F477978
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 400 | 669 | 435 |
Family's Representative Sequence
| Representative Sequence | 3300042993|Ga0439440_0011246|Ga0439440_0011246_47_1546 |
| Length | 499 |
| Sequence | MERRPRVGDEEDYAKETIIRGPQSGSAVRGLRAADCGLRAIYSPGADRAAISPESALERPTEQRVDALEQSTIARVSRRLVPFLVVCYFVAYLDRVNVSFAALTMNRDLGFSASQYGFGAGVFFLAYFLFEVPSNLLLERFGARKWIARIMFTWGLISGAMAFVGGPTSFYVLRALLGVAESGFFPGIIFYLTLWFPAVYRARIIGYFMAAIPLSTVLGAPISGLLLGLDGILGLKGWQWLFIIEAAPSLILSVVVLFYLTDRPADATWLPPQERAWLVRRLESEHAHRTSRHNLSVWQALLNPKVLALSLVYFGAVATNYGLSFFLPQIVKAFGLTNFQTGLVSALPYAVGVVSIVWWGHRSDRLRERRFHASFALAVAATGIALSTMFDNPVLKMLALSIAGFGIFGNLPVFWTLPTAFLSGAAAAGGIALINSIGNLAGFAGPYAMGAIKDLTGSYTGGLLGLSVLGFLAMTLVLVLGHDTSLEHAPEERPQSITP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 10 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 11 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 12 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 13 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 14 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 17 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 18 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 19 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 20 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 21 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 22 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 23 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 24 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 25 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 26 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 27 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 28 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 29 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 30 | 2791355199 | |||
| 31 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 32 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 33 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 34 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 35 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 36 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 37 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 38 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 39 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 40 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 41 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 42 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 43 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 44 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 45 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 46 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 47 | 2922425934 | |||
| 48 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 49 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 50 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 51 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 52 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 53 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 54 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 55 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 56 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 57 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 58 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 59 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 68 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 101 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 103 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 104 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 105 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 146 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 215 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 219 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 244 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 247 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 248 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 348 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 349 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 350 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 351 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 354 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 355 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 360 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 367 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 382 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 385 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 386 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 387 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 388 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 391 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 392 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 394 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 395 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 396 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 397 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 398 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 399 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 400 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.36 |
| Metatranscriptomes | 0.41 |
| Isolates | 8.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.38 |
| Nodule | 4.24 |
| Rhizoplane | 6.43 |
| Rhizosphere | 72.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1001010 | 3300003214 | Bacteria | 18626 |
| 2 | rootH2_10052757 | 3300003320 | Bacteria | 14719 |
| 3 | rootH1_10043004 | 3300003323 | Bacteria | 5214 |
| 4 | JGI25404J52841_10004087 | 3300003659 | Bacteria | 2934 |
| 5 | Ga0055533_1000137 | 3300003756 | Bacteria | 78353 |
| 6 | Ga0055532_1000027 | 3300003758 | Bacteria | 234571 |
| 7 | Ga0055527_1000019 | 3300003760 | Bacteria | 234571 |
| 8 | Ga0055535_1000021 | 3300003761 | Bacteria | 234571 |
| 9 | Ga0055542_1000032 | 3300003762 | Bacteria | 234571 |
| 10 | Ga0055529_1000038 | 3300003763 | Bacteria | 234571 |
| 11 | Ga0055543_1005732 | 3300004625 | Bacteria | 3124 |
| 12 | Ga0065712_10016758 | 3300005290 | Bacteria | 1549 |
| 13 | Ga0065707_10022500 | 3300005295 | Bacteria | 1909 |
| 14 | Ga0070676_10021093 | 3300005328 | Bacteria | 3645 |
| 15 | Ga0070676_10028507 | 3300005328 | Bacteria | 3172 |
| 16 | Ga0070683_100014434 | 3300005329 | Bacteria | 6910 |
| 17 | Ga0070683_100179697 | 3300005329 | Bacteria | 2008 |
| 18 | Ga0070690_100119926 | 3300005330 | Bacteria | 1764 |
| 19 | Ga0070670_100002872 | 3300005331 | Bacteria | 14262 |
| 20 | Ga0070670_100018702 | 3300005331 | Bacteria | 5938 |
| 21 | Ga0070660_100078009 | 3300005339 | Bacteria | 2597 |
| 22 | Ga0070691_10001180 | 3300005341 | Bacteria | 10937 |
| 23 | Ga0070687_100028231 | 3300005343 | Bacteria | 2719 |
| 24 | Ga0070675_100003322 | 3300005354 | Bacteria | 12198 |
| 25 | Ga0070675_100051949 | 3300005354 | Bacteria | 3369 |
| 26 | Ga0070675_100237649 | 3300005354 | Bacteria | 1591 |
| 27 | Ga0070671_100020341 | 3300005355 | Bacteria | 5412 |
| 28 | Ga0070671_100032569 | 3300005355 | Bacteria | 4309 |
| 29 | Ga0070671_100287588 | 3300005355 | Bacteria | 1399 |
| 30 | Ga0070674_100004479 | 3300005356 | Bacteria | 7972 |
| 31 | Ga0070673_100010637 | 3300005364 | Bacteria | 6237 |
| 32 | Ga0070673_100014715 | 3300005364 | Bacteria | 5464 |
| 33 | Ga0070688_100026016 | 3300005365 | Bacteria | 3472 |
| 34 | Ga0070688_100083275 | 3300005365 | Bacteria | 2075 |
| 35 | Ga0070688_100104439 | 3300005365 | Bacteria | 1873 |
| 36 | Ga0070667_100022997 | 3300005367 | Bacteria | 5169 |
| 37 | Ga0070667_100185577 | 3300005367 | Bacteria | 1841 |
| 38 | Ga0070667_100217415 | 3300005367 | Bacteria | 1700 |
| 39 | Ga0070709_10036666 | 3300005434 | Bacteria | 2989 |
| 40 | Ga0070709_10063888 | 3300005434 | Bacteria | 2352 |
| 41 | Ga0070714_100051316 | 3300005435 | Bacteria | 3516 |
| 42 | Ga0070713_100002333 | 3300005436 | Bacteria | 12376 |
| 43 | Ga0070713_100014322 | 3300005436 | Bacteria | 5884 |
| 44 | Ga0070713_100064159 | 3300005436 | Bacteria | 3082 |
| 45 | Ga0070710_10070662 | 3300005437 | Bacteria | 2011 |
| 46 | Ga0070705_100005190 | 3300005440 | Bacteria | 6327 |
| 47 | Ga0070700_100002121 | 3300005441 | Bacteria | 10060 |
| 48 | Ga0070700_100010299 | 3300005441 | Bacteria | 5159 |
| 49 | Ga0070700_100036295 | 3300005441 | Bacteria | 2988 |
| 50 | Ga0070694_100018162 | 3300005444 | Bacteria | 4460 |
| 51 | Ga0070694_100019869 | 3300005444 | Bacteria | 4276 |
| 52 | Ga0070662_100086492 | 3300005457 | Bacteria | 2345 |
| 53 | Ga0070681_10135150 | 3300005458 | Bacteria | 2397 |
| 54 | Ga0068867_100002007 | 3300005459 | Bacteria | 14213 |
| 55 | Ga0068867_100027130 | 3300005459 | Bacteria | 4115 |
| 56 | Ga0070685_10091284 | 3300005466 | Bacteria | 1844 |
| 57 | Ga0070685_10098883 | 3300005466 | Bacteria | 1778 |
| 58 | Ga0070684_100009488 | 3300005535 | Bacteria | 7666 |
| 59 | Ga0070697_100017298 | 3300005536 | Bacteria | 5671 |
| 60 | Ga0070697_100224951 | 3300005536 | Bacteria | 1599 |
| 61 | Ga0070672_100078195 | 3300005543 | Bacteria | 2647 |
| 62 | Ga0070665_100018633 | 3300005548 | Bacteria | 6957 |
| 63 | Ga0070704_100034142 | 3300005549 | Bacteria | 3446 |
| 64 | Ga0068855_100047693 | 3300005563 | Bacteria | 5060 |
| 65 | Ga0068855_100148756 | 3300005563 | Bacteria | 2664 |
| 66 | Ga0068855_100238699 | 3300005563 | Bacteria | 2032 |
| 67 | Ga0070664_100165054 | 3300005564 | Bacteria | 1962 |
| 68 | Ga0068856_100201070 | 3300005614 | Bacteria | 2007 |
| 69 | Ga0070702_100006477 | 3300005615 | Bacteria | 5545 |
| 70 | Ga0068852_100004545 | 3300005616 | Bacteria | 9820 |
| 71 | Ga0068859_100111487 | 3300005617 | Bacteria | 2799 |
| 72 | Ga0068859_100211536 | 3300005617 | Bacteria | 2026 |
| 73 | Ga0068859_100216823 | 3300005617 | Unclassified | 2001 |
| 74 | Ga0068866_10079404 | 3300005718 | Bacteria | 1758 |
| 75 | Ga0068861_100023927 | 3300005719 | Bacteria | 4411 |
| 76 | Ga0068861_100144008 | 3300005719 | Bacteria | 1948 |
| 77 | Ga0068863_100005848 | 3300005841 | Bacteria | 12052 |
| 78 | Ga0068858_100053264 | 3300005842 | Bacteria | 3743 |
| 79 | Ga0068858_100116856 | 3300005842 | Bacteria | 2493 |
| 80 | Ga0068858_100197222 | 3300005842 | Bacteria | 1903 |
| 81 | Ga0068862_100028718 | 3300005844 | Bacteria | 4684 |
| 82 | Ga0068862_100109934 | 3300005844 | Bacteria | 2419 |
| 83 | Ga0081455_10000970 | 3300005937 | Bacteria | 36631 |
| 84 | Ga0081455_10011905 | 3300005937 | Bacteria | 8708 |
| 85 | Ga0081455_10018025 | 3300005937 | Bacteria | 6743 |
| 86 | Ga0081540_1014231 | 3300005983 | Bacteria | 5112 |
| 87 | Ga0081540_1020207 | 3300005983 | Bacteria | 4016 |
| 88 | Ga0081540_1078592 | 3300005983 | Bacteria | 1495 |
| 89 | Ga0070715_10046123 | 3300006163 | Bacteria | 1851 |
| 90 | Ga0070712_100094165 | 3300006175 | Bacteria | 2200 |
| 91 | Ga0070712_100165030 | 3300006175 | Bacteria | 1713 |
| 92 | Ga0075367_10012258 | 3300006178 | Bacteria | 4564 |
| 93 | Ga0068871_100010948 | 3300006358 | Bacteria | 6644 |
| 94 | Ga0075428_100000716 | 3300006844 | Bacteria | 34355 |
| 95 | Ga0075430_100038198 | 3300006846 | Bacteria | 4069 |
| 96 | Ga0075434_100003344 | 3300006871 | Bacteria | 14354 |
| 97 | Ga0075434_100045122 | 3300006871 | Bacteria | 4372 |
| 98 | Ga0075434_100236944 | 3300006871 | Bacteria | 1845 |
| 99 | Ga0075434_100259342 | 3300006871 | Bacteria | 1757 |
| 100 | Ga0075429_100003354 | 3300006880 | Bacteria | 13653 |
| 101 | Ga0068865_100007648 | 3300006881 | Bacteria | 6656 |
| 102 | Ga0097620_100111488 | 3300006931 | Bacteria | 2799 |
| 103 | Ga0097620_100211531 | 3300006931 | Bacteria | 2026 |
| 104 | Ga0097620_100216819 | 3300006931 | Unclassified | 2001 |
| 105 | Ga0075435_100005123 | 3300007076 | Bacteria | 9109 |
| 106 | Ga0075435_100016850 | 3300007076 | Bacteria | 5517 |
| 107 | Ga0099794_10000010 | 3300007265 | Bacteria | 90057 |
| 108 | Ga0099794_10015237 | 3300007265 | Bacteria | 3389 |
| 109 | Ga0105251_10000044 | 3300009011 | Bacteria | 113730 |
| 110 | Ga0105251_10001709 | 3300009011 | Bacteria | 18381 |
| 111 | Ga0105240_10140096 | 3300009093 | Bacteria | 2892 |
| 112 | Ga0111539_10001075 | 3300009094 | Bacteria | 36049 |
| 113 | Ga0111539_10085305 | 3300009094 | Bacteria | 3712 |
| 114 | Ga0111539_10103558 | 3300009094 | Bacteria | 3340 |
| 115 | Ga0105245_10086069 | 3300009098 | Bacteria | 2882 |
| 116 | Ga0105245_10142872 | 3300009098 | Bacteria | 2256 |
| 117 | Ga0114129_10002446 | 3300009147 | Bacteria | 25786 |
| 118 | Ga0114129_10011875 | 3300009147 | Bacteria | 12387 |
| 119 | Ga0114129_10059691 | 3300009147 | Bacteria | 5332 |
| 120 | Ga0105242_10035603 | 3300009176 | Bacteria | 3991 |
| 121 | Ga0105242_10184943 | 3300009176 | Bacteria | 1841 |
| 122 | Ga0105248_10020071 | 3300009177 | Bacteria | 7402 |
| 123 | Ga0105248_10076951 | 3300009177 | Bacteria | 3750 |
| 124 | Ga0105248_10079722 | 3300009177 | Bacteria | 3680 |
| 125 | Ga0105238_10034934 | 3300009551 | Bacteria | 5113 |
| 126 | Ga0105238_10037793 | 3300009551 | Bacteria | 4906 |
| 127 | Ga0105238_10166675 | 3300009551 | Bacteria | 2179 |
| 128 | Ga0105239_10143640 | 3300010375 | Bacteria | 2660 |
| 129 | Ga0105246_10094194 | 3300011119 | Bacteria | 2165 |
| 130 | Ga0157370_10086916 | 3300013104 | Bacteria | 2937 |
| 131 | Ga0157369_10036695 | 3300013105 | Bacteria | 5369 |
| 132 | Ga0157369_10075017 | 3300013105 | Bacteria | 3626 |
| 133 | Ga0157369_10079723 | 3300013105 | Bacteria | 3507 |
| 134 | Ga0157369_10213720 | 3300013105 | Bacteria | 2021 |
| 135 | Ga0157374_10033012 | 3300013296 | Bacteria | 4720 |
| 136 | Ga0157378_10064352 | 3300013297 | Bacteria | 3280 |
| 137 | Ga0157378_10179741 | 3300013297 | Bacteria | 1990 |
| 138 | Ga0163162_10001069 | 3300013306 | Bacteria | 25456 |
| 139 | Ga0163162_10102720 | 3300013306 | Bacteria | 2952 |
| 140 | Ga0157375_10003972 | 3300013308 | Bacteria | 12828 |
| 141 | Ga0157375_10086155 | 3300013308 | Bacteria | 3192 |
| 142 | Ga0182008_10031527 | 3300014497 | Bacteria | 2668 |
| 143 | Ga0182008_10092390 | 3300014497 | Bacteria | 1493 |
| 144 | Ga0157379_10025945 | 3300014968 | Bacteria | 5212 |
| 145 | Ga0157376_10142154 | 3300014969 | Bacteria | 2154 |
| 146 | Ga0163161_10031884 | 3300017792 | Bacteria | 3758 |
| 147 | Ga0206353_10788850 | 3300020082 | Bacteria | 2056 |
| 148 | Ga0213876_10001700 | 3300021384 | Bacteria | 13392 |
| 149 | Ga0213876_10035245 | 3300021384 | Bacteria | 2640 |
| 150 | Ga0213875_10000440 | 3300021388 | Bacteria | 36355 |
| 151 | Ga0213875_10000626 | 3300021388 | Bacteria | 28206 |
| 152 | Ga0213875_10001904 | 3300021388 | Bacteria | 12907 |
| 153 | Ga0213875_10003880 | 3300021388 | Bacteria | 8367 |
| 154 | Ga0213875_10005058 | 3300021388 | Bacteria | 7142 |
| 155 | Ga0224712_10062101 | 3300022467 | Bacteria | 1492 |
| 156 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 157 | Ga0209674_100126 | 3300025226 | Bacteria | 125779 |
| 158 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 159 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 160 | Ga0209563_104793 | 3300025230 | Bacteria | 2535 |
| 161 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 162 | Ga0209677_101747 | 3300025253 | Bacteria | 9025 |
| 163 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 164 | Ga0209759_1000085 | 3300025256 | Bacteria | 168382 |
| 165 | Ga0209759_1000093 | 3300025256 | Bacteria | 159472 |
| 166 | Ga0209759_1000161 | 3300025256 | Bacteria | 115331 |
| 167 | Ga0209233_1000043 | 3300025261 | Bacteria | 509723 |
| 168 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 169 | Ga0209455_1002309 | 3300025272 | Bacteria | 7470 |
| 170 | Ga0207713_1000113 | 3300025735 | Bacteria | 132424 |
| 171 | Ga0207713_1008942 | 3300025735 | Bacteria | 5696 |
| 172 | Ga0207682_10006780 | 3300025893 | Bacteria | 4598 |
| 173 | Ga0207692_10066752 | 3300025898 | Bacteria | 1881 |
| 174 | Ga0207692_10120813 | 3300025898 | Bacteria | 1467 |
| 175 | Ga0207710_10010466 | 3300025900 | Bacteria | 3907 |
| 176 | Ga0207688_10000801 | 3300025901 | Bacteria | 15726 |
| 177 | Ga0207688_10019190 | 3300025901 | Bacteria | 3722 |
| 178 | Ga0207680_10053203 | 3300025903 | Bacteria | 2430 |
| 179 | Ga0207685_10012541 | 3300025905 | Bacteria | 2590 |
| 180 | Ga0207645_10001457 | 3300025907 | Bacteria | 19339 |
| 181 | Ga0207645_10017851 | 3300025907 | Bacteria | 4678 |
| 182 | Ga0207645_10065127 | 3300025907 | Bacteria | 2328 |
| 183 | Ga0207654_10123665 | 3300025911 | Bacteria | 1628 |
| 184 | Ga0207707_10001587 | 3300025912 | Bacteria | 20953 |
| 185 | Ga0207695_10102440 | 3300025913 | Bacteria | 2855 |
| 186 | Ga0207695_10137684 | 3300025913 | Bacteria | 2393 |
| 187 | Ga0207693_10042007 | 3300025915 | Bacteria | 3599 |
| 188 | Ga0207693_10062650 | 3300025915 | Bacteria | 2914 |
| 189 | Ga0207649_10124618 | 3300025920 | Bacteria | 1742 |
| 190 | Ga0207652_10024665 | 3300025921 | Bacteria | 4991 |
| 191 | Ga0207681_10015327 | 3300025923 | Bacteria | 4779 |
| 192 | Ga0207694_10009465 | 3300025924 | Bacteria | 7343 |
| 193 | Ga0207650_10011889 | 3300025925 | Bacteria | 5998 |
| 194 | Ga0207650_10029246 | 3300025925 | Bacteria | 3960 |
| 195 | Ga0207659_10000151 | 3300025926 | Bacteria | 41086 |
| 196 | Ga0207659_10046101 | 3300025926 | Bacteria | 3077 |
| 197 | Ga0207659_10148965 | 3300025926 | Bacteria | 1825 |
| 198 | Ga0207700_10079664 | 3300025928 | Bacteria | 2551 |
| 199 | Ga0207700_10100262 | 3300025928 | Bacteria | 2308 |
| 200 | Ga0207664_10034986 | 3300025929 | Bacteria | 3873 |
| 201 | Ga0207644_10001532 | 3300025931 | Bacteria | 14889 |
| 202 | Ga0207706_10037808 | 3300025933 | Bacteria | 4284 |
| 203 | Ga0207706_10052543 | 3300025933 | Bacteria | 3597 |
| 204 | Ga0207706_10075748 | 3300025933 | Bacteria | 2959 |
| 205 | Ga0207706_10086088 | 3300025933 | Bacteria | 2762 |
| 206 | Ga0207670_10011466 | 3300025936 | Bacteria | 5149 |
| 207 | Ga0207670_10033903 | 3300025936 | Bacteria | 3294 |
| 208 | Ga0207691_10004519 | 3300025940 | Bacteria | 13458 |
| 209 | Ga0207711_10013040 | 3300025941 | Bacteria | 6903 |
| 210 | Ga0207711_10019897 | 3300025941 | Bacteria | 5594 |
| 211 | Ga0207711_10058072 | 3300025941 | Bacteria | 3328 |
| 212 | Ga0207661_10002926 | 3300025944 | Bacteria | 11801 |
| 213 | Ga0207661_10026599 | 3300025944 | Bacteria | 4411 |
| 214 | Ga0207667_10215746 | 3300025949 | Bacteria | 1966 |
| 215 | Ga0207667_10293366 | 3300025949 | Bacteria | 1661 |
| 216 | Ga0207651_10044586 | 3300025960 | Bacteria | 2969 |
| 217 | Ga0207712_10076367 | 3300025961 | Bacteria | 2425 |
| 218 | Ga0207640_10166217 | 3300025981 | Bacteria | 1638 |
| 219 | Ga0207658_10052593 | 3300025986 | Bacteria | 3006 |
| 220 | Ga0207658_10208468 | 3300025986 | Bacteria | 1636 |
| 221 | Ga0207703_10028551 | 3300026035 | Bacteria | 4399 |
| 222 | Ga0207703_10044000 | 3300026035 | Bacteria | 3586 |
| 223 | Ga0207703_10069244 | 3300026035 | Bacteria | 2910 |
| 224 | Ga0207678_10090778 | 3300026067 | Bacteria | 2611 |
| 225 | Ga0207678_10174646 | 3300026067 | Bacteria | 1834 |
| 226 | Ga0207708_10001606 | 3300026075 | Bacteria | 16834 |
| 227 | Ga0207708_10006098 | 3300026075 | Bacteria | 8938 |
| 228 | Ga0207708_10011567 | 3300026075 | Bacteria | 6576 |
| 229 | Ga0207708_10163070 | 3300026075 | Bacteria | 1761 |
| 230 | Ga0207702_10090074 | 3300026078 | Bacteria | 2684 |
| 231 | Ga0207641_10006954 | 3300026088 | Bacteria | 9469 |
| 232 | Ga0207648_10003970 | 3300026089 | Bacteria | 15371 |
| 233 | Ga0207648_10120234 | 3300026089 | Bacteria | 2309 |
| 234 | Ga0207676_10065336 | 3300026095 | Bacteria | 2896 |
| 235 | Ga0207674_10054063 | 3300026116 | Bacteria | 4090 |
| 236 | Ga0207674_10283835 | 3300026116 | Bacteria | 1604 |
| 237 | Ga0207675_100015983 | 3300026118 | Bacteria | 7005 |
| 238 | Ga0207675_100265429 | 3300026118 | Bacteria | 1665 |
| 239 | Ga0207698_10025813 | 3300026142 | Bacteria | 4146 |
| 240 | Ga0209371_1008167 | 3300027312 | Bacteria | 3522 |
| 241 | Ga0209588_1000008 | 3300027671 | Bacteria | 177025 |
| 242 | Ga0207428_10078289 | 3300027907 | Bacteria | 2587 |
| 243 | Ga0207428_10122150 | 3300027907 | Bacteria | 1997 |
| 244 | Ga0268266_10008403 | 3300028379 | Bacteria | 9178 |
| 245 | Ga0268266_10055598 | 3300028379 | Bacteria | 3403 |
| 246 | Ga0268266_10244317 | 3300028379 | Bacteria | 1658 |
| 247 | Ga0268265_10057480 | 3300028380 | Bacteria | 2965 |
| 248 | Ga0265337_1008497 | 3300028556 | Bacteria | 3731 |
| 249 | Ga0265334_10005240 | 3300028573 | Bacteria | 5676 |
| 250 | Ga0265323_10004965 | 3300028653 | Bacteria | 5682 |
| 251 | Ga0265322_10006588 | 3300028654 | Bacteria | 3415 |
| 252 | Ga0265336_10000720 | 3300028666 | Bacteria | 17508 |
| 253 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 254 | Ga0265324_10011049 | 3300029957 | Bacteria | 3455 |
| 255 | Ga0268256_1008456 | 3300030500 | Bacteria | 3522 |
| 256 | Ga0265330_10031008 | 3300031235 | Bacteria | 2397 |
| 257 | Ga0265328_10020016 | 3300031239 | Bacteria | 2564 |
| 258 | Ga0265339_10008238 | 3300031249 | Bacteria | 6646 |
| 259 | Ga0265339_10013072 | 3300031249 | Bacteria | 5042 |
| 260 | Ga0265327_10019949 | 3300031251 | Bacteria | 4103 |
| 261 | Ga0307513_10179819 | 3300031456 | Bacteria | 1980 |
| 262 | Ga0307408_100117783 | 3300031548 | Bacteria | 2052 |
| 263 | Ga0307412_10000003 | 3300031911 | Bacteria | 659081 |
| 264 | Ga0307412_10064787 | 3300031911 | Bacteria | 2470 |
| 265 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 266 | Ga0373948_0000495 | 3300034817 | Bacteria | 4916 |
| 267 | Ga0373958_0000513 | 3300034819 | Bacteria | 4805 |
| 268 | Ga0373929_0000168 | 3300035085 | Bacteria | 11502 |
| 269 | Ga0373949_0000323 | 3300035090 | Bacteria | 16930 |
| 270 | Ga0373932_0000150 | 3300035112 | Bacteria | 19959 |
| 271 | Ga0373939_0000084 | 3300035114 | Bacteria | 29929 |
| 272 | Ga0373941_0000528 | 3300035115 | Bacteria | 7660 |
| 273 | Ga0373953_0008846 | 3300035117 | Bacteria | 3437 |
| 274 | Ga0373956_0097949 | 3300035119 | Bacteria | 1358 |
| 275 | Ga0373960_0000037 | 3300035121 | Bacteria | 17306 |
| 276 | Ga0373943_0071486 | 3300035170 | Bacteria | 1758 |
| 277 | Ga0373943_0080703 | 3300035170 | Bacteria | 1668 |
| 278 | Ga0373946_0032364 | 3300035171 | Bacteria | 2100 |
| 279 | Ga0373955_0016528 | 3300035172 | Bacteria | 3634 |
| 280 | Ga0373961_0004131 | 3300035241 | Bacteria | 3529 |
| 281 | Ga0373931_0000303 | 3300035691 | Bacteria | 20692 |
| 282 | Ga0373933_0021763 | 3300035724 | Bacteria | 3646 |
| 283 | Ga0373937_0007874 | 3300036401 | Bacteria | 9237 |
| 284 | Ga0373937_0011489 | 3300036401 | Bacteria | 7772 |
| 285 | Ga0373937_0092229 | 3300036401 | Bacteria | 2807 |
| 286 | Ga0373925_0020468 | 3300037068 | Bacteria | 4816 |
| 287 | Ga0373925_0069856 | 3300037068 | Bacteria | 2654 |
| 288 | Ga0395900_0052469 | 3300037418 | Bacteria | 4197 |
| 289 | Ga0395898_0010462 | 3300037466 | Bacteria | 9697 |
| 290 | Ga0395898_0010740 | 3300037466 | Bacteria | 9566 |
| 291 | Ga0395898_0047903 | 3300037466 | Bacteria | 4192 |
| 292 | Ga0395905_0003302 | 3300037471 | Bacteria | 17319 |
| 293 | Ga0395905_0020217 | 3300037471 | Bacteria | 6308 |
| 294 | Ga0395905_0154009 | 3300037471 | Bacteria | 2162 |
| 295 | Ga0436364_0254983 | 3300037853 | Bacteria | 7047 |
| 296 | Ga0436364_0266271 | 3300037853 | Bacteria | 210347 |
| 297 | Ga0436364_0271701 | 3300037853 | Bacteria | 23456 |
| 298 | Ga0436364_0404199 | 3300037853 | Bacteria | 41005 |
| 299 | Ga0436364_0885307 | 3300037853 | Bacteria | 2974 |
| 300 | Ga0436364_0925092 | 3300037853 | Bacteria | 3606 |
| 301 | Ga0436364_1325276 | 3300037853 | Bacteria | 58128 |
| 302 | Ga0436364_1553245 | 3300037853 | Bacteria | 44239 |
| 303 | Ga0395901_0030579 | 3300038443 | Bacteria | 5549 |
| 304 | Ga0436365_0467544 | 3300039437 | Bacteria | 8071 |
| 305 | Ga0436365_0532933 | 3300039437 | Bacteria | 3225 |
| 306 | Ga0436365_0727442 | 3300039437 | Bacteria | 2323 |
| 307 | Ga0436365_0802243 | 3300039437 | Bacteria | 3174 |
| 308 | Ga0436360_0360856 | 3300039438 | Bacteria | 5711 |
| 309 | Ga0436360_0389184 | 3300039438 | Bacteria | 1978 |
| 310 | Ga0436360_0742611 | 3300039438 | Bacteria | 1508 |
| 311 | Ga0436361_0043228 | 3300039447 | Bacteria | 3343 |
| 312 | Ga0436361_0083385 | 3300039447 | Bacteria | 5752 |
| 313 | Ga0436361_1119041 | 3300039447 | Bacteria | 2739 |
| 314 | Ga0436362_0317323 | 3300039453 | Bacteria | 2406 |
| 315 | Ga0439450_002885 | 3300042008 | Bacteria | 2770 |
| 316 | Ga0439464_0002113 | 3300042439 | Bacteria | 4844 |
| 317 | Ga0439440_0011246 | 3300042993 | Bacteria | 1885 |
| 318 | Ga0466969_0008115 | 3300044656 | Bacteria | 5573 |
| 319 | Ga0466972_0067295 | 3300044658 | Bacteria | 1711 |
| 320 | Ga0466965_0036409 | 3300044683 | Bacteria | 2414 |
| 321 | Ga0466966_0027864 | 3300044684 | Bacteria | 3682 |
| 322 | Ga0466966_0033398 | 3300044684 | Bacteria | 3332 |
| 323 | Ga0466966_0082178 | 3300044684 | Bacteria | 2005 |
| 324 | Ga0466970_0003997 | 3300044765 | Bacteria | 7235 |
| 325 | Ga0466957_0104811 | 3300044842 | Bacteria | 1787 |
| 326 | Ga0466960_0019221 | 3300044901 | Bacteria | 3007 |
| 327 | Ga0466959_0111990 | 3300045049 | Bacteria | 1947 |
| 328 | Ga0451576_0035940 | 3300045051 | Bacteria | 5254 |
| 329 | Ga0466967_0061292 | 3300045976 | Bacteria | 3337 |
| 330 | Ga0495592_0003685 | 3300046454 | Bacteria | 11042 |
| 331 | Ga0495592_0048855 | 3300046454 | Bacteria | 3146 |
| 332 | Ga0495603_0002386 | 3300046455 | Bacteria | 11045 |
| 333 | Ga0495603_0029609 | 3300046455 | Bacteria | 3301 |
| 334 | Ga0495603_0046516 | 3300046455 | Bacteria | 2585 |
| 335 | Ga0495603_0099314 | 3300046455 | Bacteria | 1700 |
| 336 | Ga0495590_0002665 | 3300046457 | Bacteria | 7378 |
| 337 | Ga0495590_0005975 | 3300046457 | Bacteria | 4772 |
| 338 | Ga0495590_0013325 | 3300046457 | Bacteria | 3026 |
| 339 | Ga0495591_012419 | 3300046458 | Bacteria | 3173 |
| 340 | Ga0495591_019645 | 3300046458 | Bacteria | 2255 |
| 341 | Ga0495629_0000047 | 3300046459 | Bacteria | 109814 |
| 342 | Ga0495629_0000287 | 3300046459 | Bacteria | 43583 |
| 343 | Ga0495629_0009388 | 3300046459 | Bacteria | 7156 |
| 344 | Ga0495629_0010780 | 3300046459 | Bacteria | 6648 |
| 345 | Ga0495629_0011415 | 3300046459 | Bacteria | 6453 |
| 346 | Ga0495629_0103896 | 3300046459 | Bacteria | 1982 |
| 347 | Ga0495638_0026787 | 3300046460 | Bacteria | 3735 |
| 348 | Ga0495638_0032135 | 3300046460 | Bacteria | 3367 |
| 349 | Ga0495651_0011893 | 3300046462 | Bacteria | 6695 |
| 350 | Ga0495651_0036647 | 3300046462 | Bacteria | 3818 |
| 351 | Ga0495651_0083835 | 3300046462 | Bacteria | 2402 |
| 352 | Ga0495653_0000049 | 3300046463 | Bacteria | 108478 |
| 353 | Ga0495653_0003218 | 3300046463 | Bacteria | 13083 |
| 354 | Ga0495653_0003314 | 3300046463 | Bacteria | 12931 |
| 355 | Ga0495653_0042266 | 3300046463 | Bacteria | 3551 |
| 356 | Ga0495653_0051619 | 3300046463 | Bacteria | 3156 |
| 357 | Ga0495653_0052445 | 3300046463 | Bacteria | 3125 |
| 358 | Ga0495650_0002989 | 3300046471 | Bacteria | 12804 |
| 359 | Ga0495650_0007998 | 3300046471 | Bacteria | 6254 |
| 360 | Ga0495580_0000414 | 3300046472 | Bacteria | 35350 |
| 361 | Ga0495580_0000860 | 3300046472 | Bacteria | 26230 |
| 362 | Ga0495580_0002553 | 3300046472 | Bacteria | 15863 |
| 363 | Ga0495580_0003175 | 3300046472 | Bacteria | 14083 |
| 364 | Ga0495580_0031640 | 3300046472 | Bacteria | 3822 |
| 365 | Ga0495582_0002422 | 3300046473 | Bacteria | 10417 |
| 366 | Ga0495605_0006007 | 3300046474 | Bacteria | 7018 |
| 367 | Ga0495605_0013244 | 3300046474 | Bacteria | 4553 |
| 368 | Ga0495639_0036017 | 3300046475 | Bacteria | 2215 |
| 369 | Ga0495664_0003118 | 3300046477 | Bacteria | 9004 |
| 370 | Ga0495664_0010147 | 3300046477 | Bacteria | 5285 |
| 371 | Ga0495664_0015269 | 3300046477 | Bacteria | 4363 |
| 372 | Ga0495664_0138763 | 3300046477 | Bacteria | 1473 |
| 373 | Ga0495585_0020478 | 3300046492 | Bacteria | 3805 |
| 374 | Ga0495596_0001422 | 3300046500 | Bacteria | 13732 |
| 375 | Ga0495607_0029182 | 3300046501 | Bacteria | 3397 |
| 376 | Ga0495583_0013422 | 3300046506 | Bacteria | 4568 |
| 377 | Ga0495606_0001644 | 3300046507 | Bacteria | 29139 |
| 378 | Ga0495606_0002954 | 3300046507 | Bacteria | 18729 |
| 379 | Ga0495606_0082955 | 3300046507 | Bacteria | 1988 |
| 380 | Ga0495606_0085171 | 3300046507 | Bacteria | 1955 |
| 381 | Ga0495608_0003678 | 3300046511 | Bacteria | 11022 |
| 382 | Ga0495608_0010063 | 3300046511 | Bacteria | 6598 |
| 383 | Ga0495608_0020118 | 3300046511 | Bacteria | 4589 |
| 384 | Ga0495608_0105684 | 3300046511 | Bacteria | 1813 |
| 385 | Ga0495610_0009776 | 3300046512 | Bacteria | 6026 |
| 386 | Ga0495618_0002191 | 3300046514 | Bacteria | 12777 |
| 387 | Ga0495618_0015313 | 3300046514 | Bacteria | 4679 |
| 388 | Ga0495618_0058946 | 3300046514 | Bacteria | 2432 |
| 389 | Ga0495620_0025837 | 3300046515 | Bacteria | 2771 |
| 390 | Ga0495628_0004242 | 3300046516 | Bacteria | 12746 |
| 391 | Ga0495628_0025538 | 3300046516 | Bacteria | 4825 |
| 392 | Ga0495628_0036048 | 3300046516 | Bacteria | 3972 |
| 393 | Ga0495630_0001867 | 3300046517 | Bacteria | 14692 |
| 394 | Ga0495630_0017745 | 3300046517 | Bacteria | 5219 |
| 395 | Ga0495630_0054091 | 3300046517 | Bacteria | 3007 |
| 396 | Ga0495630_0054612 | 3300046517 | Bacteria | 2992 |
| 397 | Ga0495630_0163141 | 3300046517 | Bacteria | 1696 |
| 398 | Ga0495643_0065027 | 3300046522 | Bacteria | 1926 |
| 399 | Ga0495644_0008402 | 3300046523 | Bacteria | 3977 |
| 400 | Ga0495648_0004447 | 3300046524 | Bacteria | 11976 |
| 401 | Ga0495648_0006073 | 3300046524 | Bacteria | 9911 |
| 402 | Ga0495648_0094933 | 3300046524 | Bacteria | 1660 |
| 403 | Ga0495666_0000624 | 3300046526 | Bacteria | 15954 |
| 404 | Ga0495666_0001763 | 3300046526 | Bacteria | 10673 |
| 405 | Ga0495642_0005507 | 3300046528 | Bacteria | 4863 |
| 406 | Ga0495652_0008175 | 3300046529 | Bacteria | 9566 |
| 407 | Ga0495652_0027851 | 3300046529 | Bacteria | 4976 |
| 408 | Ga0495652_0051284 | 3300046529 | Bacteria | 3524 |
| 409 | Ga0495652_0069097 | 3300046529 | Bacteria | 2958 |
| 410 | Ga0495652_0114387 | 3300046529 | Bacteria | 2164 |
| 411 | Ga0495652_0193740 | 3300046529 | Bacteria | 1549 |
| 412 | Ga0495654_0040309 | 3300046530 | Bacteria | 2328 |
| 413 | Ga0495665_0000184 | 3300046531 | Bacteria | 31944 |
| 414 | Ga0495665_0025694 | 3300046531 | Bacteria | 3162 |
| 415 | Ga0495640_0011178 | 3300046533 | Bacteria | 6910 |
| 416 | Ga0495640_0013091 | 3300046533 | Bacteria | 6315 |
| 417 | Ga0495640_0044020 | 3300046533 | Bacteria | 3105 |
| 418 | Ga0495587_0003817 | 3300046536 | Bacteria | 9997 |
| 419 | Ga0495587_0043474 | 3300046536 | Bacteria | 2675 |
| 420 | Ga0495597_0006750 | 3300046542 | Bacteria | 5908 |
| 421 | Ga0495645_0000308 | 3300046543 | Bacteria | 35334 |
| 422 | Ga0495645_0022747 | 3300046543 | Bacteria | 4535 |
| 423 | Ga0495645_0052674 | 3300046543 | Bacteria | 2960 |
| 424 | Ga0495667_0007142 | 3300046559 | Bacteria | 7575 |
| 425 | Ga0495656_0038668 | 3300046615 | Bacteria | 1978 |
| 426 | Ga0495634_0003782 | 3300046642 | Bacteria | 12022 |
| 427 | Ga0495634_0019842 | 3300046642 | Bacteria | 4771 |
| 428 | Ga0495634_0071053 | 3300046642 | Bacteria | 2293 |
| 429 | Ga0495611_0072507 | 3300046648 | Bacteria | 1576 |
| 430 | Ga0495635_0001524 | 3300046663 | Bacteria | 15504 |
| 431 | Ga0495635_0033472 | 3300046663 | Bacteria | 3565 |
| 432 | Ga0495635_0061105 | 3300046663 | Bacteria | 2588 |
| 433 | Ga0495661_0009216 | 3300046665 | Bacteria | 6782 |
| 434 | Ga0495661_0020504 | 3300046665 | Bacteria | 4314 |
| 435 | Ga0495661_0029145 | 3300046665 | Bacteria | 3526 |
| 436 | Ga0495657_0005049 | 3300046675 | Bacteria | 10483 |
| 437 | Ga0495599_0007673 | 3300046678 | Bacteria | 6553 |
| 438 | Ga0495599_0019554 | 3300046678 | Bacteria | 4221 |
| 439 | Ga0495599_0032833 | 3300046678 | Bacteria | 3259 |
| 440 | Ga0495599_0061613 | 3300046678 | Bacteria | 2344 |
| 441 | Ga0495599_0100124 | 3300046678 | Bacteria | 1806 |
| 442 | Ga0495599_0110563 | 3300046678 | Bacteria | 1712 |
| 443 | Ga0495623_0001022 | 3300046679 | Bacteria | 18934 |
| 444 | Ga0495623_0007081 | 3300046679 | Bacteria | 7290 |
| 445 | Ga0495623_0057642 | 3300046679 | Bacteria | 2443 |
| 446 | Ga0495646_0002308 | 3300046680 | Bacteria | 11673 |
| 447 | Ga0495646_0002989 | 3300046680 | Bacteria | 10483 |
| 448 | Ga0495646_0014296 | 3300046680 | Bacteria | 5049 |
| 449 | Ga0495646_0027334 | 3300046680 | Bacteria | 3579 |
| 450 | Ga0495646_0035672 | 3300046680 | Bacteria | 3084 |
| 451 | Ga0495669_0001826 | 3300046684 | Bacteria | 8708 |
| 452 | Ga0495669_0026421 | 3300046684 | Bacteria | 2537 |
| 453 | Ga0495669_0073600 | 3300046684 | Bacteria | 1561 |
| 454 | Ga0495669_0084387 | 3300046684 | Bacteria | 1461 |
| 455 | Ga0495613_0004361 | 3300046689 | Bacteria | 10586 |
| 456 | Ga0495613_0018890 | 3300046689 | Bacteria | 5135 |
| 457 | Ga0495613_0152476 | 3300046689 | Bacteria | 1647 |
| 458 | Ga0495624_0000148 | 3300046690 | Bacteria | 51192 |
| 459 | Ga0495624_0000578 | 3300046690 | Bacteria | 28629 |
| 460 | Ga0495624_0008776 | 3300046690 | Bacteria | 7029 |
| 461 | Ga0495624_0027521 | 3300046690 | Bacteria | 3722 |
| 462 | Ga0495624_0081592 | 3300046690 | Bacteria | 2002 |
| 463 | Ga0495670_0007124 | 3300046691 | Bacteria | 5505 |
| 464 | Ga0495670_0008471 | 3300046691 | Bacteria | 5057 |
| 465 | Ga0495671_0040019 | 3300046692 | Bacteria | 2365 |
| 466 | Ga0495649_0002847 | 3300046694 | Bacteria | 12009 |
| 467 | Ga0495649_0018234 | 3300046694 | Bacteria | 3953 |
| 468 | Ga0495649_0019991 | 3300046694 | Bacteria | 3758 |
| 469 | Ga0495649_0039484 | 3300046694 | Bacteria | 2587 |
| 470 | Ga0495589_0002507 | 3300046794 | Bacteria | 10250 |
| 471 | Ga0495589_0009377 | 3300046794 | Bacteria | 5090 |
| 472 | Ga0495589_0033249 | 3300046794 | Bacteria | 2591 |
| 473 | Ga0495589_0042375 | 3300046794 | Bacteria | 2268 |
| 474 | Ga0495600_0016638 | 3300046809 | Bacteria | 4672 |
| 475 | Ga0495600_0020283 | 3300046809 | Bacteria | 4251 |
| 476 | Ga0495660_0096975 | 3300046810 | Bacteria | 1523 |
| 477 | Ga0495581_0007802 | 3300047315 | Bacteria | 6198 |
| 478 | Ga0495581_0013578 | 3300047315 | Bacteria | 4724 |
| 479 | Ga0495581_0061318 | 3300047315 | Bacteria | 2173 |
| 480 | Ga0495581_0078355 | 3300047315 | Bacteria | 1912 |
| 481 | Ga0495604_0002912 | 3300047317 | Bacteria | 13721 |
| 482 | Ga0495604_0011973 | 3300047317 | Bacteria | 6895 |
| 483 | Ga0495604_0013666 | 3300047317 | Bacteria | 6475 |
| 484 | Ga0495604_0023339 | 3300047317 | Bacteria | 4934 |
| 485 | Ga0495604_0044079 | 3300047317 | Bacteria | 3488 |
| 486 | Ga0495604_0044369 | 3300047317 | Bacteria | 3474 |
| 487 | Ga0495604_0072807 | 3300047317 | Bacteria | 2595 |
| 488 | Ga0495674_0017601 | 3300047319 | Bacteria | 6653 |
| 489 | Ga0495674_0018306 | 3300047319 | Bacteria | 6522 |
| 490 | Ga0495674_0020127 | 3300047319 | Bacteria | 6182 |
| 491 | Ga0495674_0027499 | 3300047319 | Bacteria | 5198 |
| 492 | Ga0495674_0032646 | 3300047319 | Bacteria | 4721 |
| 493 | Ga0495674_0060134 | 3300047319 | Bacteria | 3316 |
| 494 | Ga0495674_0068785 | 3300047319 | Bacteria | 3063 |
| 495 | Ga0495674_0215839 | 3300047319 | Bacteria | 1587 |
| 496 | Ga0495672_0019038 | 3300047320 | Bacteria | 4539 |
| 497 | Ga0495676_0007935 | 3300047321 | Bacteria | 9734 |
| 498 | Ga0495676_0031142 | 3300047321 | Bacteria | 4515 |
| 499 | Ga0495676_0131922 | 3300047321 | Bacteria | 1802 |
| 500 | Ga0495680_0016843 | 3300047322 | Bacteria | 6262 |
| 501 | Ga0495680_0018452 | 3300047322 | Bacteria | 5923 |
| 502 | Ga0495680_0023652 | 3300047322 | Bacteria | 5105 |
| 503 | Ga0495680_0029524 | 3300047322 | Bacteria | 4490 |
| 504 | Ga0495680_0105060 | 3300047322 | Bacteria | 2100 |
| 505 | Ga0495683_0000523 | 3300047323 | Bacteria | 29254 |
| 506 | Ga0495683_0000761 | 3300047323 | Bacteria | 23227 |
| 507 | Ga0495683_0001566 | 3300047323 | Bacteria | 14818 |
| 508 | Ga0495683_0012608 | 3300047323 | Bacteria | 4439 |
| 509 | Ga0495683_0042978 | 3300047323 | Bacteria | 2277 |
| 510 | Ga0495687_000018 | 3300047443 | Bacteria | 342973 |
| 511 | Ga0495687_000022 | 3300047443 | Bacteria | 327353 |
| 512 | Ga0495687_018846 | 3300047443 | Bacteria | 3400 |
| 513 | Ga0495675_0004474 | 3300047444 | Bacteria | 8466 |
| 514 | Ga0495675_0029029 | 3300047444 | Bacteria | 3526 |
| 515 | Ga0495675_0036787 | 3300047444 | Bacteria | 3120 |
| 516 | Ga0495675_0105152 | 3300047444 | Bacteria | 1764 |
| 517 | Ga0495679_000041 | 3300047446 | Bacteria | 147336 |
| 518 | Ga0495679_002330 | 3300047446 | Bacteria | 9755 |
| 519 | Ga0495679_002470 | 3300047446 | Bacteria | 9402 |
| 520 | Ga0495673_0012383 | 3300047469 | Bacteria | 4530 |
| 521 | Ga0495673_0047917 | 3300047469 | Bacteria | 1886 |
| 522 | Ga0495684_0024367 | 3300047471 | Bacteria | 4659 |
| 523 | Ga0495684_0090769 | 3300047471 | Bacteria | 2314 |
| 524 | Ga0495686_0000099 | 3300047472 | Bacteria | 180546 |
| 525 | Ga0495686_0004668 | 3300047472 | Bacteria | 11120 |
| 526 | Ga0495686_0017071 | 3300047472 | Bacteria | 4901 |
| 527 | Ga0495686_0021136 | 3300047472 | Bacteria | 4329 |
| 528 | Ga0495593_0002613 | 3300047673 | Bacteria | 10829 |
| 529 | Ga0495593_0004417 | 3300047673 | Bacteria | 8357 |
| 530 | Ga0495593_0006594 | 3300047673 | Bacteria | 6795 |
| 531 | Ga0495593_0010960 | 3300047673 | Bacteria | 5219 |
| 532 | Ga0495593_0021813 | 3300047673 | Bacteria | 3573 |
| 533 | Ga0495593_0071574 | 3300047673 | Bacteria | 1800 |
| 534 | Ga0495602_0001075 | 3300048088 | Bacteria | 26813 |
| 535 | Ga0495602_0015644 | 3300048088 | Bacteria | 7648 |
| 536 | Ga0495602_0028841 | 3300048088 | Bacteria | 5302 |
| 537 | Ga0495602_0130464 | 3300048088 | Bacteria | 2005 |
| 538 | Ga0495614_0006254 | 3300048089 | Bacteria | 5350 |
| 539 | Ga0495614_0008107 | 3300048089 | Bacteria | 4670 |
| 540 | Ga0495614_0024828 | 3300048089 | Bacteria | 2587 |
| 541 | Ga0495614_0038608 | 3300048089 | Bacteria | 2049 |
| 542 | Ga0496100_0101914 | 3300048903 | Bacteria | 1980 |
| 543 | Ga0496100_0155868 | 3300048903 | Bacteria | 1633 |
| 544 | Ga0496101_0026165 | 3300048904 | Bacteria | 4055 |
| 545 | Ga0496101_0049720 | 3300048904 | Bacteria | 3017 |
| 546 | Ga0496101_0092639 | 3300048904 | Bacteria | 2250 |
| 547 | Ga0496101_0140515 | 3300048904 | Bacteria | 1840 |
| 548 | Ga0496102_0022584 | 3300048905 | Bacteria | 5574 |
| 549 | Ga0496102_0023131 | 3300048905 | Bacteria | 5515 |
| 550 | Ga0496102_0092975 | 3300048905 | Bacteria | 2794 |
| 551 | Ga0496103_0003842 | 3300048906 | Bacteria | 9141 |
| 552 | Ga0496103_0008845 | 3300048906 | Bacteria | 5973 |
| 553 | Ga0496104_0098062 | 3300048907 | Bacteria | 2805 |
| 554 | Ga0496104_0121550 | 3300048907 | Bacteria | 2507 |
| 555 | Ga0496105_0019340 | 3300048908 | Bacteria | 5492 |
| 556 | Ga0496105_0021573 | 3300048908 | Bacteria | 5213 |
| 557 | Ga0496105_0062093 | 3300048908 | Bacteria | 3084 |
| 558 | Ga0496105_0126428 | 3300048908 | Bacteria | 2107 |
| 559 | Ga0496106_0000051 | 3300048909 | Bacteria | 95750 |
| 560 | Ga0496106_0017680 | 3300048909 | Bacteria | 5274 |
| 561 | Ga0496106_0022950 | 3300048909 | Bacteria | 4634 |
| 562 | Ga0496107_0009531 | 3300048910 | Bacteria | 6738 |
| 563 | Ga0496107_0018666 | 3300048910 | Bacteria | 4886 |
| 564 | Ga0496108_0071329 | 3300048911 | Bacteria | 2931 |
| 565 | Ga0496109_0010742 | 3300048912 | Bacteria | 7837 |
| 566 | Ga0496109_0041224 | 3300048912 | Bacteria | 4183 |
| 567 | Ga0496109_0254514 | 3300048912 | Bacteria | 1654 |
| 568 | Ga0496110_0003254 | 3300048913 | Bacteria | 12382 |
| 569 | Ga0496110_0037301 | 3300048913 | Bacteria | 4224 |
| 570 | Ga0496110_0068709 | 3300048913 | Bacteria | 3136 |
| 571 | Ga0496110_0135186 | 3300048913 | Bacteria | 2227 |
| 572 | Ga0496111_0006394 | 3300048914 | Bacteria | 7646 |
| 573 | Ga0496112_0002364 | 3300048915 | Bacteria | 15157 |
| 574 | Ga0496112_0004419 | 3300048915 | Bacteria | 11904 |
| 575 | Ga0496112_0017474 | 3300048915 | Bacteria | 6739 |
| 576 | Ga0496112_0050969 | 3300048915 | Bacteria | 4060 |
| 577 | Ga0496112_0099048 | 3300048915 | Bacteria | 2885 |
| 578 | Ga0496113_0001917 | 3300048916 | Bacteria | 11882 |
| 579 | Ga0496113_0025143 | 3300048916 | Bacteria | 4242 |
| 580 | Ga0496113_0030239 | 3300048916 | Bacteria | 3919 |
| 581 | Ga0496114_0000869 | 3300048917 | Bacteria | 22582 |
| 582 | Ga0496115_0021018 | 3300048918 | Bacteria | 5037 |
| 583 | Ga0496115_0032847 | 3300048918 | Bacteria | 4096 |
| 584 | Ga0496115_0084565 | 3300048918 | Bacteria | 2587 |
| 585 | Ga0496115_0108082 | 3300048918 | Bacteria | 2284 |
| 586 | Ga0496115_0113677 | 3300048918 | Bacteria | 2225 |
| 587 | Ga0496116_0000899 | 3300048919 | Bacteria | 36846 |
| 588 | Ga0496116_0026117 | 3300048919 | Bacteria | 4277 |
| 589 | Ga0496117_0004613 | 3300048920 | Bacteria | 15034 |
| 590 | Ga0496117_0024602 | 3300048920 | Bacteria | 4757 |
| 591 | Ga0496117_0031521 | 3300048920 | Bacteria | 4044 |
| 592 | Ga0496117_0032823 | 3300048920 | Bacteria | 3937 |
| 593 | Ga0496117_0114769 | 3300048920 | Bacteria | 1668 |
| 594 | Ga0496118_0001256 | 3300048921 | Bacteria | 38929 |
| 595 | Ga0496118_0007222 | 3300048921 | Bacteria | 11859 |
| 596 | Ga0496118_0038761 | 3300048921 | Bacteria | 3814 |
| 597 | Ga0496118_0109296 | 3300048921 | Bacteria | 1841 |
| 598 | Ga0496119_0036649 | 3300048922 | Bacteria | 3199 |
| 599 | Ga0496119_0115197 | 3300048922 | Bacteria | 1485 |
| 600 | Ga0496120_0016688 | 3300048923 | Bacteria | 4791 |
| 601 | Ga0496121_0000491 | 3300048924 | Bacteria | 75865 |
| 602 | Ga0496121_0003581 | 3300048924 | Bacteria | 21934 |
| 603 | Ga0496121_0012704 | 3300048924 | Bacteria | 9138 |
| 604 | Ga0496121_0016512 | 3300048924 | Bacteria | 7617 |
| 605 | Ga0496121_0018490 | 3300048924 | Bacteria | 7023 |
| 606 | Ga0496121_0024493 | 3300048924 | Bacteria | 5768 |
| 607 | Ga0496121_0061503 | 3300048924 | Bacteria | 3081 |
| 608 | Ga0496122_0000179 | 3300048925 | Bacteria | 149332 |
| 609 | Ga0496122_0006588 | 3300048925 | Bacteria | 13254 |
| 610 | Ga0496123_0000305 | 3300048926 | Bacteria | 95376 |
| 611 | Ga0496124_0004561 | 3300048927 | Bacteria | 16098 |
| 612 | Ga0496124_0074473 | 3300048927 | Bacteria | 2806 |
| 613 | Ga0496125_0001319 | 3300048928 | Bacteria | 36659 |
| 614 | Ga0496125_0014613 | 3300048928 | Bacteria | 7634 |
| 615 | Ga0496125_0033439 | 3300048928 | Bacteria | 4550 |
| 616 | Ga0496126_0000031 | 3300048929 | Bacteria | 373371 |
| 617 | Ga0496126_0000297 | 3300048929 | Bacteria | 106129 |
| 618 | Ga0496126_0000506 | 3300048929 | Bacteria | 76527 |
| 619 | Ga0496126_0001335 | 3300048929 | Bacteria | 39121 |
| 620 | Ga0496126_0015062 | 3300048929 | Bacteria | 7794 |
| 621 | Ga0496126_0026463 | 3300048929 | Bacteria | 5562 |
| 622 | Ga0496126_0032036 | 3300048929 | Bacteria | 4958 |
| 623 | Ga0496126_0045397 | 3300048929 | Bacteria | 4039 |
| 624 | Ga0496126_0096717 | 3300048929 | Bacteria | 2588 |
| 625 | Ga0495678_023367 | 3300049459 | Bacteria | 2687 |
| 626 | Ga0501291_003411 | 3300049514 | Bacteria | 1974 |
| 627 | Ga0501034_0068901 | 3300049571 | Bacteria | 3548 |
| 628 | Ga0501043_0086713 | 3300049579 | Bacteria | 2460 |
| 629 | Ga0501046_0018761 | 3300049580 | Bacteria | 5749 |
| 630 | Ga0501047_0006979 | 3300049581 | Bacteria | 10603 |
| 631 | Ga0501070_0019038 | 3300049586 | Bacteria | 5758 |
| 632 | Ga0501074_0038057 | 3300049590 | Bacteria | 3486 |
| 633 | Ga0501202_017281 | 3300049652 | Bacteria | 1408 |
| 634 | Ga0501080_0005410 | 3300049742 | Bacteria | 11388 |
| 635 | Ga0501044_0081437 | 3300049823 | Bacteria | 3277 |
| 636 | nmdc:mga05p37_12043_c1 | 3300050507 | Bacteria | 10321 |
| 637 | nmdc:mga05p37_3101_c1 | 3300050507 | Bacteria | 19316 |
| 638 | nmdc:mga05p37_8693_c1 | 3300050507 | Bacteria | 11999 |
| 639 | nmdc:mga09592_3091_c1 | 3300050508 | Bacteria | 13506 |
| 640 | nmdc:mga09592_3337_c1 | 3300050508 | Bacteria | 12982 |
| 641 | nmdc:mga0qj67_12694_c1 | 3300050509 | Bacteria | 6353 |
| 642 | nmdc:mga06r32_18406_c1 | 3300050510 | Bacteria | 6397 |
| 643 | nmdc:mga06r32_43055_c1 | 3300050510 | Bacteria | 4295 |
| 644 | nmdc:mga08y16_123590_c1 | 3300050511 | Bacteria | 2693 |
| 645 | nmdc:mga08y16_91172_c1 | 3300050511 | Bacteria | 3177 |
| 646 | nmdc:mga0n895_114998_c1 | 3300050512 | Bacteria | 2708 |
| 647 | nmdc:mga0n895_46067_c1 | 3300050512 | Bacteria | 4259 |
| 648 | nmdc:mga0n895_61515_c1 | 3300050512 | Bacteria | 3707 |
| 649 | nmdc:mga0rr50_10716_c1 | 3300050513 | Bacteria | 5838 |
| 650 | nmdc:mga0rr50_1562_c1 | 3300050513 | Bacteria | 12631 |
| 651 | nmdc:mga0rr50_4849_c1 | 3300050513 | Bacteria | 7954 |
| 652 | nmdc:mga0a205_130175_c1 | 3300050515 | Bacteria | 2417 |
| 653 | Ga0495601_0010465 | 3300053077 | Bacteria | 5520 |
| 654 | Ga0495595_0003601 | 3300053084 | Bacteria | 6155 |
| 655 | Ga0495619_0003266 | 3300053085 | Bacteria | 10485 |
| 656 | Ga0500644_0008217 | 3300053088 | Bacteria | 2748 |
| 657 | Ga0500651_0122322 | 3300053093 | Bacteria | 1579 |
| 658 | Ga0500566_0001270 | 3300053094 | Bacteria | 14724 |
| 659 | Ga0500556_0000012 | 3300053104 | Bacteria | 250391 |
| 660 | Ga0500642_0000110 | 3300053130 | Bacteria | 38826 |
| 661 | Ga0500652_000566 | 3300053131 | Bacteria | 12950 |
| 662 | Ga0500559_0000198 | 3300053136 | Bacteria | 47902 |
| 663 | Ga0500568_0003536 | 3300053139 | Bacteria | 8657 |
| 664 | Ga0500604_0012577 | 3300053151 | Bacteria | 2286 |
| 665 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 666 | Ga0500622_0000885 | 3300053156 | Bacteria | 25488 |
| 667 | Ga0500636_0036660 | 3300053177 | Bacteria | 2901 |
| 668 | Ga0587069_004949 | 3300059642 | Bacteria | 1525 |
| 669 | Ga0466962_0031098 | 3300061719 | Bacteria | 2556 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0037301 | Ga0496110_0037301_12_1100 | 352 |
| 2 | 3300048920 | Ga0496117_0114769 | Ga0496117_0114769_34_1209 | 360 |
| 3 | 3300048913 | Ga0496110_0135186 | Ga0496110_0135186_26_1246 | 367 |
| 4 | 3300005367 | Ga0070667_100217415 | Ga0070667_1002174151 | 375 |
| 5 | 3300025907 | Ga0207645_10065127 | Ga0207645_100651271 | 375 |
| 6 | 3300048904 | Ga0496101_0140515 | Ga0496101_0140515_430_1764 | 375 |
| 7 | 3300005355 | Ga0070671_100032569 | Ga0070671_1000325693 | 377 |
| 8 | 3300005331 | Ga0070670_100002872 | Ga0070670_1000028721 | 379 |
| 9 | 3300005354 | Ga0070675_100051949 | Ga0070675_1000519492 | 379 |
| 10 | 3300005364 | Ga0070673_100014715 | Ga0070673_1000147152 | 379 |
| 11 | 3300005564 | Ga0070664_100165054 | Ga0070664_1001650542 | 379 |
| 12 | 3300005617 | Ga0068859_100211536 | Ga0068859_1002115362 | 379 |
| 13 | 3300005842 | Ga0068858_100197222 | Ga0068858_1001972222 | 379 |
| 14 | 3300006175 | Ga0070712_100094165 | Ga0070712_1000941652 | 379 |
| 15 | 3300006931 | Ga0097620_100211531 | Ga0097620_1002115311 | 379 |
| 16 | 3300009098 | Ga0105245_10086069 | Ga0105245_100860692 | 379 |
| 17 | 3300025915 | Ga0207693_10042007 | Ga0207693_100420072 | 379 |
| 18 | 3300025925 | Ga0207650_10011889 | Ga0207650_100118891 | 379 |
| 19 | 3300025926 | Ga0207659_10046101 | Ga0207659_100461013 | 379 |
| 20 | 3300025931 | Ga0207644_10001532 | Ga0207644_100015324 | 379 |
| 21 | 3300025936 | Ga0207670_10033903 | Ga0207670_100339033 | 379 |
| 22 | 3300025960 | Ga0207651_10044586 | Ga0207651_100445862 | 379 |
| 23 | 3300025986 | Ga0207658_10208468 | Ga0207658_102084682 | 379 |
| 24 | 3300026035 | Ga0207703_10069244 | Ga0207703_100692442 | 379 |
| 25 | 3300028379 | Ga0268266_10055598 | Ga0268266_100555982 | 379 |
| 26 | 3300048903 | Ga0496100_0101914 | Ga0496100_0101914_342_1676 | 379 |
| 27 | 3300048905 | Ga0496102_0092975 | Ga0496102_0092975_453_1790 | 379 |
| 28 | 3300048912 | Ga0496109_0041224 | Ga0496109_0041224_1422_2759 | 379 |
| 29 | 3300048915 | Ga0496112_0004419 | Ga0496112_0004419_10247_11584 | 379 |
| 30 | 3300046463 | Ga0495653_0042266 | Ga0495653_0042266_14_1282 | 383 |
| 31 | 3300048904 | Ga0496101_0049720 | Ga0496101_0049720_315_1664 | 386 |
| 32 | 3300004625 | Ga0055543_1005732 | Ga0055543_10057322 | 387 |
| 33 | 3300006175 | Ga0070712_100165030 | Ga0070712_1001650302 | 387 |
| 34 | 3300035172 | Ga0373955_0016528 | Ga0373955_0016528_1973_3310 | 387 |
| 35 | 3300036401 | Ga0373937_0007874 | Ga0373937_0007874_2932_4269 | 387 |
| 36 | 3300046463 | Ga0495653_0051619 | Ga0495653_0051619_434_1771 | 387 |
| 37 | 3300046678 | Ga0495599_0019554 | Ga0495599_0019554_2322_3659 | 387 |
| 38 | 3300047317 | Ga0495604_0011973 | Ga0495604_0011973_696_2033 | 387 |
| 39 | 3300020082 | Ga0206353_10788850 | Ga0206353_107888502 | 388 |
| 40 | 3300028556 | Ga0265337_1008497 | Ga0265337_10084972 | 389 |
| 41 | 3300046511 | Ga0495608_0105684 | Ga0495608_0105684_25_1290 | 389 |
| 42 | 3300049571 | Ga0501034_0068901 | Ga0501034_0068901_1702_3060 | 392 |
| 43 | 3300049579 | Ga0501043_0086713 | Ga0501043_0086713_337_1695 | 392 |
| 44 | 3300050511 | nmdc:mga08y16_91172_c1 | nmdc:mga08y16_91172_c1_1256_2554 | 392 |
| 45 | 3300025920 | Ga0207649_10124618 | Ga0207649_101246182 | 393 |
| 46 | 3300005841 | Ga0068863_100005848 | Ga0068863_1000058483 | 394 |
| 47 | 3300026088 | Ga0207641_10006954 | Ga0207641_1000695410 | 394 |
| 48 | 3300046529 | Ga0495652_0193740 | Ga0495652_0193740_84_1406 | 394 |
| 49 | 3300046615 | Ga0495656_0038668 | Ga0495656_0038668_333_1631 | 394 |
| 50 | 3300046684 | Ga0495669_0073600 | Ga0495669_0073600_37_1335 | 394 |
| 51 | 3300050507 | nmdc:mga05p37_12043_c1 | nmdc:mga05p37_12043_c1_1346_2644 | 394 |
| 52 | 3300037466 | Ga0395898_0047903 | Ga0395898_0047903_2768_4096 | 395 |
| 53 | 3300005441 | Ga0070700_100036295 | Ga0070700_1000362954 | 396 |
| 54 | 3300026075 | Ga0207708_10163070 | Ga0207708_101630702 | 396 |
| 55 | 3300059642 | Ga0587069_004949 | Ga0587069_004949_192_1451 | 396 |
| 56 | 3300005355 | Ga0070671_100020341 | Ga0070671_1000203413 | 397 |
| 57 | 3300005367 | Ga0070667_100022997 | Ga0070667_1000229972 | 397 |
| 58 | 3300005842 | Ga0068858_100116856 | Ga0068858_1001168562 | 397 |
| 59 | 3300013306 | Ga0163162_10102720 | Ga0163162_101027203 | 397 |
| 60 | 3300013308 | Ga0157375_10086155 | Ga0157375_100861553 | 397 |
| 61 | 3300014968 | Ga0157379_10025945 | Ga0157379_100259452 | 397 |
| 62 | 3300025936 | Ga0207670_10011466 | Ga0207670_100114662 | 397 |
| 63 | 3300025941 | Ga0207711_10013040 | Ga0207711_100130403 | 397 |
| 64 | 3300025986 | Ga0207658_10052593 | Ga0207658_100525932 | 397 |
| 65 | 3300026035 | Ga0207703_10028551 | Ga0207703_100285514 | 397 |
| 66 | 3300007265 | Ga0099794_10015237 | Ga0099794_100152372 | 398 |
| 67 | 3300021388 | Ga0213875_10005058 | Ga0213875_100050583 | 398 |
| 68 | 3300037853 | Ga0436364_0404199 | Ga0436364_0404199_30855_32153 | 398 |
| 69 | 3300037853 | Ga0436364_0925092 | Ga0436364_0925092_1829_3133 | 398 |
| 70 | 3300005937 | Ga0081455_10018025 | Ga0081455_100180255 | 400 |
| 71 | 3300005983 | Ga0081540_1078592 | Ga0081540_10785921 | 400 |
| 72 | 3300048903 | Ga0496100_0155868 | Ga0496100_0155868_10_1263 | 400 |
| 73 | 3300005466 | Ga0070685_10091284 | Ga0070685_100912841 | 401 |
| 74 | 3300025901 | Ga0207688_10000801 | Ga0207688_100008019 | 401 |
| 75 | 3300048912 | Ga0496109_0254514 | Ga0496109_0254514_235_1533 | 401 |
| 76 | 3300005983 | Ga0081540_1014231 | Ga0081540_10142313 | 402 |
| 77 | 3300035117 | Ga0373953_0008846 | Ga0373953_0008846_1034_2362 | 402 |
| 78 | 3300035119 | Ga0373956_0097949 | Ga0373956_0097949_17_1345 | 402 |
| 79 | 3300035171 | Ga0373946_0032364 | Ga0373946_0032364_613_1941 | 402 |
| 80 | 3300036401 | Ga0373937_0092229 | Ga0373937_0092229_344_1858 | 402 |
| 81 | 3300046459 | Ga0495629_0011415 | Ga0495629_0011415_1859_3373 | 402 |
| 82 | 3300046462 | Ga0495651_0083835 | Ga0495651_0083835_1039_2367 | 402 |
| 83 | 3300046511 | Ga0495608_0020118 | Ga0495608_0020118_3016_4344 | 402 |
| 84 | 3300046514 | Ga0495618_0002191 | Ga0495618_0002191_9485_10999 | 402 |
| 85 | 3300046517 | Ga0495630_0054091 | Ga0495630_0054091_722_2236 | 402 |
| 86 | 3300046529 | Ga0495652_0008175 | Ga0495652_0008175_8192_9520 | 402 |
| 87 | 3300046543 | Ga0495645_0052674 | Ga0495645_0052674_639_1967 | 402 |
| 88 | 3300047317 | Ga0495604_0023339 | Ga0495604_0023339_260_1588 | 402 |
| 89 | 3300047319 | Ga0495674_0018306 | Ga0495674_0018306_2908_4422 | 402 |
| 90 | 3300047322 | Ga0495680_0018452 | Ga0495680_0018452_1556_3070 | 402 |
| 91 | 3300047471 | Ga0495684_0024367 | Ga0495684_0024367_901_2229 | 402 |
| 92 | 3300053077 | Ga0495601_0010465 | Ga0495601_0010465_2605_3933 | 402 |
| 93 | 3300053084 | Ga0495595_0003601 | Ga0495595_0003601_2129_3643 | 402 |
| 94 | 3300053085 | Ga0495619_0003266 | Ga0495619_0003266_8898_10412 | 402 |
| 95 | 3300033442 | Ga0315911_1000001 | Ga0315911_10000011120 | 405 |
| 96 | 3300037068 | Ga0373925_0069856 | Ga0373925_0069856_1316_2641 | 405 |
| 97 | 3300039437 | Ga0436365_0532933 | Ga0436365_0532933_1569_2885 | 405 |
| 98 | 3300005937 | Ga0081455_10011905 | Ga0081455_100119054 | 406 |
| 99 | 3300006871 | Ga0075434_100045122 | Ga0075434_1000451224 | 406 |
| 100 | 3300026035 | Ga0207703_10044000 | Ga0207703_100440002 | 406 |
| 101 | 3300031249 | Ga0265339_10013072 | Ga0265339_100130722 | 406 |
| 102 | 3300048915 | Ga0496112_0050969 | Ga0496112_0050969_1134_2474 | 406 |
| 103 | 3300021388 | Ga0213875_10000440 | Ga0213875_100004409 | 407 |
| 104 | 3300039447 | Ga0436361_1119041 | Ga0436361_1119041_1447_2724 | 407 |
| 105 | 3300048919 | Ga0496116_0026117 | Ga0496116_0026117_2202_3536 | 407 |
| 106 | 3300005563 | Ga0068855_100047693 | Ga0068855_1000476933 | 408 |
| 107 | 3300005617 | Ga0068859_100111487 | Ga0068859_1001114872 | 408 |
| 108 | 3300006931 | Ga0097620_100111488 | Ga0097620_1001114882 | 408 |
| 109 | 3300009551 | Ga0105238_10037793 | Ga0105238_100377932 | 408 |
| 110 | 3300013296 | Ga0157374_10033012 | Ga0157374_100330123 | 408 |
| 111 | 3300025924 | Ga0207694_10009465 | Ga0207694_100094652 | 408 |
| 112 | 3300028379 | Ga0268266_10244317 | Ga0268266_102443171 | 408 |
| 113 | 3300035724 | Ga0373933_0021763 | Ga0373933_0021763_2218_3543 | 408 |
| 114 | 3300037068 | Ga0373925_0020468 | Ga0373925_0020468_1346_2671 | 408 |
| 115 | 3300046462 | Ga0495651_0011893 | Ga0495651_0011893_4928_6253 | 408 |
| 116 | 3300013297 | Ga0157378_10179741 | Ga0157378_101797413 | 409 |
| 117 | 3300021384 | Ga0213876_10035245 | Ga0213876_100352452 | 409 |
| 118 | 3300037853 | Ga0436364_0885307 | Ga0436364_0885307_1484_2809 | 409 |
| 119 | 3300039437 | Ga0436365_0467544 | Ga0436365_0467544_1006_2331 | 409 |
| 120 | 3300048909 | Ga0496106_0000051 | Ga0496106_0000051_70526_71875 | 409 |
| 121 | 3300048924 | Ga0496121_0018490 | Ga0496121_0018490_3433_4782 | 409 |
| 122 | 3300036401 | Ga0373937_0011489 | Ga0373937_0011489_1927_3252 | 410 |
| 123 | 3300046454 | Ga0495592_0048855 | Ga0495592_0048855_994_2319 | 410 |
| 124 | 3300046455 | Ga0495603_0099314 | Ga0495603_0099314_254_1537 | 410 |
| 125 | 3300047319 | Ga0495674_0060134 | Ga0495674_0060134_607_1932 | 410 |
| 126 | 3300047322 | Ga0495680_0029524 | Ga0495680_0029524_485_1810 | 410 |
| 127 | 3300048925 | Ga0496122_0000179 | Ga0496122_0000179_75265_76581 | 410 |
| 128 | 3300048926 | Ga0496123_0000305 | Ga0496123_0000305_73210_74526 | 410 |
| 129 | 3300005536 | Ga0070697_100224951 | Ga0070697_1002249511 | 411 |
| 130 | 3300005563 | Ga0068855_100238699 | Ga0068855_1002386991 | 412 |
| 131 | 3300005616 | Ga0068852_100004545 | Ga0068852_1000045457 | 412 |
| 132 | 3300005983 | Ga0081540_1020207 | Ga0081540_10202073 | 412 |
| 133 | 3300009147 | Ga0114129_10011875 | Ga0114129_100118755 | 412 |
| 134 | 3300014497 | Ga0182008_10092390 | Ga0182008_100923901 | 412 |
| 135 | 3300022467 | Ga0224712_10062101 | Ga0224712_100621011 | 412 |
| 136 | 3300025949 | Ga0207667_10215746 | Ga0207667_102157462 | 412 |
| 137 | 3300050507 | nmdc:mga05p37_8693_c1 | nmdc:mga05p37_8693_c1_6676_7965 | 412 |
| 138 | 3300026142 | Ga0207698_10025813 | Ga0207698_100258133 | 413 |
| 139 | 3300039438 | Ga0436360_0389184 | Ga0436360_0389184_260_1594 | 413 |
| 140 | iso_pu_bacteria | 2791355199 | 2793083039 | 413 |
| 141 | iso_pu_bacteria | 2908739725 | 2908740944 | 413 |
| 142 | iso_pu_bacteria | 3005474847 | 3005476879 | 413 |
| 143 | 3300005329 | Ga0070683_100014434 | Ga0070683_1000144346 | 414 |
| 144 | 3300025944 | Ga0207661_10026599 | Ga0207661_100265992 | 414 |
| 145 | 3300025949 | Ga0207667_10293366 | Ga0207667_102933661 | 414 |
| 146 | 3300031239 | Ga0265328_10020016 | Ga0265328_100200162 | 414 |
| 147 | 3300031249 | Ga0265339_10008238 | Ga0265339_100082382 | 414 |
| 148 | 3300047319 | Ga0495674_0032646 | Ga0495674_0032646_102_1451 | 414 |
| 149 | 3300048924 | Ga0496121_0016512 | Ga0496121_0016512_5117_6442 | 414 |
| 150 | 3300005328 | Ga0070676_10028507 | Ga0070676_100285071 | 415 |
| 151 | 3300005341 | Ga0070691_10001180 | Ga0070691_100011807 | 415 |
| 152 | 3300005440 | Ga0070705_100005190 | Ga0070705_1000051901 | 415 |
| 153 | 3300005441 | Ga0070700_100002121 | Ga0070700_1000021214 | 415 |
| 154 | 3300005444 | Ga0070694_100018162 | Ga0070694_1000181624 | 415 |
| 155 | 3300005444 | Ga0070694_100019869 | Ga0070694_1000198693 | 415 |
| 156 | 3300005459 | Ga0068867_100027130 | Ga0068867_1000271303 | 415 |
| 157 | 3300005615 | Ga0070702_100006477 | Ga0070702_1000064773 | 415 |
| 158 | 3300005617 | Ga0068859_100216823 | Ga0068859_1002168233 | 415 |
| 159 | 3300005719 | Ga0068861_100023927 | Ga0068861_1000239273 | 415 |
| 160 | 3300006178 | Ga0075367_10012258 | Ga0075367_100122582 | 415 |
| 161 | 3300006931 | Ga0097620_100216819 | Ga0097620_1002168192 | 415 |
| 162 | 3300007265 | Ga0099794_10000010 | Ga0099794_100000108 | 415 |
| 163 | 3300009147 | Ga0114129_10059691 | Ga0114129_100596913 | 415 |
| 164 | 3300013105 | Ga0157369_10213720 | Ga0157369_102137201 | 415 |
| 165 | 3300014497 | Ga0182008_10031527 | Ga0182008_100315271 | 415 |
| 166 | 3300021384 | Ga0213876_10001700 | Ga0213876_100017009 | 415 |
| 167 | 3300025907 | Ga0207645_10017851 | Ga0207645_100178511 | 415 |
| 168 | 3300026075 | Ga0207708_10006098 | Ga0207708_100060987 | 415 |
| 169 | 3300027671 | Ga0209588_1000008 | Ga0209588_100000892 | 415 |
| 170 | 3300037466 | Ga0395898_0010462 | Ga0395898_0010462_7445_8782 | 415 |
| 171 | 3300039437 | Ga0436365_0727442 | Ga0436365_0727442_690_2015 | 415 |
| 172 | 3300039437 | Ga0436365_0802243 | Ga0436365_0802243_1818_3143 | 415 |
| 173 | 3300039453 | Ga0436362_0317323 | Ga0436362_0317323_1048_2373 | 415 |
| 174 | 3300046517 | Ga0495630_0163141 | Ga0495630_0163141_368_1678 | 415 |
| 175 | 3300005290 | Ga0065712_10016758 | Ga0065712_100167581 | 416 |
| 176 | 3300005331 | Ga0070670_100018702 | Ga0070670_1000187024 | 416 |
| 177 | 3300005356 | Ga0070674_100004479 | Ga0070674_1000044795 | 416 |
| 178 | 3300005457 | Ga0070662_100086492 | Ga0070662_1000864922 | 416 |
| 179 | 3300005535 | Ga0070684_100009488 | Ga0070684_1000094886 | 416 |
| 180 | 3300005718 | Ga0068866_10079404 | Ga0068866_100794042 | 416 |
| 181 | 3300005719 | Ga0068861_100144008 | Ga0068861_1001440082 | 416 |
| 182 | 3300005844 | Ga0068862_100028718 | Ga0068862_1000287182 | 416 |
| 183 | 3300009093 | Ga0105240_10140096 | Ga0105240_101400962 | 416 |
| 184 | 3300009094 | Ga0111539_10103558 | Ga0111539_101035582 | 416 |
| 185 | 3300025253 | Ga0209677_101747 | Ga0209677_10174710 | 416 |
| 186 | 3300025913 | Ga0207695_10137684 | Ga0207695_101376843 | 416 |
| 187 | 3300025923 | Ga0207681_10015327 | Ga0207681_100153272 | 416 |
| 188 | 3300025925 | Ga0207650_10029246 | Ga0207650_100292462 | 416 |
| 189 | 3300025933 | Ga0207706_10052543 | Ga0207706_100525433 | 416 |
| 190 | 3300025933 | Ga0207706_10086088 | Ga0207706_100860883 | 416 |
| 191 | 3300025944 | Ga0207661_10002926 | Ga0207661_100029261 | 416 |
| 192 | 3300025961 | Ga0207712_10076367 | Ga0207712_100763672 | 416 |
| 193 | 3300026075 | Ga0207708_10011567 | Ga0207708_100115672 | 416 |
| 194 | 3300026089 | Ga0207648_10120234 | Ga0207648_101202342 | 416 |
| 195 | 3300027907 | Ga0207428_10078289 | Ga0207428_100782892 | 416 |
| 196 | 3300039438 | Ga0436360_0742611 | Ga0436360_0742611_58_1392 | 416 |
| 197 | 3300044684 | Ga0466966_0033398 | Ga0466966_0033398_1198_2523 | 416 |
| 198 | 3300045049 | Ga0466959_0111990 | Ga0466959_0111990_494_1816 | 416 |
| 199 | 3300046460 | Ga0495638_0026787 | Ga0495638_0026787_368_1699 | 416 |
| 200 | 3300046472 | Ga0495580_0002553 | Ga0495580_0002553_11907_13238 | 416 |
| 201 | 3300046506 | Ga0495583_0013422 | Ga0495583_0013422_2757_4088 | 416 |
| 202 | 3300046690 | Ga0495624_0027521 | Ga0495624_0027521_1503_2834 | 416 |
| 203 | 3300047319 | Ga0495674_0017601 | Ga0495674_0017601_1503_2834 | 416 |
| 204 | 3300047472 | Ga0495686_0017071 | Ga0495686_0017071_2484_3815 | 416 |
| 205 | 3300047673 | Ga0495593_0021813 | Ga0495593_0021813_1220_2551 | 416 |
| 206 | 3300048924 | Ga0496121_0012704 | Ga0496121_0012704_1967_3298 | 416 |
| 207 | 3300048929 | Ga0496126_0045397 | Ga0496126_0045397_1863_3185 | 416 |
| 208 | 3300061719 | Ga0466962_0031098 | Ga0466962_0031098_875_2197 | 416 |
| 209 | iso_pu_bacteria | 2511231024 | 2511373570 | 416 |
| 210 | 3300005328 | Ga0070676_10021093 | Ga0070676_100210933 | 417 |
| 211 | 3300005330 | Ga0070690_100119926 | Ga0070690_1001199262 | 417 |
| 212 | 3300005343 | Ga0070687_100028231 | Ga0070687_1000282311 | 417 |
| 213 | 3300005364 | Ga0070673_100010637 | Ga0070673_1000106375 | 417 |
| 214 | 3300005365 | Ga0070688_100026016 | Ga0070688_1000260162 | 417 |
| 215 | 3300005365 | Ga0070688_100104439 | Ga0070688_1001044392 | 417 |
| 216 | 3300005367 | Ga0070667_100185577 | Ga0070667_1001855772 | 417 |
| 217 | 3300005441 | Ga0070700_100010299 | Ga0070700_1000102992 | 417 |
| 218 | 3300005459 | Ga0068867_100002007 | Ga0068867_1000020072 | 417 |
| 219 | 3300005466 | Ga0070685_10098883 | Ga0070685_100988832 | 417 |
| 220 | 3300005543 | Ga0070672_100078195 | Ga0070672_1000781951 | 417 |
| 221 | 3300005549 | Ga0070704_100034142 | Ga0070704_1000341423 | 417 |
| 222 | 3300005842 | Ga0068858_100053264 | Ga0068858_1000532642 | 417 |
| 223 | 3300006871 | Ga0075434_100259342 | Ga0075434_1002593422 | 417 |
| 224 | 3300007076 | Ga0075435_100005123 | Ga0075435_1000051238 | 417 |
| 225 | 3300009011 | Ga0105251_10000044 | Ga0105251_1000004437 | 417 |
| 226 | 3300009094 | Ga0111539_10085305 | Ga0111539_100853053 | 417 |
| 227 | 3300009098 | Ga0105245_10142872 | Ga0105245_101428722 | 417 |
| 228 | 3300009177 | Ga0105248_10076951 | Ga0105248_100769512 | 417 |
| 229 | 3300010375 | Ga0105239_10143640 | Ga0105239_101436402 | 417 |
| 230 | 3300013297 | Ga0157378_10064352 | Ga0157378_100643522 | 417 |
| 231 | 3300025272 | Ga0209455_1002309 | Ga0209455_10023095 | 417 |
| 232 | 3300025735 | Ga0207713_1000113 | Ga0207713_100011371 | 417 |
| 233 | 3300025893 | Ga0207682_10006780 | Ga0207682_100067802 | 417 |
| 234 | 3300025901 | Ga0207688_10019190 | Ga0207688_100191902 | 417 |
| 235 | 3300025907 | Ga0207645_10001457 | Ga0207645_1000145714 | 417 |
| 236 | 3300025926 | Ga0207659_10148965 | Ga0207659_101489652 | 417 |
| 237 | 3300025933 | Ga0207706_10075748 | Ga0207706_100757483 | 417 |
| 238 | 3300025940 | Ga0207691_10004519 | Ga0207691_100045195 | 417 |
| 239 | 3300025941 | Ga0207711_10019897 | Ga0207711_100198974 | 417 |
| 240 | 3300025981 | Ga0207640_10166217 | Ga0207640_101662171 | 417 |
| 241 | 3300026075 | Ga0207708_10001606 | Ga0207708_100016064 | 417 |
| 242 | 3300026089 | Ga0207648_10003970 | Ga0207648_100039702 | 417 |
| 243 | 3300026118 | Ga0207675_100015983 | Ga0207675_1000159835 | 417 |
| 244 | 3300027907 | Ga0207428_10122150 | Ga0207428_101221502 | 417 |
| 245 | 3300031235 | Ga0265330_10031008 | Ga0265330_100310082 | 417 |
| 246 | 3300047443 | Ga0495687_000022 | Ga0495687_000022_81312_82646 | 417 |
| 247 | 3300048908 | Ga0496105_0126428 | Ga0496105_0126428_745_2082 | 417 |
| 248 | 3300048915 | Ga0496112_0099048 | Ga0496112_0099048_1334_2665 | 417 |
| 249 | 3300048918 | Ga0496115_0108082 | Ga0496115_0108082_749_2086 | 417 |
| 250 | 3300050512 | nmdc:mga0n895_61515_c1 | nmdc:mga0n895_61515_c1_252_1583 | 417 |
| 251 | 3300050513 | nmdc:mga0rr50_10716_c1 | nmdc:mga0rr50_10716_c1_1485_2816 | 417 |
| 252 | 3300005458 | Ga0070681_10135150 | Ga0070681_101351504 | 418 |
| 253 | 3300005844 | Ga0068862_100109934 | Ga0068862_1001099343 | 418 |
| 254 | 3300006358 | Ga0068871_100010948 | Ga0068871_1000109483 | 418 |
| 255 | 3300006844 | Ga0075428_100000716 | Ga0075428_10000071620 | 418 |
| 256 | 3300006846 | Ga0075430_100038198 | Ga0075430_1000381984 | 418 |
| 257 | 3300006880 | Ga0075429_100003354 | Ga0075429_1000033544 | 418 |
| 258 | 3300006881 | Ga0068865_100007648 | Ga0068865_1000076488 | 418 |
| 259 | 3300009094 | Ga0111539_10001075 | Ga0111539_1000107513 | 418 |
| 260 | 3300009147 | Ga0114129_10002446 | Ga0114129_100024467 | 418 |
| 261 | 3300009551 | Ga0105238_10166675 | Ga0105238_101666751 | 418 |
| 262 | 3300025900 | Ga0207710_10010466 | Ga0207710_100104663 | 418 |
| 263 | 3300025921 | Ga0207652_10024665 | Ga0207652_100246653 | 418 |
| 264 | 3300026095 | Ga0207676_10065336 | Ga0207676_100653362 | 418 |
| 265 | 3300028380 | Ga0268265_10057480 | Ga0268265_100574802 | 418 |
| 266 | 3300037853 | Ga0436364_0266271 | Ga0436364_0266271_126906_128234 | 418 |
| 267 | 3300042008 | Ga0439450_002885 | Ga0439450_002885_450_1757 | 418 |
| 268 | 3300042439 | Ga0439464_0002113 | Ga0439464_0002113_3015_4322 | 418 |
| 269 | 3300042993 | Ga0439440_0011246 | Ga0439440_0011246_47_1546 | 418 |
| 270 | 3300048915 | Ga0496112_0017474 | Ga0496112_0017474_2173_3468 | 418 |
| 271 | 3300048916 | Ga0496113_0025143 | Ga0496113_0025143_2115_3410 | 418 |
| 272 | 3300048927 | Ga0496124_0074473 | Ga0496124_0074473_757_2094 | 418 |
| 273 | 3300048928 | Ga0496125_0033439 | Ga0496125_0033439_2500_3837 | 418 |
| 274 | 3300050507 | nmdc:mga05p37_3101_c1 | nmdc:mga05p37_3101_c1_9418_10725 | 418 |
| 275 | 3300050508 | nmdc:mga09592_3091_c1 | nmdc:mga09592_3091_c1_6988_8295 | 418 |
| 276 | 3300050509 | nmdc:mga0qj67_12694_c1 | nmdc:mga0qj67_12694_c1_4123_5430 | 418 |
| 277 | 3300050510 | nmdc:mga06r32_43055_c1 | nmdc:mga06r32_43055_c1_911_2218 | 418 |
| 278 | 3300005434 | Ga0070709_10063888 | Ga0070709_100638881 | 419 |
| 279 | 3300005436 | Ga0070713_100014322 | Ga0070713_1000143223 | 419 |
| 280 | 3300005614 | Ga0068856_100201070 | Ga0068856_1002010702 | 419 |
| 281 | 3300025928 | Ga0207700_10079664 | Ga0207700_100796641 | 419 |
| 282 | 3300028573 | Ga0265334_10005240 | Ga0265334_100052404 | 419 |
| 283 | 3300028653 | Ga0265323_10004965 | Ga0265323_100049652 | 419 |
| 284 | 3300028654 | Ga0265322_10006588 | Ga0265322_100065882 | 419 |
| 285 | 3300028666 | Ga0265336_10000720 | Ga0265336_1000072011 | 419 |
| 286 | 3300028800 | Ga0265338_10000034 | Ga0265338_100000344 | 419 |
| 287 | 3300029957 | Ga0265324_10011049 | Ga0265324_100110492 | 419 |
| 288 | 3300048929 | Ga0496126_0000506 | Ga0496126_0000506_26397_27746 | 419 |
| 289 | iso_pu_bacteria | 2602042107 | 2603857803 | 419 |
| 290 | iso_pu_bacteria | 2857524615 | 2857527175 | 419 |
| 291 | iso_pu_bacteria | 2919073203 | 2919078291 | 419 |
| 292 | 3300005354 | Ga0070675_100237649 | Ga0070675_1002376492 | 420 |
| 293 | 3300037471 | Ga0395905_0020217 | Ga0395905_0020217_974_2290 | 420 |
| 294 | 3300046507 | Ga0495606_0082955 | Ga0495606_0082955_668_1975 | 420 |
| 295 | 3300005354 | Ga0070675_100003322 | Ga0070675_10000332210 | 421 |
| 296 | 3300005355 | Ga0070671_100287588 | Ga0070671_1002875881 | 421 |
| 297 | 3300005365 | Ga0070688_100083275 | Ga0070688_1000832752 | 421 |
| 298 | 3300005434 | Ga0070709_10036666 | Ga0070709_100366662 | 421 |
| 299 | 3300005437 | Ga0070710_10070662 | Ga0070710_100706621 | 421 |
| 300 | 3300005548 | Ga0070665_100018633 | Ga0070665_1000186333 | 421 |
| 301 | 3300006163 | Ga0070715_10046123 | Ga0070715_100461232 | 421 |
| 302 | 3300006871 | Ga0075434_100003344 | Ga0075434_10000334412 | 421 |
| 303 | 3300007076 | Ga0075435_100016850 | Ga0075435_1000168502 | 421 |
| 304 | 3300009176 | Ga0105242_10035603 | Ga0105242_100356033 | 421 |
| 305 | 3300009176 | Ga0105242_10184943 | Ga0105242_101849431 | 421 |
| 306 | 3300014969 | Ga0157376_10142154 | Ga0157376_101421542 | 421 |
| 307 | 3300025898 | Ga0207692_10066752 | Ga0207692_100667521 | 421 |
| 308 | 3300025905 | Ga0207685_10012541 | Ga0207685_100125412 | 421 |
| 309 | 3300025911 | Ga0207654_10123665 | Ga0207654_101236652 | 421 |
| 310 | 3300025926 | Ga0207659_10000151 | Ga0207659_100001514 | 421 |
| 311 | 3300025933 | Ga0207706_10037808 | Ga0207706_100378082 | 421 |
| 312 | 3300026078 | Ga0207702_10090074 | Ga0207702_100900742 | 421 |
| 313 | 3300028379 | Ga0268266_10008403 | Ga0268266_100084032 | 421 |
| 314 | 3300034817 | Ga0373948_0000495 | Ga0373948_0000495_2302_3615 | 421 |
| 315 | 3300034819 | Ga0373958_0000513 | Ga0373958_0000513_451_1764 | 421 |
| 316 | 3300035085 | Ga0373929_0000168 | Ga0373929_0000168_2204_3517 | 421 |
| 317 | 3300035090 | Ga0373949_0000323 | Ga0373949_0000323_8316_9629 | 421 |
| 318 | 3300035112 | Ga0373932_0000150 | Ga0373932_0000150_12456_13769 | 421 |
| 319 | 3300035114 | Ga0373939_0000084 | Ga0373939_0000084_5544_6857 | 421 |
| 320 | 3300035115 | Ga0373941_0000528 | Ga0373941_0000528_4192_5505 | 421 |
| 321 | 3300035121 | Ga0373960_0000037 | Ga0373960_0000037_14702_16015 | 421 |
| 322 | 3300035170 | Ga0373943_0080703 | Ga0373943_0080703_143_1456 | 421 |
| 323 | 3300035241 | Ga0373961_0004131 | Ga0373961_0004131_1823_3136 | 421 |
| 324 | 3300035691 | Ga0373931_0000303 | Ga0373931_0000303_18223_19536 | 421 |
| 325 | 3300039438 | Ga0436360_0360856 | Ga0436360_0360856_1458_2762 | 421 |
| 326 | 3300039447 | Ga0436361_0043228 | Ga0436361_0043228_1699_3003 | 421 |
| 327 | 3300039447 | Ga0436361_0083385 | Ga0436361_0083385_1493_2797 | 421 |
| 328 | 3300045051 | Ga0451576_0035940 | Ga0451576_0035940_1279_2592 | 421 |
| 329 | 3300046501 | Ga0495607_0029182 | Ga0495607_0029182_322_1668 | 421 |
| 330 | 3300046524 | Ga0495648_0094933 | Ga0495648_0094933_10_1356 | 421 |
| 331 | 3300046665 | Ga0495661_0020504 | Ga0495661_0020504_840_2186 | 421 |
| 332 | 3300046691 | Ga0495670_0008471 | Ga0495670_0008471_209_1555 | 421 |
| 333 | 3300046692 | Ga0495671_0040019 | Ga0495671_0040019_353_1699 | 421 |
| 334 | 3300048911 | Ga0496108_0071329 | Ga0496108_0071329_1491_2798 | 421 |
| 335 | 3300048913 | Ga0496110_0068709 | Ga0496110_0068709_201_1511 | 421 |
| 336 | 3300048920 | Ga0496117_0024602 | Ga0496117_0024602_2535_3836 | 421 |
| 337 | 3300048921 | Ga0496118_0007222 | Ga0496118_0007222_5426_6727 | 421 |
| 338 | 3300048922 | Ga0496119_0115197 | Ga0496119_0115197_99_1445 | 421 |
| 339 | 3300048923 | Ga0496120_0016688 | Ga0496120_0016688_1809_3155 | 421 |
| 340 | 3300048924 | Ga0496121_0000491 | Ga0496121_0000491_64871_66223 | 421 |
| 341 | 3300048924 | Ga0496121_0024493 | Ga0496121_0024493_1323_2669 | 421 |
| 342 | 3300048928 | Ga0496125_0001319 | Ga0496125_0001319_13484_14830 | 421 |
| 343 | 3300048929 | Ga0496126_0000031 | Ga0496126_0000031_121851_123152 | 421 |
| 344 | 3300048929 | Ga0496126_0001335 | Ga0496126_0001335_22023_23375 | 421 |
| 345 | 3300048929 | Ga0496126_0096717 | Ga0496126_0096717_869_2215 | 421 |
| 346 | 3300050508 | nmdc:mga09592_3337_c1 | nmdc:mga09592_3337_c1_9085_10446 | 421 |
| 347 | 3300050510 | nmdc:mga06r32_18406_c1 | nmdc:mga06r32_18406_c1_235_1554 | 421 |
| 348 | 3300050511 | nmdc:mga08y16_123590_c1 | nmdc:mga08y16_123590_c1_639_1949 | 421 |
| 349 | 3300050512 | nmdc:mga0n895_46067_c1 | nmdc:mga0n895_46067_c1_946_2259 | 421 |
| 350 | 3300050513 | nmdc:mga0rr50_1562_c1 | nmdc:mga0rr50_1562_c1_4335_5699 | 421 |
| 351 | 3300050513 | nmdc:mga0rr50_4849_c1 | nmdc:mga0rr50_4849_c1_749_2062 | 421 |
| 352 | 3300050515 | nmdc:mga0a205_130175_c1 | nmdc:mga0a205_130175_c1_903_2252 | 421 |
| 353 | 3300053088 | Ga0500644_0008217 | Ga0500644_0008217_1035_2381 | 421 |
| 354 | 3300053093 | Ga0500651_0122322 | Ga0500651_0122322_138_1484 | 421 |
| 355 | 3300053094 | Ga0500566_0001270 | Ga0500566_0001270_12575_13921 | 421 |
| 356 | 3300053104 | Ga0500556_0000012 | Ga0500556_0000012_145556_146902 | 421 |
| 357 | 3300053130 | Ga0500642_0000110 | Ga0500642_0000110_26308_27654 | 421 |
| 358 | 3300053131 | Ga0500652_000566 | Ga0500652_000566_2129_3475 | 421 |
| 359 | 3300053136 | Ga0500559_0000198 | Ga0500559_0000198_3848_5194 | 421 |
| 360 | 3300053139 | Ga0500568_0003536 | Ga0500568_0003536_2137_3483 | 421 |
| 361 | 3300053151 | Ga0500604_0012577 | Ga0500604_0012577_883_2229 | 421 |
| 362 | 3300053153 | Ga0500616_0000035 | Ga0500616_0000035_242836_244182 | 421 |
| 363 | 3300053156 | Ga0500622_0000885 | Ga0500622_0000885_20269_21615 | 421 |
| 364 | 3300053177 | Ga0500636_0036660 | Ga0500636_0036660_936_2282 | 421 |
| 365 | iso_pu_bacteria | 2855730933 | 2855731201 | 421 |
| 366 | iso_pu_bacteria | 2855767633 | 2855767985 | 421 |
| 367 | 3300031548 | Ga0307408_100117783 | Ga0307408_1001177831 | 422 |
| 368 | 3300031911 | Ga0307412_10064787 | Ga0307412_100647872 | 422 |
| 369 | 3300045976 | Ga0466967_0061292 | Ga0466967_0061292_1711_3033 | 422 |
| 370 | 3300049514 | Ga0501291_003411 | Ga0501291_003411_596_1945 | 422 |
| 371 | 3300049652 | Ga0501202_017281 | Ga0501202_017281_73_1398 | 422 |
| 372 | 3300003320 | rootH2_10052757 | rootH2_100527576 | 423 |
| 373 | 3300021388 | Ga0213875_10003880 | Ga0213875_100038806 | 423 |
| 374 | 3300037853 | Ga0436364_0271701 | Ga0436364_0271701_19941_21275 | 423 |
| 375 | 3300046457 | Ga0495590_0013325 | Ga0495590_0013325_871_2223 | 423 |
| 376 | 3300046507 | Ga0495606_0085171 | Ga0495606_0085171_88_1440 | 423 |
| 377 | 3300046516 | Ga0495628_0004242 | Ga0495628_0004242_821_2218 | 423 |
| 378 | 3300046665 | Ga0495661_0029145 | Ga0495661_0029145_1698_3050 | 423 |
| 379 | 3300046694 | Ga0495649_0039484 | Ga0495649_0039484_999_2351 | 423 |
| 380 | 3300047320 | Ga0495672_0019038 | Ga0495672_0019038_2433_3785 | 423 |
| 381 | 3300047446 | Ga0495679_000041 | Ga0495679_000041_11887_13239 | 423 |
| 382 | 3300047469 | Ga0495673_0047917 | Ga0495673_0047917_441_1793 | 423 |
| 383 | 3300047472 | Ga0495686_0000099 | Ga0495686_0000099_123828_125162 | 423 |
| 384 | 3300048918 | Ga0496115_0113677 | Ga0496115_0113677_643_1989 | 423 |
| 385 | 3300049459 | Ga0495678_023367 | Ga0495678_023367_597_1949 | 423 |
| 386 | 3300003659 | JGI25404J52841_10004087 | JGI25404J52841_100040872 | 424 |
| 387 | 3300031456 | Ga0307513_10179819 | Ga0307513_101798192 | 424 |
| 388 | 3300046459 | Ga0495629_0000047 | Ga0495629_0000047_92540_93895 | 424 |
| 389 | 3300046463 | Ga0495653_0000049 | Ga0495653_0000049_91284_92639 | 424 |
| 390 | 3300046471 | Ga0495650_0002989 | Ga0495650_0002989_2845_4191 | 424 |
| 391 | 3300046472 | Ga0495580_0000414 | Ga0495580_0000414_2718_4070 | 424 |
| 392 | 3300046472 | Ga0495580_0000860 | Ga0495580_0000860_5043_6398 | 424 |
| 393 | 3300046516 | Ga0495628_0025538 | Ga0495628_0025538_1344_2699 | 424 |
| 394 | 3300046517 | Ga0495630_0054612 | Ga0495630_0054612_820_2172 | 424 |
| 395 | 3300046524 | Ga0495648_0006073 | Ga0495648_0006073_7644_8954 | 424 |
| 396 | 3300046529 | Ga0495652_0069097 | Ga0495652_0069097_1531_2883 | 424 |
| 397 | 3300046678 | Ga0495599_0100124 | Ga0495599_0100124_297_1649 | 424 |
| 398 | 3300046680 | Ga0495646_0002989 | Ga0495646_0002989_4082_5437 | 424 |
| 399 | 3300046684 | Ga0495669_0084387 | Ga0495669_0084387_89_1405 | 424 |
| 400 | 3300046690 | Ga0495624_0008776 | Ga0495624_0008776_1338_2693 | 424 |
| 401 | 3300047317 | Ga0495604_0044369 | Ga0495604_0044369_621_1973 | 424 |
| 402 | 3300047319 | Ga0495674_0020127 | Ga0495674_0020127_3490_4845 | 424 |
| 403 | 3300047321 | Ga0495676_0131922 | Ga0495676_0131922_66_1421 | 424 |
| 404 | 3300047673 | Ga0495593_0006594 | Ga0495593_0006594_3588_4943 | 424 |
| 405 | 3300005937 | Ga0081455_10000970 | Ga0081455_100009705 | 425 |
| 406 | iso_pu_bacteria | 2508501128 | 2509152094 | 425 |
| 407 | iso_pu_bacteria | 3003665799 | 3003666638 | 425 |
| 408 | 3300005295 | Ga0065707_10022500 | Ga0065707_100225002 | 426 |
| 409 | 3300005536 | Ga0070697_100017298 | Ga0070697_1000172984 | 426 |
| 410 | 3300046477 | Ga0495664_0138763 | Ga0495664_0138763_28_1371 | 426 |
| 411 | 3300046678 | Ga0495599_0110563 | Ga0495599_0110563_256_1647 | 426 |
| 412 | iso_pu_bacteria | 2513237096 | 2513656627 | 426 |
| 413 | iso_pu_bacteria | 2513237137 | 2513858583 | 426 |
| 414 | iso_pu_bacteria | 2513237145 | 2513917812 | 426 |
| 415 | iso_pu_bacteria | 2517572143 | 2517893140 | 426 |
| 416 | iso_pu_bacteria | 2545555834 | 2545673262 | 426 |
| 417 | iso_pu_bacteria | 2906635258 | 2906640854 | 426 |
| 418 | iso_pu_bacteria | 2906660503 | 2906661348 | 426 |
| 419 | iso_pu_bacteria | 2922425934 | 2922429346 | 426 |
| 420 | iso_pu_bacteria | 2935630451 | 2935634079 | 426 |
| 421 | iso_pu_bacteria | 2941507105 | 2941510970 | 426 |
| 422 | iso_pu_bacteria | 2941515067 | 2941518354 | 426 |
| 423 | iso_pu_bacteria | 2941523033 | 2941527383 | 426 |
| 424 | iso_pu_bacteria | 641522639 | 641641289 | 426 |
| 425 | iso_pu_bacteria | 8019555841 | 8019557547 | 426 |
| 426 | iso_pu_bacteria | 8019565922 | 8019567750 | 426 |
| 427 | 3300005329 | Ga0070683_100179697 | Ga0070683_1001796972 | 427 |
| 428 | 3300005436 | Ga0070713_100002333 | Ga0070713_10000233312 | 427 |
| 429 | 3300009551 | Ga0105238_10034934 | Ga0105238_100349347 | 427 |
| 430 | 3300025912 | Ga0207707_10001587 | Ga0207707_1000158715 | 427 |
| 431 | 3300044658 | Ga0466972_0067295 | Ga0466972_0067295_65_1390 | 427 |
| 432 | 3300044683 | Ga0466965_0036409 | Ga0466965_0036409_77_1420 | 427 |
| 433 | 3300044684 | Ga0466966_0082178 | Ga0466966_0082178_148_1491 | 427 |
| 434 | iso_pu_bacteria | 2513237098 | 2513680340 | 427 |
| 435 | iso_pu_bacteria | 2876761206 | 2876764807 | 427 |
| 436 | iso_pu_bacteria | 2879099564 | 2879101602 | 427 |
| 437 | iso_pu_bacteria | 2885383462 | 2885392236 | 427 |
| 438 | iso_pu_bacteria | 2903768456 | 2903771368 | 427 |
| 439 | 3300005435 | Ga0070714_100051316 | Ga0070714_1000513164 | 428 |
| 440 | 3300005436 | Ga0070713_100064159 | Ga0070713_1000641593 | 428 |
| 441 | 3300005563 | Ga0068855_100148756 | Ga0068855_1001487563 | 428 |
| 442 | 3300013104 | Ga0157370_10086916 | Ga0157370_100869163 | 428 |
| 443 | 3300013105 | Ga0157369_10036695 | Ga0157369_100366955 | 428 |
| 444 | 3300013105 | Ga0157369_10075017 | Ga0157369_100750171 | 428 |
| 445 | 3300021388 | Ga0213875_10000626 | Ga0213875_1000062623 | 428 |
| 446 | 3300021388 | Ga0213875_10001904 | Ga0213875_100019045 | 428 |
| 447 | 3300025913 | Ga0207695_10102440 | Ga0207695_101024403 | 428 |
| 448 | 3300025928 | Ga0207700_10100262 | Ga0207700_101002622 | 428 |
| 449 | 3300025929 | Ga0207664_10034986 | Ga0207664_100349865 | 428 |
| 450 | 3300026116 | Ga0207674_10054063 | Ga0207674_100540634 | 428 |
| 451 | 3300026116 | Ga0207674_10283835 | Ga0207674_102838352 | 428 |
| 452 | 3300037418 | Ga0395900_0052469 | Ga0395900_0052469_2678_4003 | 428 |
| 453 | 3300037466 | Ga0395898_0010740 | Ga0395898_0010740_1796_3121 | 428 |
| 454 | 3300037853 | Ga0436364_0254983 | Ga0436364_0254983_4656_5981 | 428 |
| 455 | 3300037853 | Ga0436364_1325276 | Ga0436364_1325276_42339_43667 | 428 |
| 456 | 3300037853 | Ga0436364_1553245 | Ga0436364_1553245_36567_37895 | 428 |
| 457 | 3300038443 | Ga0395901_0030579 | Ga0395901_0030579_984_2309 | 428 |
| 458 | 3300048929 | Ga0496126_0015062 | Ga0496126_0015062_4743_6068 | 428 |
| 459 | 3300048929 | Ga0496126_0026463 | Ga0496126_0026463_2800_4128 | 428 |
| 460 | 3300048929 | Ga0496126_0032036 | Ga0496126_0032036_3196_4521 | 428 |
| 461 | 3300049580 | Ga0501046_0018761 | Ga0501046_0018761_4106_5431 | 428 |
| 462 | 3300049581 | Ga0501047_0006979 | Ga0501047_0006979_3878_5203 | 428 |
| 463 | 3300049586 | Ga0501070_0019038 | Ga0501070_0019038_3842_5167 | 428 |
| 464 | 3300049590 | Ga0501074_0038057 | Ga0501074_0038057_689_2014 | 428 |
| 465 | 3300049742 | Ga0501080_0005410 | Ga0501080_0005410_3817_5142 | 428 |
| 466 | 3300049823 | Ga0501044_0081437 | Ga0501044_0081437_656_1981 | 428 |
| 467 | 3300003323 | rootH1_10043004 | rootH1_100430042 | 429 |
| 468 | 3300009177 | Ga0105248_10079722 | Ga0105248_100797222 | 429 |
| 469 | 3300025941 | Ga0207711_10058072 | Ga0207711_100580722 | 429 |
| 470 | 3300031251 | Ga0265327_10019949 | Ga0265327_100199492 | 429 |
| 471 | 3300044901 | Ga0466960_0019221 | Ga0466960_0019221_75_1403 | 429 |
| 472 | 3300046663 | Ga0495635_0033472 | Ga0495635_0033472_20_1345 | 429 |
| 473 | 3300046690 | Ga0495624_0000148 | Ga0495624_0000148_47857_49209 | 429 |
| 474 | 3300047472 | Ga0495686_0004668 | Ga0495686_0004668_889_2223 | 429 |
| 475 | 3300047472 | Ga0495686_0021136 | Ga0495686_0021136_900_2252 | 429 |
| 476 | 3300048921 | Ga0496118_0109296 | Ga0496118_0109296_452_1804 | 429 |
| 477 | 3300048924 | Ga0496121_0061503 | Ga0496121_0061503_1325_2677 | 429 |
| 478 | 3300048929 | Ga0496126_0000297 | Ga0496126_0000297_59129_60481 | 429 |
| 479 | 3300006871 | Ga0075434_100236944 | Ga0075434_1002369441 | 430 |
| 480 | 3300011119 | Ga0105246_10094194 | Ga0105246_100941941 | 430 |
| 481 | 3300025898 | Ga0207692_10120813 | Ga0207692_101208131 | 430 |
| 482 | 3300025915 | Ga0207693_10062650 | Ga0207693_100626503 | 430 |
| 483 | 3300026118 | Ga0207675_100265429 | Ga0207675_1002654292 | 430 |
| 484 | 3300035170 | Ga0373943_0071486 | Ga0373943_0071486_224_1570 | 430 |
| 485 | 3300037471 | Ga0395905_0154009 | Ga0395905_0154009_526_1860 | 430 |
| 486 | 3300046458 | Ga0495591_012419 | Ga0495591_012419_215_1570 | 430 |
| 487 | 3300046462 | Ga0495651_0036647 | Ga0495651_0036647_127_1482 | 430 |
| 488 | 3300046472 | Ga0495580_0031640 | Ga0495580_0031640_284_1639 | 430 |
| 489 | 3300046475 | Ga0495639_0036017 | Ga0495639_0036017_310_1656 | 430 |
| 490 | 3300046477 | Ga0495664_0010147 | Ga0495664_0010147_3666_5021 | 430 |
| 491 | 3300046500 | Ga0495596_0001422 | Ga0495596_0001422_9053_10408 | 430 |
| 492 | 3300046511 | Ga0495608_0010063 | Ga0495608_0010063_1708_3063 | 430 |
| 493 | 3300046514 | Ga0495618_0058946 | Ga0495618_0058946_863_2218 | 430 |
| 494 | 3300046526 | Ga0495666_0000624 | Ga0495666_0000624_12383_13738 | 430 |
| 495 | 3300046529 | Ga0495652_0114387 | Ga0495652_0114387_528_1883 | 430 |
| 496 | 3300046533 | Ga0495640_0011178 | Ga0495640_0011178_3051_4406 | 430 |
| 497 | 3300046536 | Ga0495587_0003817 | Ga0495587_0003817_4670_6025 | 430 |
| 498 | 3300046559 | Ga0495667_0007142 | Ga0495667_0007142_349_1704 | 430 |
| 499 | 3300046642 | Ga0495634_0019842 | Ga0495634_0019842_1581_2936 | 430 |
| 500 | 3300046678 | Ga0495599_0032833 | Ga0495599_0032833_1551_2906 | 430 |
| 501 | 3300046679 | Ga0495623_0057642 | Ga0495623_0057642_680_2035 | 430 |
| 502 | 3300046680 | Ga0495646_0027334 | Ga0495646_0027334_389_1744 | 430 |
| 503 | 3300046689 | Ga0495613_0152476 | Ga0495613_0152476_144_1499 | 430 |
| 504 | 3300046690 | Ga0495624_0081592 | Ga0495624_0081592_65_1420 | 430 |
| 505 | 3300046794 | Ga0495589_0042375 | Ga0495589_0042375_68_1423 | 430 |
| 506 | 3300046809 | Ga0495600_0020283 | Ga0495600_0020283_2025_3380 | 430 |
| 507 | 3300047315 | Ga0495581_0078355 | Ga0495581_0078355_258_1613 | 430 |
| 508 | 3300047317 | Ga0495604_0044079 | Ga0495604_0044079_904_2259 | 430 |
| 509 | 3300047319 | Ga0495674_0215839 | Ga0495674_0215839_88_1443 | 430 |
| 510 | 3300047321 | Ga0495676_0031142 | Ga0495676_0031142_138_1493 | 430 |
| 511 | 3300047322 | Ga0495680_0105060 | Ga0495680_0105060_348_1703 | 430 |
| 512 | 3300047323 | Ga0495683_0000761 | Ga0495683_0000761_14617_15972 | 430 |
| 513 | 3300047444 | Ga0495675_0105152 | Ga0495675_0105152_144_1499 | 430 |
| 514 | 3300047446 | Ga0495679_002470 | Ga0495679_002470_1561_2916 | 430 |
| 515 | 3300047469 | Ga0495673_0012383 | Ga0495673_0012383_97_1452 | 430 |
| 516 | 3300047673 | Ga0495593_0071574 | Ga0495593_0071574_65_1420 | 430 |
| 517 | 3300048088 | Ga0495602_0130464 | Ga0495602_0130464_145_1500 | 430 |
| 518 | 3300048089 | Ga0495614_0024828 | Ga0495614_0024828_492_1847 | 430 |
| 519 | 3300048904 | Ga0496101_0092639 | Ga0496101_0092639_887_2233 | 430 |
| 520 | 3300048906 | Ga0496103_0008845 | Ga0496103_0008845_505_1833 | 430 |
| 521 | 3300048907 | Ga0496104_0121550 | Ga0496104_0121550_75_1403 | 430 |
| 522 | 3300048908 | Ga0496105_0019340 | Ga0496105_0019340_1730_3076 | 430 |
| 523 | 3300048909 | Ga0496106_0022950 | Ga0496106_0022950_1055_2383 | 430 |
| 524 | 3300048912 | Ga0496109_0010742 | Ga0496109_0010742_4650_5996 | 430 |
| 525 | 3300048913 | Ga0496110_0003254 | Ga0496110_0003254_8614_9942 | 430 |
| 526 | 3300048916 | Ga0496113_0001917 | Ga0496113_0001917_4277_5605 | 430 |
| 527 | 3300048916 | Ga0496113_0030239 | Ga0496113_0030239_2162_3508 | 430 |
| 528 | 3300048918 | Ga0496115_0032847 | Ga0496115_0032847_542_1888 | 430 |
| 529 | 3300048920 | Ga0496117_0032823 | Ga0496117_0032823_1061_2389 | 430 |
| 530 | 3300048921 | Ga0496118_0038761 | Ga0496118_0038761_920_2248 | 430 |
| 531 | 3300048922 | Ga0496119_0036649 | Ga0496119_0036649_12_1340 | 430 |
| 532 | 3300048924 | Ga0496121_0003581 | Ga0496121_0003581_1055_2383 | 430 |
| 533 | 3300048927 | Ga0496124_0004561 | Ga0496124_0004561_7182_8510 | 430 |
| 534 | 3300048928 | Ga0496125_0014613 | Ga0496125_0014613_1145_2473 | 430 |
| 535 | 3300050512 | nmdc:mga0n895_114998_c1 | nmdc:mga0n895_114998_c1_1247_2596 | 430 |
| 536 | 3300009177 | Ga0105248_10020071 | Ga0105248_100200714 | 432 |
| 537 | 3300013306 | Ga0163162_10001069 | Ga0163162_1000106923 | 432 |
| 538 | 3300013308 | Ga0157375_10003972 | Ga0157375_1000397210 | 432 |
| 539 | 3300017792 | Ga0163161_10031884 | Ga0163161_100318843 | 432 |
| 540 | 3300025903 | Ga0207680_10053203 | Ga0207680_100532032 | 432 |
| 541 | 3300046459 | Ga0495629_0103896 | Ga0495629_0103896_344_1696 | 432 |
| 542 | 3300046460 | Ga0495638_0032135 | Ga0495638_0032135_210_1562 | 432 |
| 543 | 3300046474 | Ga0495605_0006007 | Ga0495605_0006007_2682_4034 | 432 |
| 544 | 3300046492 | Ga0495585_0020478 | Ga0495585_0020478_1532_2884 | 432 |
| 545 | 3300046523 | Ga0495644_0008402 | Ga0495644_0008402_2603_3955 | 432 |
| 546 | 3300046648 | Ga0495611_0072507 | Ga0495611_0072507_15_1367 | 432 |
| 547 | 3300046684 | Ga0495669_0001826 | Ga0495669_0001826_4422_5774 | 432 |
| 548 | 3300046691 | Ga0495670_0007124 | Ga0495670_0007124_2437_3789 | 432 |
| 549 | 3300046794 | Ga0495589_0002507 | Ga0495589_0002507_6480_7832 | 432 |
| 550 | 3300048905 | Ga0496102_0023131 | Ga0496102_0023131_2645_3997 | 432 |
| 551 | 3300048908 | Ga0496105_0062093 | Ga0496105_0062093_1674_3026 | 432 |
| 552 | 3300048909 | Ga0496106_0017680 | Ga0496106_0017680_1139_2491 | 432 |
| 553 | 3300048910 | Ga0496107_0009531 | Ga0496107_0009531_4890_6242 | 432 |
| 554 | 3300026067 | Ga0207678_10090778 | Ga0207678_100907782 | 433 |
| 555 | 3300031911 | Ga0307412_10000003 | Ga0307412_10000003108 | 433 |
| 556 | 3300047323 | Ga0495683_0012608 | Ga0495683_0012608_1103_2455 | 433 |
| 557 | 3300048920 | Ga0496117_0031521 | Ga0496117_0031521_2181_3533 | 433 |
| 558 | iso_pu_bacteria | 2501025501 | 2501072023 | 434 |
| 559 | iso_pu_bacteria | 2501025502 | 2501084330 | 434 |
| 560 | iso_pu_bacteria | 2501025504 | 2501411834 | 434 |
| 561 | iso_pu_bacteria | 2510065045 | 2510251112 | 434 |
| 562 | iso_pu_bacteria | 2510917013 | 2511088588 | 434 |
| 563 | iso_pu_bacteria | 2510917014 | 2511100836 | 434 |
| 564 | iso_pu_bacteria | 2510917015 | 2511107406 | 434 |
| 565 | iso_pu_bacteria | 2512047030 | 2512346027 | 434 |
| 566 | iso_pu_bacteria | 2513237082 | 2513553304 | 434 |
| 567 | iso_pu_bacteria | 2513237083 | 2513564194 | 434 |
| 568 | iso_pu_bacteria | 2515154122 | 2515685150 | 434 |
| 569 | iso_pu_bacteria | 2515154123 | 2515687037 | 434 |
| 570 | iso_pu_bacteria | 2515154189 | 2516023438 | 434 |
| 571 | iso_pu_bacteria | 2600255067 | 2600813589 | 434 |
| 572 | iso_pu_bacteria | 2718217991 | 2719640244 | 434 |
| 573 | iso_pu_bacteria | 2738541296 | 2738820955 | 434 |
| 574 | iso_pu_bacteria | 2738541298 | 2738833437 | 434 |
| 575 | iso_pu_bacteria | 2738541306 | 2738874964 | 434 |
| 576 | iso_pu_bacteria | 2738543002 | 2739186593 | 434 |
| 577 | iso_pu_bacteria | 2738543008 | 2739221562 | 434 |
| 578 | iso_pu_bacteria | 2883087390 | 2883094171 | 434 |
| 579 | iso_pu_bacteria | 2885270888 | 2885274283 | 434 |
| 580 | iso_pu_bacteria | 2900634093 | 2900634838 | 434 |
| 581 | iso_pu_bacteria | 2902682994 | 2902689863 | 434 |
| 582 | iso_pu_bacteria | 2919527303 | 2919530818 | 434 |
| 583 | iso_pu_bacteria | 2945934425 | 2945936757 | 434 |
| 584 | iso_pu_bacteria | 2990703756 | 2990709313 | 434 |
| 585 | iso_pu_bacteria | 641736151 | 642423334 | 434 |
| 586 | iso_pu_bacteria | 642555113 | 642621579 | 434 |
| 587 | iso_pu_bacteria | 8003955200 | 8003960675 | 434 |
| 588 | iso_pu_bacteria | 8055301274 | 8055302578 | 434 |
| 589 | 3300005339 | Ga0070660_100078009 | Ga0070660_1000780092 | 435 |
| 590 | 3300044842 | Ga0466957_0104811 | Ga0466957_0104811_238_1611 | 435 |
| 591 | 3300046474 | Ga0495605_0013244 | Ga0495605_0013244_252_1604 | 435 |
| 592 | 3300046512 | Ga0495610_0009776 | Ga0495610_0009776_2711_4063 | 435 |
| 593 | 3300046522 | Ga0495643_0065027 | Ga0495643_0065027_218_1570 | 435 |
| 594 | 3300046694 | Ga0495649_0018234 | Ga0495649_0018234_790_2133 | 435 |
| 595 | 3300046694 | Ga0495649_0019991 | Ga0495649_0019991_913_2265 | 435 |
| 596 | 3300047323 | Ga0495683_0042978 | Ga0495683_0042978_848_2191 | 435 |
| 597 | 3300047443 | Ga0495687_000018 | Ga0495687_000018_261738_263081 | 435 |
| 598 | 3300013105 | Ga0157369_10079723 | Ga0157369_100797233 | 436 |
| 599 | 3300037471 | Ga0395905_0003302 | Ga0395905_0003302_15483_16829 | 436 |
| 600 | 3300046463 | Ga0495653_0003314 | Ga0495653_0003314_6718_8064 | 436 |
| 601 | 3300046477 | Ga0495664_0015269 | Ga0495664_0015269_2072_3418 | 436 |
| 602 | 3300046517 | Ga0495630_0017745 | Ga0495630_0017745_2513_3859 | 436 |
| 603 | 3300046531 | Ga0495665_0000184 | Ga0495665_0000184_25272_26618 | 436 |
| 604 | 3300046678 | Ga0495599_0061613 | Ga0495599_0061613_837_2183 | 436 |
| 605 | 3300046679 | Ga0495623_0001022 | Ga0495623_0001022_996_2342 | 436 |
| 606 | 3300046680 | Ga0495646_0014296 | Ga0495646_0014296_2292_3638 | 436 |
| 607 | 3300046684 | Ga0495669_0026421 | Ga0495669_0026421_336_1682 | 436 |
| 608 | 3300046690 | Ga0495624_0000578 | Ga0495624_0000578_3247_4593 | 436 |
| 609 | 3300047317 | Ga0495604_0002912 | Ga0495604_0002912_647_1993 | 436 |
| 610 | 3300047322 | Ga0495680_0023652 | Ga0495680_0023652_3172_4518 | 436 |
| 611 | 3300047444 | Ga0495675_0029029 | Ga0495675_0029029_1288_2634 | 436 |
| 612 | 3300047673 | Ga0495593_0002613 | Ga0495593_0002613_8548_9894 | 436 |
| 613 | 3300048088 | Ga0495602_0001075 | Ga0495602_0001075_21245_22591 | 436 |
| 614 | 3300048907 | Ga0496104_0098062 | Ga0496104_0098062_197_1543 | 436 |
| 615 | 3300048918 | Ga0496115_0084565 | Ga0496115_0084565_388_1734 | 436 |
| 616 | 3300009011 | Ga0105251_10001709 | Ga0105251_1000170914 | 437 |
| 617 | 3300025226 | Ga0209674_100126 | Ga0209674_10012636 | 437 |
| 618 | 3300025256 | Ga0209759_1000093 | Ga0209759_100009362 | 437 |
| 619 | 3300025735 | Ga0207713_1008942 | Ga0207713_10089425 | 437 |
| 620 | 3300026067 | Ga0207678_10174646 | Ga0207678_101746462 | 437 |
| 621 | 3300046455 | Ga0495603_0002386 | Ga0495603_0002386_3546_4898 | 437 |
| 622 | 3300046455 | Ga0495603_0046516 | Ga0495603_0046516_464_1816 | 437 |
| 623 | 3300046457 | Ga0495590_0002665 | Ga0495590_0002665_1627_2976 | 437 |
| 624 | 3300046458 | Ga0495591_019645 | Ga0495591_019645_731_2083 | 437 |
| 625 | 3300046459 | Ga0495629_0000287 | Ga0495629_0000287_24682_26034 | 437 |
| 626 | 3300046459 | Ga0495629_0010780 | Ga0495629_0010780_3871_5223 | 437 |
| 627 | 3300046463 | Ga0495653_0052445 | Ga0495653_0052445_1042_2394 | 437 |
| 628 | 3300046472 | Ga0495580_0003175 | Ga0495580_0003175_9845_11197 | 437 |
| 629 | 3300046473 | Ga0495582_0002422 | Ga0495582_0002422_6215_7567 | 437 |
| 630 | 3300046477 | Ga0495664_0003118 | Ga0495664_0003118_1038_2390 | 437 |
| 631 | 3300046507 | Ga0495606_0002954 | Ga0495606_0002954_12135_13487 | 437 |
| 632 | 3300046514 | Ga0495618_0015313 | Ga0495618_0015313_1200_2552 | 437 |
| 633 | 3300046515 | Ga0495620_0025837 | Ga0495620_0025837_174_1523 | 437 |
| 634 | 3300046517 | Ga0495630_0001867 | Ga0495630_0001867_797_2149 | 437 |
| 635 | 3300046524 | Ga0495648_0004447 | Ga0495648_0004447_7567_8919 | 437 |
| 636 | 3300046526 | Ga0495666_0001763 | Ga0495666_0001763_2836_4188 | 437 |
| 637 | 3300046528 | Ga0495642_0005507 | Ga0495642_0005507_3339_4691 | 437 |
| 638 | 3300046529 | Ga0495652_0027851 | Ga0495652_0027851_1536_2888 | 437 |
| 639 | 3300046530 | Ga0495654_0040309 | Ga0495654_0040309_607_1959 | 437 |
| 640 | 3300046533 | Ga0495640_0044020 | Ga0495640_0044020_678_2030 | 437 |
| 641 | 3300046536 | Ga0495587_0043474 | Ga0495587_0043474_591_1943 | 437 |
| 642 | 3300046542 | Ga0495597_0006750 | Ga0495597_0006750_140_1489 | 437 |
| 643 | 3300046543 | Ga0495645_0000308 | Ga0495645_0000308_18165_19517 | 437 |
| 644 | 3300046543 | Ga0495645_0022747 | Ga0495645_0022747_2452_3804 | 437 |
| 645 | 3300046642 | Ga0495634_0003782 | Ga0495634_0003782_258_1610 | 437 |
| 646 | 3300046642 | Ga0495634_0071053 | Ga0495634_0071053_737_2089 | 437 |
| 647 | 3300046663 | Ga0495635_0061105 | Ga0495635_0061105_506_1858 | 437 |
| 648 | 3300046665 | Ga0495661_0009216 | Ga0495661_0009216_4967_6319 | 437 |
| 649 | 3300046678 | Ga0495599_0007673 | Ga0495599_0007673_2929_4281 | 437 |
| 650 | 3300046680 | Ga0495646_0002308 | Ga0495646_0002308_2859_4211 | 437 |
| 651 | 3300046689 | Ga0495613_0004361 | Ga0495613_0004361_6360_7712 | 437 |
| 652 | 3300046689 | Ga0495613_0018890 | Ga0495613_0018890_87_1439 | 437 |
| 653 | 3300046794 | Ga0495589_0009377 | Ga0495589_0009377_1240_2592 | 437 |
| 654 | 3300046794 | Ga0495589_0033249 | Ga0495589_0033249_621_1973 | 437 |
| 655 | 3300046810 | Ga0495660_0096975 | Ga0495660_0096975_137_1486 | 437 |
| 656 | 3300047315 | Ga0495581_0007802 | Ga0495581_0007802_1986_3338 | 437 |
| 657 | 3300047315 | Ga0495581_0061318 | Ga0495581_0061318_361_1713 | 437 |
| 658 | 3300047317 | Ga0495604_0013666 | Ga0495604_0013666_2823_4175 | 437 |
| 659 | 3300047319 | Ga0495674_0027499 | Ga0495674_0027499_3383_4735 | 437 |
| 660 | 3300047321 | Ga0495676_0007935 | Ga0495676_0007935_1041_2393 | 437 |
| 661 | 3300047322 | Ga0495680_0016843 | Ga0495680_0016843_913_2265 | 437 |
| 662 | 3300047323 | Ga0495683_0001566 | Ga0495683_0001566_10496_11845 | 437 |
| 663 | 3300047444 | Ga0495675_0036787 | Ga0495675_0036787_754_2106 | 437 |
| 664 | 3300047446 | Ga0495679_002330 | Ga0495679_002330_6869_8221 | 437 |
| 665 | 3300047471 | Ga0495684_0090769 | Ga0495684_0090769_319_1671 | 437 |
| 666 | 3300047673 | Ga0495593_0004417 | Ga0495593_0004417_845_2197 | 437 |
| 667 | 3300048088 | Ga0495602_0015644 | Ga0495602_0015644_1200_2552 | 437 |
| 668 | 3300048089 | Ga0495614_0006254 | Ga0495614_0006254_592_1944 | 437 |
| 669 | 3300048089 | Ga0495614_0038608 | Ga0495614_0038608_357_1709 | 437 |
| 670 | 3300048904 | Ga0496101_0026165 | Ga0496101_0026165_1358_2710 | 437 |
| 671 | 3300048905 | Ga0496102_0022584 | Ga0496102_0022584_3344_4693 | 437 |
| 672 | 3300048908 | Ga0496105_0021573 | Ga0496105_0021573_2606_3958 | 437 |
| 673 | 3300048910 | Ga0496107_0018666 | Ga0496107_0018666_499_1848 | 437 |
| 674 | 3300048914 | Ga0496111_0006394 | Ga0496111_0006394_3605_4954 | 437 |
| 675 | 3300048915 | Ga0496112_0002364 | Ga0496112_0002364_5167_6516 | 437 |
| 676 | 3300048917 | Ga0496114_0000869 | Ga0496114_0000869_8332_9684 | 437 |
| 677 | 3300048918 | Ga0496115_0021018 | Ga0496115_0021018_1574_2926 | 437 |
| 678 | 3300048919 | Ga0496116_0000899 | Ga0496116_0000899_180_1529 | 437 |
| 679 | 3300048925 | Ga0496122_0006588 | Ga0496122_0006588_9213_10562 | 437 |
| 680 | 3300003214 | JGI25165J46597_1001010 | JGI25165J46597_100101013 | 438 |
| 681 | 3300003756 | Ga0055533_1000137 | Ga0055533_100013758 | 438 |
| 682 | 3300003758 | Ga0055532_1000027 | Ga0055532_100002720 | 438 |
| 683 | 3300003760 | Ga0055527_1000019 | Ga0055527_1000019182 | 438 |
| 684 | 3300003761 | Ga0055535_1000021 | Ga0055535_1000021182 | 438 |
| 685 | 3300003762 | Ga0055542_1000032 | Ga0055542_100003220 | 438 |
| 686 | 3300003763 | Ga0055529_1000038 | Ga0055529_1000038182 | 438 |
| 687 | 3300025226 | Ga0209674_100005 | Ga0209674_100005189 | 438 |
| 688 | 3300025228 | Ga0209672_100001 | Ga0209672_100001651 | 438 |
| 689 | 3300025229 | Ga0209147_100001 | Ga0209147_100001651 | 438 |
| 690 | 3300025230 | Ga0209563_104793 | Ga0209563_1047932 | 438 |
| 691 | 3300025242 | Ga0209258_100001 | Ga0209258_100001651 | 438 |
| 692 | 3300025254 | Ga0209148_1000003 | Ga0209148_1000003651 | 438 |
| 693 | 3300025256 | Ga0209759_1000085 | Ga0209759_100008536 | 438 |
| 694 | 3300025256 | Ga0209759_1000161 | Ga0209759_100016176 | 438 |
| 695 | 3300025261 | Ga0209233_1000043 | Ga0209233_100004376 | 438 |
| 696 | 3300025272 | Ga0209455_1000001 | Ga0209455_1000001651 | 438 |
| 697 | 3300027312 | Ga0209371_1008167 | Ga0209371_10081671 | 438 |
| 698 | 3300030500 | Ga0268256_1008456 | Ga0268256_10084565 | 438 |
| 699 | 3300044656 | Ga0466969_0008115 | Ga0466969_0008115_4187_5542 | 438 |
| 700 | 3300044684 | Ga0466966_0027864 | Ga0466966_0027864_359_1714 | 438 |
| 701 | 3300044765 | Ga0466970_0003997 | Ga0466970_0003997_5170_6525 | 438 |
| 702 | 3300046454 | Ga0495592_0003685 | Ga0495592_0003685_3454_4806 | 438 |
| 703 | 3300046455 | Ga0495603_0029609 | Ga0495603_0029609_901_2253 | 438 |
| 704 | 3300046457 | Ga0495590_0005975 | Ga0495590_0005975_533_1885 | 438 |
| 705 | 3300046459 | Ga0495629_0009388 | Ga0495629_0009388_2999_4351 | 438 |
| 706 | 3300046463 | Ga0495653_0003218 | Ga0495653_0003218_1978_3330 | 438 |
| 707 | 3300046471 | Ga0495650_0007998 | Ga0495650_0007998_2567_3919 | 438 |
| 708 | 3300046507 | Ga0495606_0001644 | Ga0495606_0001644_4852_6204 | 438 |
| 709 | 3300046511 | Ga0495608_0003678 | Ga0495608_0003678_5203_6555 | 438 |
| 710 | 3300046516 | Ga0495628_0036048 | Ga0495628_0036048_1605_2957 | 438 |
| 711 | 3300046529 | Ga0495652_0051284 | Ga0495652_0051284_696_2048 | 438 |
| 712 | 3300046531 | Ga0495665_0025694 | Ga0495665_0025694_1673_3025 | 438 |
| 713 | 3300046533 | Ga0495640_0013091 | Ga0495640_0013091_4169_5521 | 438 |
| 714 | 3300046663 | Ga0495635_0001524 | Ga0495635_0001524_11386_12738 | 438 |
| 715 | 3300046675 | Ga0495657_0005049 | Ga0495657_0005049_7946_9298 | 438 |
| 716 | 3300046679 | Ga0495623_0007081 | Ga0495623_0007081_1605_2957 | 438 |
| 717 | 3300046680 | Ga0495646_0035672 | Ga0495646_0035672_784_2136 | 438 |
| 718 | 3300046694 | Ga0495649_0002847 | Ga0495649_0002847_2817_4169 | 438 |
| 719 | 3300046809 | Ga0495600_0016638 | Ga0495600_0016638_800_2152 | 438 |
| 720 | 3300047315 | Ga0495581_0013578 | Ga0495581_0013578_1715_3067 | 438 |
| 721 | 3300047317 | Ga0495604_0072807 | Ga0495604_0072807_554_1906 | 438 |
| 722 | 3300047319 | Ga0495674_0068785 | Ga0495674_0068785_949_2301 | 438 |
| 723 | 3300047323 | Ga0495683_0000523 | Ga0495683_0000523_22860_24212 | 438 |
| 724 | 3300047443 | Ga0495687_018846 | Ga0495687_018846_1461_2813 | 438 |
| 725 | 3300047444 | Ga0495675_0004474 | Ga0495675_0004474_6071_7423 | 438 |
| 726 | 3300047673 | Ga0495593_0010960 | Ga0495593_0010960_1016_2368 | 438 |
| 727 | 3300048088 | Ga0495602_0028841 | Ga0495602_0028841_3397_4749 | 438 |
| 728 | 3300048089 | Ga0495614_0008107 | Ga0495614_0008107_1715_3067 | 438 |
| 729 | 3300048906 | Ga0496103_0003842 | Ga0496103_0003842_4451_5806 | 438 |
| 730 | 3300048920 | Ga0496117_0004613 | Ga0496117_0004613_2623_3978 | 438 |
| 731 | 3300048921 | Ga0496118_0001256 | Ga0496118_0001256_12347_13702 | 438 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6e9o-assembly2.cif.gz_A | e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form | 0.8529 | 12 | 412 |
| 6e9o-assembly1.cif.gz_B | e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form | 0.8427 | 16 | 412 |
| 6g9x-assembly2.cif.gz_B | crystal structure of a mfs transporter at 2.54 angstroem resolution | 0.821 | 15 | 411 |
| 7t3o-assembly1.cif.gz_A | rat vesicular glutamate transporter 2 (vglut2) in low cl condition | 0.8184 | 12 | 414 |
| 6e9o-assembly2.cif.gz_A | e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form | 0.818 | 12 | 412 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76470_233_424_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.946 | 237 | 412 | 1.20.1250.20 |
| af_O53919_11_216_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.915 | 7 | 212 | 1.20.1250.20 |
| af_P76470_6_212_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9142 | 5 | 211 | 1.20.1250.20 |
| af_O53919_239_423_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9129 | 243 | 411 | 1.20.1250.20 |
| af_Q5A896_302_490_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9122 | 237 | 412 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7TXX7-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9786 | 108 | 412 |
GO:0016020
GO:0022857 |
| AF-A0A3M4F023-F1-model_v4 | deleted | 0.9721 | 46 | 412 |
|
| AF-A0A258K3G0-F1-model_v4 | Major facilitator superfamily (MFS) profile domain-containing protein | 0.9661 | 70 | 411 |
GO:0016020
GO:0022857 |
| AF-A0A6P2FBD3-F1-model_v4 | Tartrate transporter | 0.9613 | 1 | 410 |
GO:0016020
GO:0022857 |
| AF-A0A2V5RRT2-F1-model_v4 | MFS transporter | 0.9567 | 42 | 412 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar