F477978

General Info

Members Datasets Scaffolds Average Seq Length
731 400 669 435

Family's Representative Sequence

Representative Sequence 3300042993|Ga0439440_0011246|Ga0439440_0011246_47_1546
Length 499
Sequence MERRPRVGDEEDYAKETIIRGPQSGSAVRGLRAADCGLRAIYSPGADRAAISPESALERPTEQRVDALEQSTIARVSRRLVPFLVVCYFVAYLDRVNVSFAALTMNRDLGFSASQYGFGAGVFFLAYFLFEVPSNLLLERFGARKWIARIMFTWGLISGAMAFVGGPTSFYVLRALLGVAESGFFPGIIFYLTLWFPAVYRARIIGYFMAAIPLSTVLGAPISGLLLGLDGILGLKGWQWLFIIEAAPSLILSVVVLFYLTDRPADATWLPPQERAWLVRRLESEHAHRTSRHNLSVWQALLNPKVLALSLVYFGAVATNYGLSFFLPQIVKAFGLTNFQTGLVSALPYAVGVVSIVWWGHRSDRLRERRFHASFALAVAATGIALSTMFDNPVLKMLALSIAGFGIFGNLPVFWTLPTAFLSGAAAAGGIALINSIGNLAGFAGPYAMGAIKDLTGSYTGGLLGLSVLGFLAMTLVLVLGHDTSLEHAPEERPQSITP

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2511231024 Pseudomonas sp. GM84 Isolate Nodule
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
14 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
18 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
19 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
22 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
23 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
24 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
25 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
26 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
27 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
28 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
29 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
30 2791355199
31 2855730933 Achromobacter sp. HZ28 Isolate Nodule
32 2855767633 Achromobacter sp. HZ34 Isolate Nodule
33 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
34 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
35 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
36 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
37 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
38 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
39 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
40 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
41 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
42 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
43 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
44 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
45 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
46 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
47 2922425934
48 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
49 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
50 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
51 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
52 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
53 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
54 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
55 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
61 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
62 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
63 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
64 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
67 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
68 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
71 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
76 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
77 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
94 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
95 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
105 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
204 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
205 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
206 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
207 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
210 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
219 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
222 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
223 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
247 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
248 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
325 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
326 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
327 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
350 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
351 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
354 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
359 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
381 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
382 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
383 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
384 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
385 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
386 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
387 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
392 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
394 641522639 Methylobacterium sp. 4-46 Isolate Nodule
395 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
396 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
397 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
398 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
399 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
400 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.36
Metatranscriptomes 0.41
Isolates 8.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.38
Nodule 4.24
Rhizoplane 6.43
Rhizosphere 72.78
Stem 0
Stem Tuber 0
Unclassified 12.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1001010 3300003214 Bacteria 18626
2 rootH2_10052757 3300003320 Bacteria 14719
3 rootH1_10043004 3300003323 Bacteria 5214
4 JGI25404J52841_10004087 3300003659 Bacteria 2934
5 Ga0055533_1000137 3300003756 Bacteria 78353
6 Ga0055532_1000027 3300003758 Bacteria 234571
7 Ga0055527_1000019 3300003760 Bacteria 234571
8 Ga0055535_1000021 3300003761 Bacteria 234571
9 Ga0055542_1000032 3300003762 Bacteria 234571
10 Ga0055529_1000038 3300003763 Bacteria 234571
11 Ga0055543_1005732 3300004625 Bacteria 3124
12 Ga0065712_10016758 3300005290 Bacteria 1549
13 Ga0065707_10022500 3300005295 Bacteria 1909
14 Ga0070676_10021093 3300005328 Bacteria 3645
15 Ga0070676_10028507 3300005328 Bacteria 3172
16 Ga0070683_100014434 3300005329 Bacteria 6910
17 Ga0070683_100179697 3300005329 Bacteria 2008
18 Ga0070690_100119926 3300005330 Bacteria 1764
19 Ga0070670_100002872 3300005331 Bacteria 14262
20 Ga0070670_100018702 3300005331 Bacteria 5938
21 Ga0070660_100078009 3300005339 Bacteria 2597
22 Ga0070691_10001180 3300005341 Bacteria 10937
23 Ga0070687_100028231 3300005343 Bacteria 2719
24 Ga0070675_100003322 3300005354 Bacteria 12198
25 Ga0070675_100051949 3300005354 Bacteria 3369
26 Ga0070675_100237649 3300005354 Bacteria 1591
27 Ga0070671_100020341 3300005355 Bacteria 5412
28 Ga0070671_100032569 3300005355 Bacteria 4309
29 Ga0070671_100287588 3300005355 Bacteria 1399
30 Ga0070674_100004479 3300005356 Bacteria 7972
31 Ga0070673_100010637 3300005364 Bacteria 6237
32 Ga0070673_100014715 3300005364 Bacteria 5464
33 Ga0070688_100026016 3300005365 Bacteria 3472
34 Ga0070688_100083275 3300005365 Bacteria 2075
35 Ga0070688_100104439 3300005365 Bacteria 1873
36 Ga0070667_100022997 3300005367 Bacteria 5169
37 Ga0070667_100185577 3300005367 Bacteria 1841
38 Ga0070667_100217415 3300005367 Bacteria 1700
39 Ga0070709_10036666 3300005434 Bacteria 2989
40 Ga0070709_10063888 3300005434 Bacteria 2352
41 Ga0070714_100051316 3300005435 Bacteria 3516
42 Ga0070713_100002333 3300005436 Bacteria 12376
43 Ga0070713_100014322 3300005436 Bacteria 5884
44 Ga0070713_100064159 3300005436 Bacteria 3082
45 Ga0070710_10070662 3300005437 Bacteria 2011
46 Ga0070705_100005190 3300005440 Bacteria 6327
47 Ga0070700_100002121 3300005441 Bacteria 10060
48 Ga0070700_100010299 3300005441 Bacteria 5159
49 Ga0070700_100036295 3300005441 Bacteria 2988
50 Ga0070694_100018162 3300005444 Bacteria 4460
51 Ga0070694_100019869 3300005444 Bacteria 4276
52 Ga0070662_100086492 3300005457 Bacteria 2345
53 Ga0070681_10135150 3300005458 Bacteria 2397
54 Ga0068867_100002007 3300005459 Bacteria 14213
55 Ga0068867_100027130 3300005459 Bacteria 4115
56 Ga0070685_10091284 3300005466 Bacteria 1844
57 Ga0070685_10098883 3300005466 Bacteria 1778
58 Ga0070684_100009488 3300005535 Bacteria 7666
59 Ga0070697_100017298 3300005536 Bacteria 5671
60 Ga0070697_100224951 3300005536 Bacteria 1599
61 Ga0070672_100078195 3300005543 Bacteria 2647
62 Ga0070665_100018633 3300005548 Bacteria 6957
63 Ga0070704_100034142 3300005549 Bacteria 3446
64 Ga0068855_100047693 3300005563 Bacteria 5060
65 Ga0068855_100148756 3300005563 Bacteria 2664
66 Ga0068855_100238699 3300005563 Bacteria 2032
67 Ga0070664_100165054 3300005564 Bacteria 1962
68 Ga0068856_100201070 3300005614 Bacteria 2007
69 Ga0070702_100006477 3300005615 Bacteria 5545
70 Ga0068852_100004545 3300005616 Bacteria 9820
71 Ga0068859_100111487 3300005617 Bacteria 2799
72 Ga0068859_100211536 3300005617 Bacteria 2026
73 Ga0068859_100216823 3300005617 Unclassified 2001
74 Ga0068866_10079404 3300005718 Bacteria 1758
75 Ga0068861_100023927 3300005719 Bacteria 4411
76 Ga0068861_100144008 3300005719 Bacteria 1948
77 Ga0068863_100005848 3300005841 Bacteria 12052
78 Ga0068858_100053264 3300005842 Bacteria 3743
79 Ga0068858_100116856 3300005842 Bacteria 2493
80 Ga0068858_100197222 3300005842 Bacteria 1903
81 Ga0068862_100028718 3300005844 Bacteria 4684
82 Ga0068862_100109934 3300005844 Bacteria 2419
83 Ga0081455_10000970 3300005937 Bacteria 36631
84 Ga0081455_10011905 3300005937 Bacteria 8708
85 Ga0081455_10018025 3300005937 Bacteria 6743
86 Ga0081540_1014231 3300005983 Bacteria 5112
87 Ga0081540_1020207 3300005983 Bacteria 4016
88 Ga0081540_1078592 3300005983 Bacteria 1495
89 Ga0070715_10046123 3300006163 Bacteria 1851
90 Ga0070712_100094165 3300006175 Bacteria 2200
91 Ga0070712_100165030 3300006175 Bacteria 1713
92 Ga0075367_10012258 3300006178 Bacteria 4564
93 Ga0068871_100010948 3300006358 Bacteria 6644
94 Ga0075428_100000716 3300006844 Bacteria 34355
95 Ga0075430_100038198 3300006846 Bacteria 4069
96 Ga0075434_100003344 3300006871 Bacteria 14354
97 Ga0075434_100045122 3300006871 Bacteria 4372
98 Ga0075434_100236944 3300006871 Bacteria 1845
99 Ga0075434_100259342 3300006871 Bacteria 1757
100 Ga0075429_100003354 3300006880 Bacteria 13653
101 Ga0068865_100007648 3300006881 Bacteria 6656
102 Ga0097620_100111488 3300006931 Bacteria 2799
103 Ga0097620_100211531 3300006931 Bacteria 2026
104 Ga0097620_100216819 3300006931 Unclassified 2001
105 Ga0075435_100005123 3300007076 Bacteria 9109
106 Ga0075435_100016850 3300007076 Bacteria 5517
107 Ga0099794_10000010 3300007265 Bacteria 90057
108 Ga0099794_10015237 3300007265 Bacteria 3389
109 Ga0105251_10000044 3300009011 Bacteria 113730
110 Ga0105251_10001709 3300009011 Bacteria 18381
111 Ga0105240_10140096 3300009093 Bacteria 2892
112 Ga0111539_10001075 3300009094 Bacteria 36049
113 Ga0111539_10085305 3300009094 Bacteria 3712
114 Ga0111539_10103558 3300009094 Bacteria 3340
115 Ga0105245_10086069 3300009098 Bacteria 2882
116 Ga0105245_10142872 3300009098 Bacteria 2256
117 Ga0114129_10002446 3300009147 Bacteria 25786
118 Ga0114129_10011875 3300009147 Bacteria 12387
119 Ga0114129_10059691 3300009147 Bacteria 5332
120 Ga0105242_10035603 3300009176 Bacteria 3991
121 Ga0105242_10184943 3300009176 Bacteria 1841
122 Ga0105248_10020071 3300009177 Bacteria 7402
123 Ga0105248_10076951 3300009177 Bacteria 3750
124 Ga0105248_10079722 3300009177 Bacteria 3680
125 Ga0105238_10034934 3300009551 Bacteria 5113
126 Ga0105238_10037793 3300009551 Bacteria 4906
127 Ga0105238_10166675 3300009551 Bacteria 2179
128 Ga0105239_10143640 3300010375 Bacteria 2660
129 Ga0105246_10094194 3300011119 Bacteria 2165
130 Ga0157370_10086916 3300013104 Bacteria 2937
131 Ga0157369_10036695 3300013105 Bacteria 5369
132 Ga0157369_10075017 3300013105 Bacteria 3626
133 Ga0157369_10079723 3300013105 Bacteria 3507
134 Ga0157369_10213720 3300013105 Bacteria 2021
135 Ga0157374_10033012 3300013296 Bacteria 4720
136 Ga0157378_10064352 3300013297 Bacteria 3280
137 Ga0157378_10179741 3300013297 Bacteria 1990
138 Ga0163162_10001069 3300013306 Bacteria 25456
139 Ga0163162_10102720 3300013306 Bacteria 2952
140 Ga0157375_10003972 3300013308 Bacteria 12828
141 Ga0157375_10086155 3300013308 Bacteria 3192
142 Ga0182008_10031527 3300014497 Bacteria 2668
143 Ga0182008_10092390 3300014497 Bacteria 1493
144 Ga0157379_10025945 3300014968 Bacteria 5212
145 Ga0157376_10142154 3300014969 Bacteria 2154
146 Ga0163161_10031884 3300017792 Bacteria 3758
147 Ga0206353_10788850 3300020082 Bacteria 2056
148 Ga0213876_10001700 3300021384 Bacteria 13392
149 Ga0213876_10035245 3300021384 Bacteria 2640
150 Ga0213875_10000440 3300021388 Bacteria 36355
151 Ga0213875_10000626 3300021388 Bacteria 28206
152 Ga0213875_10001904 3300021388 Bacteria 12907
153 Ga0213875_10003880 3300021388 Bacteria 8367
154 Ga0213875_10005058 3300021388 Bacteria 7142
155 Ga0224712_10062101 3300022467 Bacteria 1492
156 Ga0209674_100005 3300025226 Bacteria 1708125
157 Ga0209674_100126 3300025226 Bacteria 125779
158 Ga0209672_100001 3300025228 Bacteria 2828210
159 Ga0209147_100001 3300025229 Bacteria 2384371
160 Ga0209563_104793 3300025230 Bacteria 2535
161 Ga0209258_100001 3300025242 Bacteria 2384269
162 Ga0209677_101747 3300025253 Bacteria 9025
163 Ga0209148_1000003 3300025254 Bacteria 2384288
164 Ga0209759_1000085 3300025256 Bacteria 168382
165 Ga0209759_1000093 3300025256 Bacteria 159472
166 Ga0209759_1000161 3300025256 Bacteria 115331
167 Ga0209233_1000043 3300025261 Bacteria 509723
168 Ga0209455_1000001 3300025272 Bacteria 2384278
169 Ga0209455_1002309 3300025272 Bacteria 7470
170 Ga0207713_1000113 3300025735 Bacteria 132424
171 Ga0207713_1008942 3300025735 Bacteria 5696
172 Ga0207682_10006780 3300025893 Bacteria 4598
173 Ga0207692_10066752 3300025898 Bacteria 1881
174 Ga0207692_10120813 3300025898 Bacteria 1467
175 Ga0207710_10010466 3300025900 Bacteria 3907
176 Ga0207688_10000801 3300025901 Bacteria 15726
177 Ga0207688_10019190 3300025901 Bacteria 3722
178 Ga0207680_10053203 3300025903 Bacteria 2430
179 Ga0207685_10012541 3300025905 Bacteria 2590
180 Ga0207645_10001457 3300025907 Bacteria 19339
181 Ga0207645_10017851 3300025907 Bacteria 4678
182 Ga0207645_10065127 3300025907 Bacteria 2328
183 Ga0207654_10123665 3300025911 Bacteria 1628
184 Ga0207707_10001587 3300025912 Bacteria 20953
185 Ga0207695_10102440 3300025913 Bacteria 2855
186 Ga0207695_10137684 3300025913 Bacteria 2393
187 Ga0207693_10042007 3300025915 Bacteria 3599
188 Ga0207693_10062650 3300025915 Bacteria 2914
189 Ga0207649_10124618 3300025920 Bacteria 1742
190 Ga0207652_10024665 3300025921 Bacteria 4991
191 Ga0207681_10015327 3300025923 Bacteria 4779
192 Ga0207694_10009465 3300025924 Bacteria 7343
193 Ga0207650_10011889 3300025925 Bacteria 5998
194 Ga0207650_10029246 3300025925 Bacteria 3960
195 Ga0207659_10000151 3300025926 Bacteria 41086
196 Ga0207659_10046101 3300025926 Bacteria 3077
197 Ga0207659_10148965 3300025926 Bacteria 1825
198 Ga0207700_10079664 3300025928 Bacteria 2551
199 Ga0207700_10100262 3300025928 Bacteria 2308
200 Ga0207664_10034986 3300025929 Bacteria 3873
201 Ga0207644_10001532 3300025931 Bacteria 14889
202 Ga0207706_10037808 3300025933 Bacteria 4284
203 Ga0207706_10052543 3300025933 Bacteria 3597
204 Ga0207706_10075748 3300025933 Bacteria 2959
205 Ga0207706_10086088 3300025933 Bacteria 2762
206 Ga0207670_10011466 3300025936 Bacteria 5149
207 Ga0207670_10033903 3300025936 Bacteria 3294
208 Ga0207691_10004519 3300025940 Bacteria 13458
209 Ga0207711_10013040 3300025941 Bacteria 6903
210 Ga0207711_10019897 3300025941 Bacteria 5594
211 Ga0207711_10058072 3300025941 Bacteria 3328
212 Ga0207661_10002926 3300025944 Bacteria 11801
213 Ga0207661_10026599 3300025944 Bacteria 4411
214 Ga0207667_10215746 3300025949 Bacteria 1966
215 Ga0207667_10293366 3300025949 Bacteria 1661
216 Ga0207651_10044586 3300025960 Bacteria 2969
217 Ga0207712_10076367 3300025961 Bacteria 2425
218 Ga0207640_10166217 3300025981 Bacteria 1638
219 Ga0207658_10052593 3300025986 Bacteria 3006
220 Ga0207658_10208468 3300025986 Bacteria 1636
221 Ga0207703_10028551 3300026035 Bacteria 4399
222 Ga0207703_10044000 3300026035 Bacteria 3586
223 Ga0207703_10069244 3300026035 Bacteria 2910
224 Ga0207678_10090778 3300026067 Bacteria 2611
225 Ga0207678_10174646 3300026067 Bacteria 1834
226 Ga0207708_10001606 3300026075 Bacteria 16834
227 Ga0207708_10006098 3300026075 Bacteria 8938
228 Ga0207708_10011567 3300026075 Bacteria 6576
229 Ga0207708_10163070 3300026075 Bacteria 1761
230 Ga0207702_10090074 3300026078 Bacteria 2684
231 Ga0207641_10006954 3300026088 Bacteria 9469
232 Ga0207648_10003970 3300026089 Bacteria 15371
233 Ga0207648_10120234 3300026089 Bacteria 2309
234 Ga0207676_10065336 3300026095 Bacteria 2896
235 Ga0207674_10054063 3300026116 Bacteria 4090
236 Ga0207674_10283835 3300026116 Bacteria 1604
237 Ga0207675_100015983 3300026118 Bacteria 7005
238 Ga0207675_100265429 3300026118 Bacteria 1665
239 Ga0207698_10025813 3300026142 Bacteria 4146
240 Ga0209371_1008167 3300027312 Bacteria 3522
241 Ga0209588_1000008 3300027671 Bacteria 177025
242 Ga0207428_10078289 3300027907 Bacteria 2587
243 Ga0207428_10122150 3300027907 Bacteria 1997
244 Ga0268266_10008403 3300028379 Bacteria 9178
245 Ga0268266_10055598 3300028379 Bacteria 3403
246 Ga0268266_10244317 3300028379 Bacteria 1658
247 Ga0268265_10057480 3300028380 Bacteria 2965
248 Ga0265337_1008497 3300028556 Bacteria 3731
249 Ga0265334_10005240 3300028573 Bacteria 5676
250 Ga0265323_10004965 3300028653 Bacteria 5682
251 Ga0265322_10006588 3300028654 Bacteria 3415
252 Ga0265336_10000720 3300028666 Bacteria 17508
253 Ga0265338_10000034 3300028800 Bacteria 244623
254 Ga0265324_10011049 3300029957 Bacteria 3455
255 Ga0268256_1008456 3300030500 Bacteria 3522
256 Ga0265330_10031008 3300031235 Bacteria 2397
257 Ga0265328_10020016 3300031239 Bacteria 2564
258 Ga0265339_10008238 3300031249 Bacteria 6646
259 Ga0265339_10013072 3300031249 Bacteria 5042
260 Ga0265327_10019949 3300031251 Bacteria 4103
261 Ga0307513_10179819 3300031456 Bacteria 1980
262 Ga0307408_100117783 3300031548 Bacteria 2052
263 Ga0307412_10000003 3300031911 Bacteria 659081
264 Ga0307412_10064787 3300031911 Bacteria 2470
265 Ga0315911_1000001 3300033442 Bacteria 1088602
266 Ga0373948_0000495 3300034817 Bacteria 4916
267 Ga0373958_0000513 3300034819 Bacteria 4805
268 Ga0373929_0000168 3300035085 Bacteria 11502
269 Ga0373949_0000323 3300035090 Bacteria 16930
270 Ga0373932_0000150 3300035112 Bacteria 19959
271 Ga0373939_0000084 3300035114 Bacteria 29929
272 Ga0373941_0000528 3300035115 Bacteria 7660
273 Ga0373953_0008846 3300035117 Bacteria 3437
274 Ga0373956_0097949 3300035119 Bacteria 1358
275 Ga0373960_0000037 3300035121 Bacteria 17306
276 Ga0373943_0071486 3300035170 Bacteria 1758
277 Ga0373943_0080703 3300035170 Bacteria 1668
278 Ga0373946_0032364 3300035171 Bacteria 2100
279 Ga0373955_0016528 3300035172 Bacteria 3634
280 Ga0373961_0004131 3300035241 Bacteria 3529
281 Ga0373931_0000303 3300035691 Bacteria 20692
282 Ga0373933_0021763 3300035724 Bacteria 3646
283 Ga0373937_0007874 3300036401 Bacteria 9237
284 Ga0373937_0011489 3300036401 Bacteria 7772
285 Ga0373937_0092229 3300036401 Bacteria 2807
286 Ga0373925_0020468 3300037068 Bacteria 4816
287 Ga0373925_0069856 3300037068 Bacteria 2654
288 Ga0395900_0052469 3300037418 Bacteria 4197
289 Ga0395898_0010462 3300037466 Bacteria 9697
290 Ga0395898_0010740 3300037466 Bacteria 9566
291 Ga0395898_0047903 3300037466 Bacteria 4192
292 Ga0395905_0003302 3300037471 Bacteria 17319
293 Ga0395905_0020217 3300037471 Bacteria 6308
294 Ga0395905_0154009 3300037471 Bacteria 2162
295 Ga0436364_0254983 3300037853 Bacteria 7047
296 Ga0436364_0266271 3300037853 Bacteria 210347
297 Ga0436364_0271701 3300037853 Bacteria 23456
298 Ga0436364_0404199 3300037853 Bacteria 41005
299 Ga0436364_0885307 3300037853 Bacteria 2974
300 Ga0436364_0925092 3300037853 Bacteria 3606
301 Ga0436364_1325276 3300037853 Bacteria 58128
302 Ga0436364_1553245 3300037853 Bacteria 44239
303 Ga0395901_0030579 3300038443 Bacteria 5549
304 Ga0436365_0467544 3300039437 Bacteria 8071
305 Ga0436365_0532933 3300039437 Bacteria 3225
306 Ga0436365_0727442 3300039437 Bacteria 2323
307 Ga0436365_0802243 3300039437 Bacteria 3174
308 Ga0436360_0360856 3300039438 Bacteria 5711
309 Ga0436360_0389184 3300039438 Bacteria 1978
310 Ga0436360_0742611 3300039438 Bacteria 1508
311 Ga0436361_0043228 3300039447 Bacteria 3343
312 Ga0436361_0083385 3300039447 Bacteria 5752
313 Ga0436361_1119041 3300039447 Bacteria 2739
314 Ga0436362_0317323 3300039453 Bacteria 2406
315 Ga0439450_002885 3300042008 Bacteria 2770
316 Ga0439464_0002113 3300042439 Bacteria 4844
317 Ga0439440_0011246 3300042993 Bacteria 1885
318 Ga0466969_0008115 3300044656 Bacteria 5573
319 Ga0466972_0067295 3300044658 Bacteria 1711
320 Ga0466965_0036409 3300044683 Bacteria 2414
321 Ga0466966_0027864 3300044684 Bacteria 3682
322 Ga0466966_0033398 3300044684 Bacteria 3332
323 Ga0466966_0082178 3300044684 Bacteria 2005
324 Ga0466970_0003997 3300044765 Bacteria 7235
325 Ga0466957_0104811 3300044842 Bacteria 1787
326 Ga0466960_0019221 3300044901 Bacteria 3007
327 Ga0466959_0111990 3300045049 Bacteria 1947
328 Ga0451576_0035940 3300045051 Bacteria 5254
329 Ga0466967_0061292 3300045976 Bacteria 3337
330 Ga0495592_0003685 3300046454 Bacteria 11042
331 Ga0495592_0048855 3300046454 Bacteria 3146
332 Ga0495603_0002386 3300046455 Bacteria 11045
333 Ga0495603_0029609 3300046455 Bacteria 3301
334 Ga0495603_0046516 3300046455 Bacteria 2585
335 Ga0495603_0099314 3300046455 Bacteria 1700
336 Ga0495590_0002665 3300046457 Bacteria 7378
337 Ga0495590_0005975 3300046457 Bacteria 4772
338 Ga0495590_0013325 3300046457 Bacteria 3026
339 Ga0495591_012419 3300046458 Bacteria 3173
340 Ga0495591_019645 3300046458 Bacteria 2255
341 Ga0495629_0000047 3300046459 Bacteria 109814
342 Ga0495629_0000287 3300046459 Bacteria 43583
343 Ga0495629_0009388 3300046459 Bacteria 7156
344 Ga0495629_0010780 3300046459 Bacteria 6648
345 Ga0495629_0011415 3300046459 Bacteria 6453
346 Ga0495629_0103896 3300046459 Bacteria 1982
347 Ga0495638_0026787 3300046460 Bacteria 3735
348 Ga0495638_0032135 3300046460 Bacteria 3367
349 Ga0495651_0011893 3300046462 Bacteria 6695
350 Ga0495651_0036647 3300046462 Bacteria 3818
351 Ga0495651_0083835 3300046462 Bacteria 2402
352 Ga0495653_0000049 3300046463 Bacteria 108478
353 Ga0495653_0003218 3300046463 Bacteria 13083
354 Ga0495653_0003314 3300046463 Bacteria 12931
355 Ga0495653_0042266 3300046463 Bacteria 3551
356 Ga0495653_0051619 3300046463 Bacteria 3156
357 Ga0495653_0052445 3300046463 Bacteria 3125
358 Ga0495650_0002989 3300046471 Bacteria 12804
359 Ga0495650_0007998 3300046471 Bacteria 6254
360 Ga0495580_0000414 3300046472 Bacteria 35350
361 Ga0495580_0000860 3300046472 Bacteria 26230
362 Ga0495580_0002553 3300046472 Bacteria 15863
363 Ga0495580_0003175 3300046472 Bacteria 14083
364 Ga0495580_0031640 3300046472 Bacteria 3822
365 Ga0495582_0002422 3300046473 Bacteria 10417
366 Ga0495605_0006007 3300046474 Bacteria 7018
367 Ga0495605_0013244 3300046474 Bacteria 4553
368 Ga0495639_0036017 3300046475 Bacteria 2215
369 Ga0495664_0003118 3300046477 Bacteria 9004
370 Ga0495664_0010147 3300046477 Bacteria 5285
371 Ga0495664_0015269 3300046477 Bacteria 4363
372 Ga0495664_0138763 3300046477 Bacteria 1473
373 Ga0495585_0020478 3300046492 Bacteria 3805
374 Ga0495596_0001422 3300046500 Bacteria 13732
375 Ga0495607_0029182 3300046501 Bacteria 3397
376 Ga0495583_0013422 3300046506 Bacteria 4568
377 Ga0495606_0001644 3300046507 Bacteria 29139
378 Ga0495606_0002954 3300046507 Bacteria 18729
379 Ga0495606_0082955 3300046507 Bacteria 1988
380 Ga0495606_0085171 3300046507 Bacteria 1955
381 Ga0495608_0003678 3300046511 Bacteria 11022
382 Ga0495608_0010063 3300046511 Bacteria 6598
383 Ga0495608_0020118 3300046511 Bacteria 4589
384 Ga0495608_0105684 3300046511 Bacteria 1813
385 Ga0495610_0009776 3300046512 Bacteria 6026
386 Ga0495618_0002191 3300046514 Bacteria 12777
387 Ga0495618_0015313 3300046514 Bacteria 4679
388 Ga0495618_0058946 3300046514 Bacteria 2432
389 Ga0495620_0025837 3300046515 Bacteria 2771
390 Ga0495628_0004242 3300046516 Bacteria 12746
391 Ga0495628_0025538 3300046516 Bacteria 4825
392 Ga0495628_0036048 3300046516 Bacteria 3972
393 Ga0495630_0001867 3300046517 Bacteria 14692
394 Ga0495630_0017745 3300046517 Bacteria 5219
395 Ga0495630_0054091 3300046517 Bacteria 3007
396 Ga0495630_0054612 3300046517 Bacteria 2992
397 Ga0495630_0163141 3300046517 Bacteria 1696
398 Ga0495643_0065027 3300046522 Bacteria 1926
399 Ga0495644_0008402 3300046523 Bacteria 3977
400 Ga0495648_0004447 3300046524 Bacteria 11976
401 Ga0495648_0006073 3300046524 Bacteria 9911
402 Ga0495648_0094933 3300046524 Bacteria 1660
403 Ga0495666_0000624 3300046526 Bacteria 15954
404 Ga0495666_0001763 3300046526 Bacteria 10673
405 Ga0495642_0005507 3300046528 Bacteria 4863
406 Ga0495652_0008175 3300046529 Bacteria 9566
407 Ga0495652_0027851 3300046529 Bacteria 4976
408 Ga0495652_0051284 3300046529 Bacteria 3524
409 Ga0495652_0069097 3300046529 Bacteria 2958
410 Ga0495652_0114387 3300046529 Bacteria 2164
411 Ga0495652_0193740 3300046529 Bacteria 1549
412 Ga0495654_0040309 3300046530 Bacteria 2328
413 Ga0495665_0000184 3300046531 Bacteria 31944
414 Ga0495665_0025694 3300046531 Bacteria 3162
415 Ga0495640_0011178 3300046533 Bacteria 6910
416 Ga0495640_0013091 3300046533 Bacteria 6315
417 Ga0495640_0044020 3300046533 Bacteria 3105
418 Ga0495587_0003817 3300046536 Bacteria 9997
419 Ga0495587_0043474 3300046536 Bacteria 2675
420 Ga0495597_0006750 3300046542 Bacteria 5908
421 Ga0495645_0000308 3300046543 Bacteria 35334
422 Ga0495645_0022747 3300046543 Bacteria 4535
423 Ga0495645_0052674 3300046543 Bacteria 2960
424 Ga0495667_0007142 3300046559 Bacteria 7575
425 Ga0495656_0038668 3300046615 Bacteria 1978
426 Ga0495634_0003782 3300046642 Bacteria 12022
427 Ga0495634_0019842 3300046642 Bacteria 4771
428 Ga0495634_0071053 3300046642 Bacteria 2293
429 Ga0495611_0072507 3300046648 Bacteria 1576
430 Ga0495635_0001524 3300046663 Bacteria 15504
431 Ga0495635_0033472 3300046663 Bacteria 3565
432 Ga0495635_0061105 3300046663 Bacteria 2588
433 Ga0495661_0009216 3300046665 Bacteria 6782
434 Ga0495661_0020504 3300046665 Bacteria 4314
435 Ga0495661_0029145 3300046665 Bacteria 3526
436 Ga0495657_0005049 3300046675 Bacteria 10483
437 Ga0495599_0007673 3300046678 Bacteria 6553
438 Ga0495599_0019554 3300046678 Bacteria 4221
439 Ga0495599_0032833 3300046678 Bacteria 3259
440 Ga0495599_0061613 3300046678 Bacteria 2344
441 Ga0495599_0100124 3300046678 Bacteria 1806
442 Ga0495599_0110563 3300046678 Bacteria 1712
443 Ga0495623_0001022 3300046679 Bacteria 18934
444 Ga0495623_0007081 3300046679 Bacteria 7290
445 Ga0495623_0057642 3300046679 Bacteria 2443
446 Ga0495646_0002308 3300046680 Bacteria 11673
447 Ga0495646_0002989 3300046680 Bacteria 10483
448 Ga0495646_0014296 3300046680 Bacteria 5049
449 Ga0495646_0027334 3300046680 Bacteria 3579
450 Ga0495646_0035672 3300046680 Bacteria 3084
451 Ga0495669_0001826 3300046684 Bacteria 8708
452 Ga0495669_0026421 3300046684 Bacteria 2537
453 Ga0495669_0073600 3300046684 Bacteria 1561
454 Ga0495669_0084387 3300046684 Bacteria 1461
455 Ga0495613_0004361 3300046689 Bacteria 10586
456 Ga0495613_0018890 3300046689 Bacteria 5135
457 Ga0495613_0152476 3300046689 Bacteria 1647
458 Ga0495624_0000148 3300046690 Bacteria 51192
459 Ga0495624_0000578 3300046690 Bacteria 28629
460 Ga0495624_0008776 3300046690 Bacteria 7029
461 Ga0495624_0027521 3300046690 Bacteria 3722
462 Ga0495624_0081592 3300046690 Bacteria 2002
463 Ga0495670_0007124 3300046691 Bacteria 5505
464 Ga0495670_0008471 3300046691 Bacteria 5057
465 Ga0495671_0040019 3300046692 Bacteria 2365
466 Ga0495649_0002847 3300046694 Bacteria 12009
467 Ga0495649_0018234 3300046694 Bacteria 3953
468 Ga0495649_0019991 3300046694 Bacteria 3758
469 Ga0495649_0039484 3300046694 Bacteria 2587
470 Ga0495589_0002507 3300046794 Bacteria 10250
471 Ga0495589_0009377 3300046794 Bacteria 5090
472 Ga0495589_0033249 3300046794 Bacteria 2591
473 Ga0495589_0042375 3300046794 Bacteria 2268
474 Ga0495600_0016638 3300046809 Bacteria 4672
475 Ga0495600_0020283 3300046809 Bacteria 4251
476 Ga0495660_0096975 3300046810 Bacteria 1523
477 Ga0495581_0007802 3300047315 Bacteria 6198
478 Ga0495581_0013578 3300047315 Bacteria 4724
479 Ga0495581_0061318 3300047315 Bacteria 2173
480 Ga0495581_0078355 3300047315 Bacteria 1912
481 Ga0495604_0002912 3300047317 Bacteria 13721
482 Ga0495604_0011973 3300047317 Bacteria 6895
483 Ga0495604_0013666 3300047317 Bacteria 6475
484 Ga0495604_0023339 3300047317 Bacteria 4934
485 Ga0495604_0044079 3300047317 Bacteria 3488
486 Ga0495604_0044369 3300047317 Bacteria 3474
487 Ga0495604_0072807 3300047317 Bacteria 2595
488 Ga0495674_0017601 3300047319 Bacteria 6653
489 Ga0495674_0018306 3300047319 Bacteria 6522
490 Ga0495674_0020127 3300047319 Bacteria 6182
491 Ga0495674_0027499 3300047319 Bacteria 5198
492 Ga0495674_0032646 3300047319 Bacteria 4721
493 Ga0495674_0060134 3300047319 Bacteria 3316
494 Ga0495674_0068785 3300047319 Bacteria 3063
495 Ga0495674_0215839 3300047319 Bacteria 1587
496 Ga0495672_0019038 3300047320 Bacteria 4539
497 Ga0495676_0007935 3300047321 Bacteria 9734
498 Ga0495676_0031142 3300047321 Bacteria 4515
499 Ga0495676_0131922 3300047321 Bacteria 1802
500 Ga0495680_0016843 3300047322 Bacteria 6262
501 Ga0495680_0018452 3300047322 Bacteria 5923
502 Ga0495680_0023652 3300047322 Bacteria 5105
503 Ga0495680_0029524 3300047322 Bacteria 4490
504 Ga0495680_0105060 3300047322 Bacteria 2100
505 Ga0495683_0000523 3300047323 Bacteria 29254
506 Ga0495683_0000761 3300047323 Bacteria 23227
507 Ga0495683_0001566 3300047323 Bacteria 14818
508 Ga0495683_0012608 3300047323 Bacteria 4439
509 Ga0495683_0042978 3300047323 Bacteria 2277
510 Ga0495687_000018 3300047443 Bacteria 342973
511 Ga0495687_000022 3300047443 Bacteria 327353
512 Ga0495687_018846 3300047443 Bacteria 3400
513 Ga0495675_0004474 3300047444 Bacteria 8466
514 Ga0495675_0029029 3300047444 Bacteria 3526
515 Ga0495675_0036787 3300047444 Bacteria 3120
516 Ga0495675_0105152 3300047444 Bacteria 1764
517 Ga0495679_000041 3300047446 Bacteria 147336
518 Ga0495679_002330 3300047446 Bacteria 9755
519 Ga0495679_002470 3300047446 Bacteria 9402
520 Ga0495673_0012383 3300047469 Bacteria 4530
521 Ga0495673_0047917 3300047469 Bacteria 1886
522 Ga0495684_0024367 3300047471 Bacteria 4659
523 Ga0495684_0090769 3300047471 Bacteria 2314
524 Ga0495686_0000099 3300047472 Bacteria 180546
525 Ga0495686_0004668 3300047472 Bacteria 11120
526 Ga0495686_0017071 3300047472 Bacteria 4901
527 Ga0495686_0021136 3300047472 Bacteria 4329
528 Ga0495593_0002613 3300047673 Bacteria 10829
529 Ga0495593_0004417 3300047673 Bacteria 8357
530 Ga0495593_0006594 3300047673 Bacteria 6795
531 Ga0495593_0010960 3300047673 Bacteria 5219
532 Ga0495593_0021813 3300047673 Bacteria 3573
533 Ga0495593_0071574 3300047673 Bacteria 1800
534 Ga0495602_0001075 3300048088 Bacteria 26813
535 Ga0495602_0015644 3300048088 Bacteria 7648
536 Ga0495602_0028841 3300048088 Bacteria 5302
537 Ga0495602_0130464 3300048088 Bacteria 2005
538 Ga0495614_0006254 3300048089 Bacteria 5350
539 Ga0495614_0008107 3300048089 Bacteria 4670
540 Ga0495614_0024828 3300048089 Bacteria 2587
541 Ga0495614_0038608 3300048089 Bacteria 2049
542 Ga0496100_0101914 3300048903 Bacteria 1980
543 Ga0496100_0155868 3300048903 Bacteria 1633
544 Ga0496101_0026165 3300048904 Bacteria 4055
545 Ga0496101_0049720 3300048904 Bacteria 3017
546 Ga0496101_0092639 3300048904 Bacteria 2250
547 Ga0496101_0140515 3300048904 Bacteria 1840
548 Ga0496102_0022584 3300048905 Bacteria 5574
549 Ga0496102_0023131 3300048905 Bacteria 5515
550 Ga0496102_0092975 3300048905 Bacteria 2794
551 Ga0496103_0003842 3300048906 Bacteria 9141
552 Ga0496103_0008845 3300048906 Bacteria 5973
553 Ga0496104_0098062 3300048907 Bacteria 2805
554 Ga0496104_0121550 3300048907 Bacteria 2507
555 Ga0496105_0019340 3300048908 Bacteria 5492
556 Ga0496105_0021573 3300048908 Bacteria 5213
557 Ga0496105_0062093 3300048908 Bacteria 3084
558 Ga0496105_0126428 3300048908 Bacteria 2107
559 Ga0496106_0000051 3300048909 Bacteria 95750
560 Ga0496106_0017680 3300048909 Bacteria 5274
561 Ga0496106_0022950 3300048909 Bacteria 4634
562 Ga0496107_0009531 3300048910 Bacteria 6738
563 Ga0496107_0018666 3300048910 Bacteria 4886
564 Ga0496108_0071329 3300048911 Bacteria 2931
565 Ga0496109_0010742 3300048912 Bacteria 7837
566 Ga0496109_0041224 3300048912 Bacteria 4183
567 Ga0496109_0254514 3300048912 Bacteria 1654
568 Ga0496110_0003254 3300048913 Bacteria 12382
569 Ga0496110_0037301 3300048913 Bacteria 4224
570 Ga0496110_0068709 3300048913 Bacteria 3136
571 Ga0496110_0135186 3300048913 Bacteria 2227
572 Ga0496111_0006394 3300048914 Bacteria 7646
573 Ga0496112_0002364 3300048915 Bacteria 15157
574 Ga0496112_0004419 3300048915 Bacteria 11904
575 Ga0496112_0017474 3300048915 Bacteria 6739
576 Ga0496112_0050969 3300048915 Bacteria 4060
577 Ga0496112_0099048 3300048915 Bacteria 2885
578 Ga0496113_0001917 3300048916 Bacteria 11882
579 Ga0496113_0025143 3300048916 Bacteria 4242
580 Ga0496113_0030239 3300048916 Bacteria 3919
581 Ga0496114_0000869 3300048917 Bacteria 22582
582 Ga0496115_0021018 3300048918 Bacteria 5037
583 Ga0496115_0032847 3300048918 Bacteria 4096
584 Ga0496115_0084565 3300048918 Bacteria 2587
585 Ga0496115_0108082 3300048918 Bacteria 2284
586 Ga0496115_0113677 3300048918 Bacteria 2225
587 Ga0496116_0000899 3300048919 Bacteria 36846
588 Ga0496116_0026117 3300048919 Bacteria 4277
589 Ga0496117_0004613 3300048920 Bacteria 15034
590 Ga0496117_0024602 3300048920 Bacteria 4757
591 Ga0496117_0031521 3300048920 Bacteria 4044
592 Ga0496117_0032823 3300048920 Bacteria 3937
593 Ga0496117_0114769 3300048920 Bacteria 1668
594 Ga0496118_0001256 3300048921 Bacteria 38929
595 Ga0496118_0007222 3300048921 Bacteria 11859
596 Ga0496118_0038761 3300048921 Bacteria 3814
597 Ga0496118_0109296 3300048921 Bacteria 1841
598 Ga0496119_0036649 3300048922 Bacteria 3199
599 Ga0496119_0115197 3300048922 Bacteria 1485
600 Ga0496120_0016688 3300048923 Bacteria 4791
601 Ga0496121_0000491 3300048924 Bacteria 75865
602 Ga0496121_0003581 3300048924 Bacteria 21934
603 Ga0496121_0012704 3300048924 Bacteria 9138
604 Ga0496121_0016512 3300048924 Bacteria 7617
605 Ga0496121_0018490 3300048924 Bacteria 7023
606 Ga0496121_0024493 3300048924 Bacteria 5768
607 Ga0496121_0061503 3300048924 Bacteria 3081
608 Ga0496122_0000179 3300048925 Bacteria 149332
609 Ga0496122_0006588 3300048925 Bacteria 13254
610 Ga0496123_0000305 3300048926 Bacteria 95376
611 Ga0496124_0004561 3300048927 Bacteria 16098
612 Ga0496124_0074473 3300048927 Bacteria 2806
613 Ga0496125_0001319 3300048928 Bacteria 36659
614 Ga0496125_0014613 3300048928 Bacteria 7634
615 Ga0496125_0033439 3300048928 Bacteria 4550
616 Ga0496126_0000031 3300048929 Bacteria 373371
617 Ga0496126_0000297 3300048929 Bacteria 106129
618 Ga0496126_0000506 3300048929 Bacteria 76527
619 Ga0496126_0001335 3300048929 Bacteria 39121
620 Ga0496126_0015062 3300048929 Bacteria 7794
621 Ga0496126_0026463 3300048929 Bacteria 5562
622 Ga0496126_0032036 3300048929 Bacteria 4958
623 Ga0496126_0045397 3300048929 Bacteria 4039
624 Ga0496126_0096717 3300048929 Bacteria 2588
625 Ga0495678_023367 3300049459 Bacteria 2687
626 Ga0501291_003411 3300049514 Bacteria 1974
627 Ga0501034_0068901 3300049571 Bacteria 3548
628 Ga0501043_0086713 3300049579 Bacteria 2460
629 Ga0501046_0018761 3300049580 Bacteria 5749
630 Ga0501047_0006979 3300049581 Bacteria 10603
631 Ga0501070_0019038 3300049586 Bacteria 5758
632 Ga0501074_0038057 3300049590 Bacteria 3486
633 Ga0501202_017281 3300049652 Bacteria 1408
634 Ga0501080_0005410 3300049742 Bacteria 11388
635 Ga0501044_0081437 3300049823 Bacteria 3277
636 nmdc:mga05p37_12043_c1 3300050507 Bacteria 10321
637 nmdc:mga05p37_3101_c1 3300050507 Bacteria 19316
638 nmdc:mga05p37_8693_c1 3300050507 Bacteria 11999
639 nmdc:mga09592_3091_c1 3300050508 Bacteria 13506
640 nmdc:mga09592_3337_c1 3300050508 Bacteria 12982
641 nmdc:mga0qj67_12694_c1 3300050509 Bacteria 6353
642 nmdc:mga06r32_18406_c1 3300050510 Bacteria 6397
643 nmdc:mga06r32_43055_c1 3300050510 Bacteria 4295
644 nmdc:mga08y16_123590_c1 3300050511 Bacteria 2693
645 nmdc:mga08y16_91172_c1 3300050511 Bacteria 3177
646 nmdc:mga0n895_114998_c1 3300050512 Bacteria 2708
647 nmdc:mga0n895_46067_c1 3300050512 Bacteria 4259
648 nmdc:mga0n895_61515_c1 3300050512 Bacteria 3707
649 nmdc:mga0rr50_10716_c1 3300050513 Bacteria 5838
650 nmdc:mga0rr50_1562_c1 3300050513 Bacteria 12631
651 nmdc:mga0rr50_4849_c1 3300050513 Bacteria 7954
652 nmdc:mga0a205_130175_c1 3300050515 Bacteria 2417
653 Ga0495601_0010465 3300053077 Bacteria 5520
654 Ga0495595_0003601 3300053084 Bacteria 6155
655 Ga0495619_0003266 3300053085 Bacteria 10485
656 Ga0500644_0008217 3300053088 Bacteria 2748
657 Ga0500651_0122322 3300053093 Bacteria 1579
658 Ga0500566_0001270 3300053094 Bacteria 14724
659 Ga0500556_0000012 3300053104 Bacteria 250391
660 Ga0500642_0000110 3300053130 Bacteria 38826
661 Ga0500652_000566 3300053131 Bacteria 12950
662 Ga0500559_0000198 3300053136 Bacteria 47902
663 Ga0500568_0003536 3300053139 Bacteria 8657
664 Ga0500604_0012577 3300053151 Bacteria 2286
665 Ga0500616_0000035 3300053153 Bacteria 394242
666 Ga0500622_0000885 3300053156 Bacteria 25488
667 Ga0500636_0036660 3300053177 Bacteria 2901
668 Ga0587069_004949 3300059642 Bacteria 1525
669 Ga0466962_0031098 3300061719 Bacteria 2556

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0037301 Ga0496110_0037301_12_1100 352
2 3300048920 Ga0496117_0114769 Ga0496117_0114769_34_1209 360
3 3300048913 Ga0496110_0135186 Ga0496110_0135186_26_1246 367
4 3300005367 Ga0070667_100217415 Ga0070667_1002174151 375
5 3300025907 Ga0207645_10065127 Ga0207645_100651271 375
6 3300048904 Ga0496101_0140515 Ga0496101_0140515_430_1764 375
7 3300005355 Ga0070671_100032569 Ga0070671_1000325693 377
8 3300005331 Ga0070670_100002872 Ga0070670_1000028721 379
9 3300005354 Ga0070675_100051949 Ga0070675_1000519492 379
10 3300005364 Ga0070673_100014715 Ga0070673_1000147152 379
11 3300005564 Ga0070664_100165054 Ga0070664_1001650542 379
12 3300005617 Ga0068859_100211536 Ga0068859_1002115362 379
13 3300005842 Ga0068858_100197222 Ga0068858_1001972222 379
14 3300006175 Ga0070712_100094165 Ga0070712_1000941652 379
15 3300006931 Ga0097620_100211531 Ga0097620_1002115311 379
16 3300009098 Ga0105245_10086069 Ga0105245_100860692 379
17 3300025915 Ga0207693_10042007 Ga0207693_100420072 379
18 3300025925 Ga0207650_10011889 Ga0207650_100118891 379
19 3300025926 Ga0207659_10046101 Ga0207659_100461013 379
20 3300025931 Ga0207644_10001532 Ga0207644_100015324 379
21 3300025936 Ga0207670_10033903 Ga0207670_100339033 379
22 3300025960 Ga0207651_10044586 Ga0207651_100445862 379
23 3300025986 Ga0207658_10208468 Ga0207658_102084682 379
24 3300026035 Ga0207703_10069244 Ga0207703_100692442 379
25 3300028379 Ga0268266_10055598 Ga0268266_100555982 379
26 3300048903 Ga0496100_0101914 Ga0496100_0101914_342_1676 379
27 3300048905 Ga0496102_0092975 Ga0496102_0092975_453_1790 379
28 3300048912 Ga0496109_0041224 Ga0496109_0041224_1422_2759 379
29 3300048915 Ga0496112_0004419 Ga0496112_0004419_10247_11584 379
30 3300046463 Ga0495653_0042266 Ga0495653_0042266_14_1282 383
31 3300048904 Ga0496101_0049720 Ga0496101_0049720_315_1664 386
32 3300004625 Ga0055543_1005732 Ga0055543_10057322 387
33 3300006175 Ga0070712_100165030 Ga0070712_1001650302 387
34 3300035172 Ga0373955_0016528 Ga0373955_0016528_1973_3310 387
35 3300036401 Ga0373937_0007874 Ga0373937_0007874_2932_4269 387
36 3300046463 Ga0495653_0051619 Ga0495653_0051619_434_1771 387
37 3300046678 Ga0495599_0019554 Ga0495599_0019554_2322_3659 387
38 3300047317 Ga0495604_0011973 Ga0495604_0011973_696_2033 387
39 3300020082 Ga0206353_10788850 Ga0206353_107888502 388
40 3300028556 Ga0265337_1008497 Ga0265337_10084972 389
41 3300046511 Ga0495608_0105684 Ga0495608_0105684_25_1290 389
42 3300049571 Ga0501034_0068901 Ga0501034_0068901_1702_3060 392
43 3300049579 Ga0501043_0086713 Ga0501043_0086713_337_1695 392
44 3300050511 nmdc:mga08y16_91172_c1 nmdc:mga08y16_91172_c1_1256_2554 392
45 3300025920 Ga0207649_10124618 Ga0207649_101246182 393
46 3300005841 Ga0068863_100005848 Ga0068863_1000058483 394
47 3300026088 Ga0207641_10006954 Ga0207641_1000695410 394
48 3300046529 Ga0495652_0193740 Ga0495652_0193740_84_1406 394
49 3300046615 Ga0495656_0038668 Ga0495656_0038668_333_1631 394
50 3300046684 Ga0495669_0073600 Ga0495669_0073600_37_1335 394
51 3300050507 nmdc:mga05p37_12043_c1 nmdc:mga05p37_12043_c1_1346_2644 394
52 3300037466 Ga0395898_0047903 Ga0395898_0047903_2768_4096 395
53 3300005441 Ga0070700_100036295 Ga0070700_1000362954 396
54 3300026075 Ga0207708_10163070 Ga0207708_101630702 396
55 3300059642 Ga0587069_004949 Ga0587069_004949_192_1451 396
56 3300005355 Ga0070671_100020341 Ga0070671_1000203413 397
57 3300005367 Ga0070667_100022997 Ga0070667_1000229972 397
58 3300005842 Ga0068858_100116856 Ga0068858_1001168562 397
59 3300013306 Ga0163162_10102720 Ga0163162_101027203 397
60 3300013308 Ga0157375_10086155 Ga0157375_100861553 397
61 3300014968 Ga0157379_10025945 Ga0157379_100259452 397
62 3300025936 Ga0207670_10011466 Ga0207670_100114662 397
63 3300025941 Ga0207711_10013040 Ga0207711_100130403 397
64 3300025986 Ga0207658_10052593 Ga0207658_100525932 397
65 3300026035 Ga0207703_10028551 Ga0207703_100285514 397
66 3300007265 Ga0099794_10015237 Ga0099794_100152372 398
67 3300021388 Ga0213875_10005058 Ga0213875_100050583 398
68 3300037853 Ga0436364_0404199 Ga0436364_0404199_30855_32153 398
69 3300037853 Ga0436364_0925092 Ga0436364_0925092_1829_3133 398
70 3300005937 Ga0081455_10018025 Ga0081455_100180255 400
71 3300005983 Ga0081540_1078592 Ga0081540_10785921 400
72 3300048903 Ga0496100_0155868 Ga0496100_0155868_10_1263 400
73 3300005466 Ga0070685_10091284 Ga0070685_100912841 401
74 3300025901 Ga0207688_10000801 Ga0207688_100008019 401
75 3300048912 Ga0496109_0254514 Ga0496109_0254514_235_1533 401
76 3300005983 Ga0081540_1014231 Ga0081540_10142313 402
77 3300035117 Ga0373953_0008846 Ga0373953_0008846_1034_2362 402
78 3300035119 Ga0373956_0097949 Ga0373956_0097949_17_1345 402
79 3300035171 Ga0373946_0032364 Ga0373946_0032364_613_1941 402
80 3300036401 Ga0373937_0092229 Ga0373937_0092229_344_1858 402
81 3300046459 Ga0495629_0011415 Ga0495629_0011415_1859_3373 402
82 3300046462 Ga0495651_0083835 Ga0495651_0083835_1039_2367 402
83 3300046511 Ga0495608_0020118 Ga0495608_0020118_3016_4344 402
84 3300046514 Ga0495618_0002191 Ga0495618_0002191_9485_10999 402
85 3300046517 Ga0495630_0054091 Ga0495630_0054091_722_2236 402
86 3300046529 Ga0495652_0008175 Ga0495652_0008175_8192_9520 402
87 3300046543 Ga0495645_0052674 Ga0495645_0052674_639_1967 402
88 3300047317 Ga0495604_0023339 Ga0495604_0023339_260_1588 402
89 3300047319 Ga0495674_0018306 Ga0495674_0018306_2908_4422 402
90 3300047322 Ga0495680_0018452 Ga0495680_0018452_1556_3070 402
91 3300047471 Ga0495684_0024367 Ga0495684_0024367_901_2229 402
92 3300053077 Ga0495601_0010465 Ga0495601_0010465_2605_3933 402
93 3300053084 Ga0495595_0003601 Ga0495595_0003601_2129_3643 402
94 3300053085 Ga0495619_0003266 Ga0495619_0003266_8898_10412 402
95 3300033442 Ga0315911_1000001 Ga0315911_10000011120 405
96 3300037068 Ga0373925_0069856 Ga0373925_0069856_1316_2641 405
97 3300039437 Ga0436365_0532933 Ga0436365_0532933_1569_2885 405
98 3300005937 Ga0081455_10011905 Ga0081455_100119054 406
99 3300006871 Ga0075434_100045122 Ga0075434_1000451224 406
100 3300026035 Ga0207703_10044000 Ga0207703_100440002 406
101 3300031249 Ga0265339_10013072 Ga0265339_100130722 406
102 3300048915 Ga0496112_0050969 Ga0496112_0050969_1134_2474 406
103 3300021388 Ga0213875_10000440 Ga0213875_100004409 407
104 3300039447 Ga0436361_1119041 Ga0436361_1119041_1447_2724 407
105 3300048919 Ga0496116_0026117 Ga0496116_0026117_2202_3536 407
106 3300005563 Ga0068855_100047693 Ga0068855_1000476933 408
107 3300005617 Ga0068859_100111487 Ga0068859_1001114872 408
108 3300006931 Ga0097620_100111488 Ga0097620_1001114882 408
109 3300009551 Ga0105238_10037793 Ga0105238_100377932 408
110 3300013296 Ga0157374_10033012 Ga0157374_100330123 408
111 3300025924 Ga0207694_10009465 Ga0207694_100094652 408
112 3300028379 Ga0268266_10244317 Ga0268266_102443171 408
113 3300035724 Ga0373933_0021763 Ga0373933_0021763_2218_3543 408
114 3300037068 Ga0373925_0020468 Ga0373925_0020468_1346_2671 408
115 3300046462 Ga0495651_0011893 Ga0495651_0011893_4928_6253 408
116 3300013297 Ga0157378_10179741 Ga0157378_101797413 409
117 3300021384 Ga0213876_10035245 Ga0213876_100352452 409
118 3300037853 Ga0436364_0885307 Ga0436364_0885307_1484_2809 409
119 3300039437 Ga0436365_0467544 Ga0436365_0467544_1006_2331 409
120 3300048909 Ga0496106_0000051 Ga0496106_0000051_70526_71875 409
121 3300048924 Ga0496121_0018490 Ga0496121_0018490_3433_4782 409
122 3300036401 Ga0373937_0011489 Ga0373937_0011489_1927_3252 410
123 3300046454 Ga0495592_0048855 Ga0495592_0048855_994_2319 410
124 3300046455 Ga0495603_0099314 Ga0495603_0099314_254_1537 410
125 3300047319 Ga0495674_0060134 Ga0495674_0060134_607_1932 410
126 3300047322 Ga0495680_0029524 Ga0495680_0029524_485_1810 410
127 3300048925 Ga0496122_0000179 Ga0496122_0000179_75265_76581 410
128 3300048926 Ga0496123_0000305 Ga0496123_0000305_73210_74526 410
129 3300005536 Ga0070697_100224951 Ga0070697_1002249511 411
130 3300005563 Ga0068855_100238699 Ga0068855_1002386991 412
131 3300005616 Ga0068852_100004545 Ga0068852_1000045457 412
132 3300005983 Ga0081540_1020207 Ga0081540_10202073 412
133 3300009147 Ga0114129_10011875 Ga0114129_100118755 412
134 3300014497 Ga0182008_10092390 Ga0182008_100923901 412
135 3300022467 Ga0224712_10062101 Ga0224712_100621011 412
136 3300025949 Ga0207667_10215746 Ga0207667_102157462 412
137 3300050507 nmdc:mga05p37_8693_c1 nmdc:mga05p37_8693_c1_6676_7965 412
138 3300026142 Ga0207698_10025813 Ga0207698_100258133 413
139 3300039438 Ga0436360_0389184 Ga0436360_0389184_260_1594 413
140 iso_pu_bacteria 2791355199 2793083039 413
141 iso_pu_bacteria 2908739725 2908740944 413
142 iso_pu_bacteria 3005474847 3005476879 413
143 3300005329 Ga0070683_100014434 Ga0070683_1000144346 414
144 3300025944 Ga0207661_10026599 Ga0207661_100265992 414
145 3300025949 Ga0207667_10293366 Ga0207667_102933661 414
146 3300031239 Ga0265328_10020016 Ga0265328_100200162 414
147 3300031249 Ga0265339_10008238 Ga0265339_100082382 414
148 3300047319 Ga0495674_0032646 Ga0495674_0032646_102_1451 414
149 3300048924 Ga0496121_0016512 Ga0496121_0016512_5117_6442 414
150 3300005328 Ga0070676_10028507 Ga0070676_100285071 415
151 3300005341 Ga0070691_10001180 Ga0070691_100011807 415
152 3300005440 Ga0070705_100005190 Ga0070705_1000051901 415
153 3300005441 Ga0070700_100002121 Ga0070700_1000021214 415
154 3300005444 Ga0070694_100018162 Ga0070694_1000181624 415
155 3300005444 Ga0070694_100019869 Ga0070694_1000198693 415
156 3300005459 Ga0068867_100027130 Ga0068867_1000271303 415
157 3300005615 Ga0070702_100006477 Ga0070702_1000064773 415
158 3300005617 Ga0068859_100216823 Ga0068859_1002168233 415
159 3300005719 Ga0068861_100023927 Ga0068861_1000239273 415
160 3300006178 Ga0075367_10012258 Ga0075367_100122582 415
161 3300006931 Ga0097620_100216819 Ga0097620_1002168192 415
162 3300007265 Ga0099794_10000010 Ga0099794_100000108 415
163 3300009147 Ga0114129_10059691 Ga0114129_100596913 415
164 3300013105 Ga0157369_10213720 Ga0157369_102137201 415
165 3300014497 Ga0182008_10031527 Ga0182008_100315271 415
166 3300021384 Ga0213876_10001700 Ga0213876_100017009 415
167 3300025907 Ga0207645_10017851 Ga0207645_100178511 415
168 3300026075 Ga0207708_10006098 Ga0207708_100060987 415
169 3300027671 Ga0209588_1000008 Ga0209588_100000892 415
170 3300037466 Ga0395898_0010462 Ga0395898_0010462_7445_8782 415
171 3300039437 Ga0436365_0727442 Ga0436365_0727442_690_2015 415
172 3300039437 Ga0436365_0802243 Ga0436365_0802243_1818_3143 415
173 3300039453 Ga0436362_0317323 Ga0436362_0317323_1048_2373 415
174 3300046517 Ga0495630_0163141 Ga0495630_0163141_368_1678 415
175 3300005290 Ga0065712_10016758 Ga0065712_100167581 416
176 3300005331 Ga0070670_100018702 Ga0070670_1000187024 416
177 3300005356 Ga0070674_100004479 Ga0070674_1000044795 416
178 3300005457 Ga0070662_100086492 Ga0070662_1000864922 416
179 3300005535 Ga0070684_100009488 Ga0070684_1000094886 416
180 3300005718 Ga0068866_10079404 Ga0068866_100794042 416
181 3300005719 Ga0068861_100144008 Ga0068861_1001440082 416
182 3300005844 Ga0068862_100028718 Ga0068862_1000287182 416
183 3300009093 Ga0105240_10140096 Ga0105240_101400962 416
184 3300009094 Ga0111539_10103558 Ga0111539_101035582 416
185 3300025253 Ga0209677_101747 Ga0209677_10174710 416
186 3300025913 Ga0207695_10137684 Ga0207695_101376843 416
187 3300025923 Ga0207681_10015327 Ga0207681_100153272 416
188 3300025925 Ga0207650_10029246 Ga0207650_100292462 416
189 3300025933 Ga0207706_10052543 Ga0207706_100525433 416
190 3300025933 Ga0207706_10086088 Ga0207706_100860883 416
191 3300025944 Ga0207661_10002926 Ga0207661_100029261 416
192 3300025961 Ga0207712_10076367 Ga0207712_100763672 416
193 3300026075 Ga0207708_10011567 Ga0207708_100115672 416
194 3300026089 Ga0207648_10120234 Ga0207648_101202342 416
195 3300027907 Ga0207428_10078289 Ga0207428_100782892 416
196 3300039438 Ga0436360_0742611 Ga0436360_0742611_58_1392 416
197 3300044684 Ga0466966_0033398 Ga0466966_0033398_1198_2523 416
198 3300045049 Ga0466959_0111990 Ga0466959_0111990_494_1816 416
199 3300046460 Ga0495638_0026787 Ga0495638_0026787_368_1699 416
200 3300046472 Ga0495580_0002553 Ga0495580_0002553_11907_13238 416
201 3300046506 Ga0495583_0013422 Ga0495583_0013422_2757_4088 416
202 3300046690 Ga0495624_0027521 Ga0495624_0027521_1503_2834 416
203 3300047319 Ga0495674_0017601 Ga0495674_0017601_1503_2834 416
204 3300047472 Ga0495686_0017071 Ga0495686_0017071_2484_3815 416
205 3300047673 Ga0495593_0021813 Ga0495593_0021813_1220_2551 416
206 3300048924 Ga0496121_0012704 Ga0496121_0012704_1967_3298 416
207 3300048929 Ga0496126_0045397 Ga0496126_0045397_1863_3185 416
208 3300061719 Ga0466962_0031098 Ga0466962_0031098_875_2197 416
209 iso_pu_bacteria 2511231024 2511373570 416
210 3300005328 Ga0070676_10021093 Ga0070676_100210933 417
211 3300005330 Ga0070690_100119926 Ga0070690_1001199262 417
212 3300005343 Ga0070687_100028231 Ga0070687_1000282311 417
213 3300005364 Ga0070673_100010637 Ga0070673_1000106375 417
214 3300005365 Ga0070688_100026016 Ga0070688_1000260162 417
215 3300005365 Ga0070688_100104439 Ga0070688_1001044392 417
216 3300005367 Ga0070667_100185577 Ga0070667_1001855772 417
217 3300005441 Ga0070700_100010299 Ga0070700_1000102992 417
218 3300005459 Ga0068867_100002007 Ga0068867_1000020072 417
219 3300005466 Ga0070685_10098883 Ga0070685_100988832 417
220 3300005543 Ga0070672_100078195 Ga0070672_1000781951 417
221 3300005549 Ga0070704_100034142 Ga0070704_1000341423 417
222 3300005842 Ga0068858_100053264 Ga0068858_1000532642 417
223 3300006871 Ga0075434_100259342 Ga0075434_1002593422 417
224 3300007076 Ga0075435_100005123 Ga0075435_1000051238 417
225 3300009011 Ga0105251_10000044 Ga0105251_1000004437 417
226 3300009094 Ga0111539_10085305 Ga0111539_100853053 417
227 3300009098 Ga0105245_10142872 Ga0105245_101428722 417
228 3300009177 Ga0105248_10076951 Ga0105248_100769512 417
229 3300010375 Ga0105239_10143640 Ga0105239_101436402 417
230 3300013297 Ga0157378_10064352 Ga0157378_100643522 417
231 3300025272 Ga0209455_1002309 Ga0209455_10023095 417
232 3300025735 Ga0207713_1000113 Ga0207713_100011371 417
233 3300025893 Ga0207682_10006780 Ga0207682_100067802 417
234 3300025901 Ga0207688_10019190 Ga0207688_100191902 417
235 3300025907 Ga0207645_10001457 Ga0207645_1000145714 417
236 3300025926 Ga0207659_10148965 Ga0207659_101489652 417
237 3300025933 Ga0207706_10075748 Ga0207706_100757483 417
238 3300025940 Ga0207691_10004519 Ga0207691_100045195 417
239 3300025941 Ga0207711_10019897 Ga0207711_100198974 417
240 3300025981 Ga0207640_10166217 Ga0207640_101662171 417
241 3300026075 Ga0207708_10001606 Ga0207708_100016064 417
242 3300026089 Ga0207648_10003970 Ga0207648_100039702 417
243 3300026118 Ga0207675_100015983 Ga0207675_1000159835 417
244 3300027907 Ga0207428_10122150 Ga0207428_101221502 417
245 3300031235 Ga0265330_10031008 Ga0265330_100310082 417
246 3300047443 Ga0495687_000022 Ga0495687_000022_81312_82646 417
247 3300048908 Ga0496105_0126428 Ga0496105_0126428_745_2082 417
248 3300048915 Ga0496112_0099048 Ga0496112_0099048_1334_2665 417
249 3300048918 Ga0496115_0108082 Ga0496115_0108082_749_2086 417
250 3300050512 nmdc:mga0n895_61515_c1 nmdc:mga0n895_61515_c1_252_1583 417
251 3300050513 nmdc:mga0rr50_10716_c1 nmdc:mga0rr50_10716_c1_1485_2816 417
252 3300005458 Ga0070681_10135150 Ga0070681_101351504 418
253 3300005844 Ga0068862_100109934 Ga0068862_1001099343 418
254 3300006358 Ga0068871_100010948 Ga0068871_1000109483 418
255 3300006844 Ga0075428_100000716 Ga0075428_10000071620 418
256 3300006846 Ga0075430_100038198 Ga0075430_1000381984 418
257 3300006880 Ga0075429_100003354 Ga0075429_1000033544 418
258 3300006881 Ga0068865_100007648 Ga0068865_1000076488 418
259 3300009094 Ga0111539_10001075 Ga0111539_1000107513 418
260 3300009147 Ga0114129_10002446 Ga0114129_100024467 418
261 3300009551 Ga0105238_10166675 Ga0105238_101666751 418
262 3300025900 Ga0207710_10010466 Ga0207710_100104663 418
263 3300025921 Ga0207652_10024665 Ga0207652_100246653 418
264 3300026095 Ga0207676_10065336 Ga0207676_100653362 418
265 3300028380 Ga0268265_10057480 Ga0268265_100574802 418
266 3300037853 Ga0436364_0266271 Ga0436364_0266271_126906_128234 418
267 3300042008 Ga0439450_002885 Ga0439450_002885_450_1757 418
268 3300042439 Ga0439464_0002113 Ga0439464_0002113_3015_4322 418
269 3300042993 Ga0439440_0011246 Ga0439440_0011246_47_1546 418
270 3300048915 Ga0496112_0017474 Ga0496112_0017474_2173_3468 418
271 3300048916 Ga0496113_0025143 Ga0496113_0025143_2115_3410 418
272 3300048927 Ga0496124_0074473 Ga0496124_0074473_757_2094 418
273 3300048928 Ga0496125_0033439 Ga0496125_0033439_2500_3837 418
274 3300050507 nmdc:mga05p37_3101_c1 nmdc:mga05p37_3101_c1_9418_10725 418
275 3300050508 nmdc:mga09592_3091_c1 nmdc:mga09592_3091_c1_6988_8295 418
276 3300050509 nmdc:mga0qj67_12694_c1 nmdc:mga0qj67_12694_c1_4123_5430 418
277 3300050510 nmdc:mga06r32_43055_c1 nmdc:mga06r32_43055_c1_911_2218 418
278 3300005434 Ga0070709_10063888 Ga0070709_100638881 419
279 3300005436 Ga0070713_100014322 Ga0070713_1000143223 419
280 3300005614 Ga0068856_100201070 Ga0068856_1002010702 419
281 3300025928 Ga0207700_10079664 Ga0207700_100796641 419
282 3300028573 Ga0265334_10005240 Ga0265334_100052404 419
283 3300028653 Ga0265323_10004965 Ga0265323_100049652 419
284 3300028654 Ga0265322_10006588 Ga0265322_100065882 419
285 3300028666 Ga0265336_10000720 Ga0265336_1000072011 419
286 3300028800 Ga0265338_10000034 Ga0265338_100000344 419
287 3300029957 Ga0265324_10011049 Ga0265324_100110492 419
288 3300048929 Ga0496126_0000506 Ga0496126_0000506_26397_27746 419
289 iso_pu_bacteria 2602042107 2603857803 419
290 iso_pu_bacteria 2857524615 2857527175 419
291 iso_pu_bacteria 2919073203 2919078291 419
292 3300005354 Ga0070675_100237649 Ga0070675_1002376492 420
293 3300037471 Ga0395905_0020217 Ga0395905_0020217_974_2290 420
294 3300046507 Ga0495606_0082955 Ga0495606_0082955_668_1975 420
295 3300005354 Ga0070675_100003322 Ga0070675_10000332210 421
296 3300005355 Ga0070671_100287588 Ga0070671_1002875881 421
297 3300005365 Ga0070688_100083275 Ga0070688_1000832752 421
298 3300005434 Ga0070709_10036666 Ga0070709_100366662 421
299 3300005437 Ga0070710_10070662 Ga0070710_100706621 421
300 3300005548 Ga0070665_100018633 Ga0070665_1000186333 421
301 3300006163 Ga0070715_10046123 Ga0070715_100461232 421
302 3300006871 Ga0075434_100003344 Ga0075434_10000334412 421
303 3300007076 Ga0075435_100016850 Ga0075435_1000168502 421
304 3300009176 Ga0105242_10035603 Ga0105242_100356033 421
305 3300009176 Ga0105242_10184943 Ga0105242_101849431 421
306 3300014969 Ga0157376_10142154 Ga0157376_101421542 421
307 3300025898 Ga0207692_10066752 Ga0207692_100667521 421
308 3300025905 Ga0207685_10012541 Ga0207685_100125412 421
309 3300025911 Ga0207654_10123665 Ga0207654_101236652 421
310 3300025926 Ga0207659_10000151 Ga0207659_100001514 421
311 3300025933 Ga0207706_10037808 Ga0207706_100378082 421
312 3300026078 Ga0207702_10090074 Ga0207702_100900742 421
313 3300028379 Ga0268266_10008403 Ga0268266_100084032 421
314 3300034817 Ga0373948_0000495 Ga0373948_0000495_2302_3615 421
315 3300034819 Ga0373958_0000513 Ga0373958_0000513_451_1764 421
316 3300035085 Ga0373929_0000168 Ga0373929_0000168_2204_3517 421
317 3300035090 Ga0373949_0000323 Ga0373949_0000323_8316_9629 421
318 3300035112 Ga0373932_0000150 Ga0373932_0000150_12456_13769 421
319 3300035114 Ga0373939_0000084 Ga0373939_0000084_5544_6857 421
320 3300035115 Ga0373941_0000528 Ga0373941_0000528_4192_5505 421
321 3300035121 Ga0373960_0000037 Ga0373960_0000037_14702_16015 421
322 3300035170 Ga0373943_0080703 Ga0373943_0080703_143_1456 421
323 3300035241 Ga0373961_0004131 Ga0373961_0004131_1823_3136 421
324 3300035691 Ga0373931_0000303 Ga0373931_0000303_18223_19536 421
325 3300039438 Ga0436360_0360856 Ga0436360_0360856_1458_2762 421
326 3300039447 Ga0436361_0043228 Ga0436361_0043228_1699_3003 421
327 3300039447 Ga0436361_0083385 Ga0436361_0083385_1493_2797 421
328 3300045051 Ga0451576_0035940 Ga0451576_0035940_1279_2592 421
329 3300046501 Ga0495607_0029182 Ga0495607_0029182_322_1668 421
330 3300046524 Ga0495648_0094933 Ga0495648_0094933_10_1356 421
331 3300046665 Ga0495661_0020504 Ga0495661_0020504_840_2186 421
332 3300046691 Ga0495670_0008471 Ga0495670_0008471_209_1555 421
333 3300046692 Ga0495671_0040019 Ga0495671_0040019_353_1699 421
334 3300048911 Ga0496108_0071329 Ga0496108_0071329_1491_2798 421
335 3300048913 Ga0496110_0068709 Ga0496110_0068709_201_1511 421
336 3300048920 Ga0496117_0024602 Ga0496117_0024602_2535_3836 421
337 3300048921 Ga0496118_0007222 Ga0496118_0007222_5426_6727 421
338 3300048922 Ga0496119_0115197 Ga0496119_0115197_99_1445 421
339 3300048923 Ga0496120_0016688 Ga0496120_0016688_1809_3155 421
340 3300048924 Ga0496121_0000491 Ga0496121_0000491_64871_66223 421
341 3300048924 Ga0496121_0024493 Ga0496121_0024493_1323_2669 421
342 3300048928 Ga0496125_0001319 Ga0496125_0001319_13484_14830 421
343 3300048929 Ga0496126_0000031 Ga0496126_0000031_121851_123152 421
344 3300048929 Ga0496126_0001335 Ga0496126_0001335_22023_23375 421
345 3300048929 Ga0496126_0096717 Ga0496126_0096717_869_2215 421
346 3300050508 nmdc:mga09592_3337_c1 nmdc:mga09592_3337_c1_9085_10446 421
347 3300050510 nmdc:mga06r32_18406_c1 nmdc:mga06r32_18406_c1_235_1554 421
348 3300050511 nmdc:mga08y16_123590_c1 nmdc:mga08y16_123590_c1_639_1949 421
349 3300050512 nmdc:mga0n895_46067_c1 nmdc:mga0n895_46067_c1_946_2259 421
350 3300050513 nmdc:mga0rr50_1562_c1 nmdc:mga0rr50_1562_c1_4335_5699 421
351 3300050513 nmdc:mga0rr50_4849_c1 nmdc:mga0rr50_4849_c1_749_2062 421
352 3300050515 nmdc:mga0a205_130175_c1 nmdc:mga0a205_130175_c1_903_2252 421
353 3300053088 Ga0500644_0008217 Ga0500644_0008217_1035_2381 421
354 3300053093 Ga0500651_0122322 Ga0500651_0122322_138_1484 421
355 3300053094 Ga0500566_0001270 Ga0500566_0001270_12575_13921 421
356 3300053104 Ga0500556_0000012 Ga0500556_0000012_145556_146902 421
357 3300053130 Ga0500642_0000110 Ga0500642_0000110_26308_27654 421
358 3300053131 Ga0500652_000566 Ga0500652_000566_2129_3475 421
359 3300053136 Ga0500559_0000198 Ga0500559_0000198_3848_5194 421
360 3300053139 Ga0500568_0003536 Ga0500568_0003536_2137_3483 421
361 3300053151 Ga0500604_0012577 Ga0500604_0012577_883_2229 421
362 3300053153 Ga0500616_0000035 Ga0500616_0000035_242836_244182 421
363 3300053156 Ga0500622_0000885 Ga0500622_0000885_20269_21615 421
364 3300053177 Ga0500636_0036660 Ga0500636_0036660_936_2282 421
365 iso_pu_bacteria 2855730933 2855731201 421
366 iso_pu_bacteria 2855767633 2855767985 421
367 3300031548 Ga0307408_100117783 Ga0307408_1001177831 422
368 3300031911 Ga0307412_10064787 Ga0307412_100647872 422
369 3300045976 Ga0466967_0061292 Ga0466967_0061292_1711_3033 422
370 3300049514 Ga0501291_003411 Ga0501291_003411_596_1945 422
371 3300049652 Ga0501202_017281 Ga0501202_017281_73_1398 422
372 3300003320 rootH2_10052757 rootH2_100527576 423
373 3300021388 Ga0213875_10003880 Ga0213875_100038806 423
374 3300037853 Ga0436364_0271701 Ga0436364_0271701_19941_21275 423
375 3300046457 Ga0495590_0013325 Ga0495590_0013325_871_2223 423
376 3300046507 Ga0495606_0085171 Ga0495606_0085171_88_1440 423
377 3300046516 Ga0495628_0004242 Ga0495628_0004242_821_2218 423
378 3300046665 Ga0495661_0029145 Ga0495661_0029145_1698_3050 423
379 3300046694 Ga0495649_0039484 Ga0495649_0039484_999_2351 423
380 3300047320 Ga0495672_0019038 Ga0495672_0019038_2433_3785 423
381 3300047446 Ga0495679_000041 Ga0495679_000041_11887_13239 423
382 3300047469 Ga0495673_0047917 Ga0495673_0047917_441_1793 423
383 3300047472 Ga0495686_0000099 Ga0495686_0000099_123828_125162 423
384 3300048918 Ga0496115_0113677 Ga0496115_0113677_643_1989 423
385 3300049459 Ga0495678_023367 Ga0495678_023367_597_1949 423
386 3300003659 JGI25404J52841_10004087 JGI25404J52841_100040872 424
387 3300031456 Ga0307513_10179819 Ga0307513_101798192 424
388 3300046459 Ga0495629_0000047 Ga0495629_0000047_92540_93895 424
389 3300046463 Ga0495653_0000049 Ga0495653_0000049_91284_92639 424
390 3300046471 Ga0495650_0002989 Ga0495650_0002989_2845_4191 424
391 3300046472 Ga0495580_0000414 Ga0495580_0000414_2718_4070 424
392 3300046472 Ga0495580_0000860 Ga0495580_0000860_5043_6398 424
393 3300046516 Ga0495628_0025538 Ga0495628_0025538_1344_2699 424
394 3300046517 Ga0495630_0054612 Ga0495630_0054612_820_2172 424
395 3300046524 Ga0495648_0006073 Ga0495648_0006073_7644_8954 424
396 3300046529 Ga0495652_0069097 Ga0495652_0069097_1531_2883 424
397 3300046678 Ga0495599_0100124 Ga0495599_0100124_297_1649 424
398 3300046680 Ga0495646_0002989 Ga0495646_0002989_4082_5437 424
399 3300046684 Ga0495669_0084387 Ga0495669_0084387_89_1405 424
400 3300046690 Ga0495624_0008776 Ga0495624_0008776_1338_2693 424
401 3300047317 Ga0495604_0044369 Ga0495604_0044369_621_1973 424
402 3300047319 Ga0495674_0020127 Ga0495674_0020127_3490_4845 424
403 3300047321 Ga0495676_0131922 Ga0495676_0131922_66_1421 424
404 3300047673 Ga0495593_0006594 Ga0495593_0006594_3588_4943 424
405 3300005937 Ga0081455_10000970 Ga0081455_100009705 425
406 iso_pu_bacteria 2508501128 2509152094 425
407 iso_pu_bacteria 3003665799 3003666638 425
408 3300005295 Ga0065707_10022500 Ga0065707_100225002 426
409 3300005536 Ga0070697_100017298 Ga0070697_1000172984 426
410 3300046477 Ga0495664_0138763 Ga0495664_0138763_28_1371 426
411 3300046678 Ga0495599_0110563 Ga0495599_0110563_256_1647 426
412 iso_pu_bacteria 2513237096 2513656627 426
413 iso_pu_bacteria 2513237137 2513858583 426
414 iso_pu_bacteria 2513237145 2513917812 426
415 iso_pu_bacteria 2517572143 2517893140 426
416 iso_pu_bacteria 2545555834 2545673262 426
417 iso_pu_bacteria 2906635258 2906640854 426
418 iso_pu_bacteria 2906660503 2906661348 426
419 iso_pu_bacteria 2922425934 2922429346 426
420 iso_pu_bacteria 2935630451 2935634079 426
421 iso_pu_bacteria 2941507105 2941510970 426
422 iso_pu_bacteria 2941515067 2941518354 426
423 iso_pu_bacteria 2941523033 2941527383 426
424 iso_pu_bacteria 641522639 641641289 426
425 iso_pu_bacteria 8019555841 8019557547 426
426 iso_pu_bacteria 8019565922 8019567750 426
427 3300005329 Ga0070683_100179697 Ga0070683_1001796972 427
428 3300005436 Ga0070713_100002333 Ga0070713_10000233312 427
429 3300009551 Ga0105238_10034934 Ga0105238_100349347 427
430 3300025912 Ga0207707_10001587 Ga0207707_1000158715 427
431 3300044658 Ga0466972_0067295 Ga0466972_0067295_65_1390 427
432 3300044683 Ga0466965_0036409 Ga0466965_0036409_77_1420 427
433 3300044684 Ga0466966_0082178 Ga0466966_0082178_148_1491 427
434 iso_pu_bacteria 2513237098 2513680340 427
435 iso_pu_bacteria 2876761206 2876764807 427
436 iso_pu_bacteria 2879099564 2879101602 427
437 iso_pu_bacteria 2885383462 2885392236 427
438 iso_pu_bacteria 2903768456 2903771368 427
439 3300005435 Ga0070714_100051316 Ga0070714_1000513164 428
440 3300005436 Ga0070713_100064159 Ga0070713_1000641593 428
441 3300005563 Ga0068855_100148756 Ga0068855_1001487563 428
442 3300013104 Ga0157370_10086916 Ga0157370_100869163 428
443 3300013105 Ga0157369_10036695 Ga0157369_100366955 428
444 3300013105 Ga0157369_10075017 Ga0157369_100750171 428
445 3300021388 Ga0213875_10000626 Ga0213875_1000062623 428
446 3300021388 Ga0213875_10001904 Ga0213875_100019045 428
447 3300025913 Ga0207695_10102440 Ga0207695_101024403 428
448 3300025928 Ga0207700_10100262 Ga0207700_101002622 428
449 3300025929 Ga0207664_10034986 Ga0207664_100349865 428
450 3300026116 Ga0207674_10054063 Ga0207674_100540634 428
451 3300026116 Ga0207674_10283835 Ga0207674_102838352 428
452 3300037418 Ga0395900_0052469 Ga0395900_0052469_2678_4003 428
453 3300037466 Ga0395898_0010740 Ga0395898_0010740_1796_3121 428
454 3300037853 Ga0436364_0254983 Ga0436364_0254983_4656_5981 428
455 3300037853 Ga0436364_1325276 Ga0436364_1325276_42339_43667 428
456 3300037853 Ga0436364_1553245 Ga0436364_1553245_36567_37895 428
457 3300038443 Ga0395901_0030579 Ga0395901_0030579_984_2309 428
458 3300048929 Ga0496126_0015062 Ga0496126_0015062_4743_6068 428
459 3300048929 Ga0496126_0026463 Ga0496126_0026463_2800_4128 428
460 3300048929 Ga0496126_0032036 Ga0496126_0032036_3196_4521 428
461 3300049580 Ga0501046_0018761 Ga0501046_0018761_4106_5431 428
462 3300049581 Ga0501047_0006979 Ga0501047_0006979_3878_5203 428
463 3300049586 Ga0501070_0019038 Ga0501070_0019038_3842_5167 428
464 3300049590 Ga0501074_0038057 Ga0501074_0038057_689_2014 428
465 3300049742 Ga0501080_0005410 Ga0501080_0005410_3817_5142 428
466 3300049823 Ga0501044_0081437 Ga0501044_0081437_656_1981 428
467 3300003323 rootH1_10043004 rootH1_100430042 429
468 3300009177 Ga0105248_10079722 Ga0105248_100797222 429
469 3300025941 Ga0207711_10058072 Ga0207711_100580722 429
470 3300031251 Ga0265327_10019949 Ga0265327_100199492 429
471 3300044901 Ga0466960_0019221 Ga0466960_0019221_75_1403 429
472 3300046663 Ga0495635_0033472 Ga0495635_0033472_20_1345 429
473 3300046690 Ga0495624_0000148 Ga0495624_0000148_47857_49209 429
474 3300047472 Ga0495686_0004668 Ga0495686_0004668_889_2223 429
475 3300047472 Ga0495686_0021136 Ga0495686_0021136_900_2252 429
476 3300048921 Ga0496118_0109296 Ga0496118_0109296_452_1804 429
477 3300048924 Ga0496121_0061503 Ga0496121_0061503_1325_2677 429
478 3300048929 Ga0496126_0000297 Ga0496126_0000297_59129_60481 429
479 3300006871 Ga0075434_100236944 Ga0075434_1002369441 430
480 3300011119 Ga0105246_10094194 Ga0105246_100941941 430
481 3300025898 Ga0207692_10120813 Ga0207692_101208131 430
482 3300025915 Ga0207693_10062650 Ga0207693_100626503 430
483 3300026118 Ga0207675_100265429 Ga0207675_1002654292 430
484 3300035170 Ga0373943_0071486 Ga0373943_0071486_224_1570 430
485 3300037471 Ga0395905_0154009 Ga0395905_0154009_526_1860 430
486 3300046458 Ga0495591_012419 Ga0495591_012419_215_1570 430
487 3300046462 Ga0495651_0036647 Ga0495651_0036647_127_1482 430
488 3300046472 Ga0495580_0031640 Ga0495580_0031640_284_1639 430
489 3300046475 Ga0495639_0036017 Ga0495639_0036017_310_1656 430
490 3300046477 Ga0495664_0010147 Ga0495664_0010147_3666_5021 430
491 3300046500 Ga0495596_0001422 Ga0495596_0001422_9053_10408 430
492 3300046511 Ga0495608_0010063 Ga0495608_0010063_1708_3063 430
493 3300046514 Ga0495618_0058946 Ga0495618_0058946_863_2218 430
494 3300046526 Ga0495666_0000624 Ga0495666_0000624_12383_13738 430
495 3300046529 Ga0495652_0114387 Ga0495652_0114387_528_1883 430
496 3300046533 Ga0495640_0011178 Ga0495640_0011178_3051_4406 430
497 3300046536 Ga0495587_0003817 Ga0495587_0003817_4670_6025 430
498 3300046559 Ga0495667_0007142 Ga0495667_0007142_349_1704 430
499 3300046642 Ga0495634_0019842 Ga0495634_0019842_1581_2936 430
500 3300046678 Ga0495599_0032833 Ga0495599_0032833_1551_2906 430
501 3300046679 Ga0495623_0057642 Ga0495623_0057642_680_2035 430
502 3300046680 Ga0495646_0027334 Ga0495646_0027334_389_1744 430
503 3300046689 Ga0495613_0152476 Ga0495613_0152476_144_1499 430
504 3300046690 Ga0495624_0081592 Ga0495624_0081592_65_1420 430
505 3300046794 Ga0495589_0042375 Ga0495589_0042375_68_1423 430
506 3300046809 Ga0495600_0020283 Ga0495600_0020283_2025_3380 430
507 3300047315 Ga0495581_0078355 Ga0495581_0078355_258_1613 430
508 3300047317 Ga0495604_0044079 Ga0495604_0044079_904_2259 430
509 3300047319 Ga0495674_0215839 Ga0495674_0215839_88_1443 430
510 3300047321 Ga0495676_0031142 Ga0495676_0031142_138_1493 430
511 3300047322 Ga0495680_0105060 Ga0495680_0105060_348_1703 430
512 3300047323 Ga0495683_0000761 Ga0495683_0000761_14617_15972 430
513 3300047444 Ga0495675_0105152 Ga0495675_0105152_144_1499 430
514 3300047446 Ga0495679_002470 Ga0495679_002470_1561_2916 430
515 3300047469 Ga0495673_0012383 Ga0495673_0012383_97_1452 430
516 3300047673 Ga0495593_0071574 Ga0495593_0071574_65_1420 430
517 3300048088 Ga0495602_0130464 Ga0495602_0130464_145_1500 430
518 3300048089 Ga0495614_0024828 Ga0495614_0024828_492_1847 430
519 3300048904 Ga0496101_0092639 Ga0496101_0092639_887_2233 430
520 3300048906 Ga0496103_0008845 Ga0496103_0008845_505_1833 430
521 3300048907 Ga0496104_0121550 Ga0496104_0121550_75_1403 430
522 3300048908 Ga0496105_0019340 Ga0496105_0019340_1730_3076 430
523 3300048909 Ga0496106_0022950 Ga0496106_0022950_1055_2383 430
524 3300048912 Ga0496109_0010742 Ga0496109_0010742_4650_5996 430
525 3300048913 Ga0496110_0003254 Ga0496110_0003254_8614_9942 430
526 3300048916 Ga0496113_0001917 Ga0496113_0001917_4277_5605 430
527 3300048916 Ga0496113_0030239 Ga0496113_0030239_2162_3508 430
528 3300048918 Ga0496115_0032847 Ga0496115_0032847_542_1888 430
529 3300048920 Ga0496117_0032823 Ga0496117_0032823_1061_2389 430
530 3300048921 Ga0496118_0038761 Ga0496118_0038761_920_2248 430
531 3300048922 Ga0496119_0036649 Ga0496119_0036649_12_1340 430
532 3300048924 Ga0496121_0003581 Ga0496121_0003581_1055_2383 430
533 3300048927 Ga0496124_0004561 Ga0496124_0004561_7182_8510 430
534 3300048928 Ga0496125_0014613 Ga0496125_0014613_1145_2473 430
535 3300050512 nmdc:mga0n895_114998_c1 nmdc:mga0n895_114998_c1_1247_2596 430
536 3300009177 Ga0105248_10020071 Ga0105248_100200714 432
537 3300013306 Ga0163162_10001069 Ga0163162_1000106923 432
538 3300013308 Ga0157375_10003972 Ga0157375_1000397210 432
539 3300017792 Ga0163161_10031884 Ga0163161_100318843 432
540 3300025903 Ga0207680_10053203 Ga0207680_100532032 432
541 3300046459 Ga0495629_0103896 Ga0495629_0103896_344_1696 432
542 3300046460 Ga0495638_0032135 Ga0495638_0032135_210_1562 432
543 3300046474 Ga0495605_0006007 Ga0495605_0006007_2682_4034 432
544 3300046492 Ga0495585_0020478 Ga0495585_0020478_1532_2884 432
545 3300046523 Ga0495644_0008402 Ga0495644_0008402_2603_3955 432
546 3300046648 Ga0495611_0072507 Ga0495611_0072507_15_1367 432
547 3300046684 Ga0495669_0001826 Ga0495669_0001826_4422_5774 432
548 3300046691 Ga0495670_0007124 Ga0495670_0007124_2437_3789 432
549 3300046794 Ga0495589_0002507 Ga0495589_0002507_6480_7832 432
550 3300048905 Ga0496102_0023131 Ga0496102_0023131_2645_3997 432
551 3300048908 Ga0496105_0062093 Ga0496105_0062093_1674_3026 432
552 3300048909 Ga0496106_0017680 Ga0496106_0017680_1139_2491 432
553 3300048910 Ga0496107_0009531 Ga0496107_0009531_4890_6242 432
554 3300026067 Ga0207678_10090778 Ga0207678_100907782 433
555 3300031911 Ga0307412_10000003 Ga0307412_10000003108 433
556 3300047323 Ga0495683_0012608 Ga0495683_0012608_1103_2455 433
557 3300048920 Ga0496117_0031521 Ga0496117_0031521_2181_3533 433
558 iso_pu_bacteria 2501025501 2501072023 434
559 iso_pu_bacteria 2501025502 2501084330 434
560 iso_pu_bacteria 2501025504 2501411834 434
561 iso_pu_bacteria 2510065045 2510251112 434
562 iso_pu_bacteria 2510917013 2511088588 434
563 iso_pu_bacteria 2510917014 2511100836 434
564 iso_pu_bacteria 2510917015 2511107406 434
565 iso_pu_bacteria 2512047030 2512346027 434
566 iso_pu_bacteria 2513237082 2513553304 434
567 iso_pu_bacteria 2513237083 2513564194 434
568 iso_pu_bacteria 2515154122 2515685150 434
569 iso_pu_bacteria 2515154123 2515687037 434
570 iso_pu_bacteria 2515154189 2516023438 434
571 iso_pu_bacteria 2600255067 2600813589 434
572 iso_pu_bacteria 2718217991 2719640244 434
573 iso_pu_bacteria 2738541296 2738820955 434
574 iso_pu_bacteria 2738541298 2738833437 434
575 iso_pu_bacteria 2738541306 2738874964 434
576 iso_pu_bacteria 2738543002 2739186593 434
577 iso_pu_bacteria 2738543008 2739221562 434
578 iso_pu_bacteria 2883087390 2883094171 434
579 iso_pu_bacteria 2885270888 2885274283 434
580 iso_pu_bacteria 2900634093 2900634838 434
581 iso_pu_bacteria 2902682994 2902689863 434
582 iso_pu_bacteria 2919527303 2919530818 434
583 iso_pu_bacteria 2945934425 2945936757 434
584 iso_pu_bacteria 2990703756 2990709313 434
585 iso_pu_bacteria 641736151 642423334 434
586 iso_pu_bacteria 642555113 642621579 434
587 iso_pu_bacteria 8003955200 8003960675 434
588 iso_pu_bacteria 8055301274 8055302578 434
589 3300005339 Ga0070660_100078009 Ga0070660_1000780092 435
590 3300044842 Ga0466957_0104811 Ga0466957_0104811_238_1611 435
591 3300046474 Ga0495605_0013244 Ga0495605_0013244_252_1604 435
592 3300046512 Ga0495610_0009776 Ga0495610_0009776_2711_4063 435
593 3300046522 Ga0495643_0065027 Ga0495643_0065027_218_1570 435
594 3300046694 Ga0495649_0018234 Ga0495649_0018234_790_2133 435
595 3300046694 Ga0495649_0019991 Ga0495649_0019991_913_2265 435
596 3300047323 Ga0495683_0042978 Ga0495683_0042978_848_2191 435
597 3300047443 Ga0495687_000018 Ga0495687_000018_261738_263081 435
598 3300013105 Ga0157369_10079723 Ga0157369_100797233 436
599 3300037471 Ga0395905_0003302 Ga0395905_0003302_15483_16829 436
600 3300046463 Ga0495653_0003314 Ga0495653_0003314_6718_8064 436
601 3300046477 Ga0495664_0015269 Ga0495664_0015269_2072_3418 436
602 3300046517 Ga0495630_0017745 Ga0495630_0017745_2513_3859 436
603 3300046531 Ga0495665_0000184 Ga0495665_0000184_25272_26618 436
604 3300046678 Ga0495599_0061613 Ga0495599_0061613_837_2183 436
605 3300046679 Ga0495623_0001022 Ga0495623_0001022_996_2342 436
606 3300046680 Ga0495646_0014296 Ga0495646_0014296_2292_3638 436
607 3300046684 Ga0495669_0026421 Ga0495669_0026421_336_1682 436
608 3300046690 Ga0495624_0000578 Ga0495624_0000578_3247_4593 436
609 3300047317 Ga0495604_0002912 Ga0495604_0002912_647_1993 436
610 3300047322 Ga0495680_0023652 Ga0495680_0023652_3172_4518 436
611 3300047444 Ga0495675_0029029 Ga0495675_0029029_1288_2634 436
612 3300047673 Ga0495593_0002613 Ga0495593_0002613_8548_9894 436
613 3300048088 Ga0495602_0001075 Ga0495602_0001075_21245_22591 436
614 3300048907 Ga0496104_0098062 Ga0496104_0098062_197_1543 436
615 3300048918 Ga0496115_0084565 Ga0496115_0084565_388_1734 436
616 3300009011 Ga0105251_10001709 Ga0105251_1000170914 437
617 3300025226 Ga0209674_100126 Ga0209674_10012636 437
618 3300025256 Ga0209759_1000093 Ga0209759_100009362 437
619 3300025735 Ga0207713_1008942 Ga0207713_10089425 437
620 3300026067 Ga0207678_10174646 Ga0207678_101746462 437
621 3300046455 Ga0495603_0002386 Ga0495603_0002386_3546_4898 437
622 3300046455 Ga0495603_0046516 Ga0495603_0046516_464_1816 437
623 3300046457 Ga0495590_0002665 Ga0495590_0002665_1627_2976 437
624 3300046458 Ga0495591_019645 Ga0495591_019645_731_2083 437
625 3300046459 Ga0495629_0000287 Ga0495629_0000287_24682_26034 437
626 3300046459 Ga0495629_0010780 Ga0495629_0010780_3871_5223 437
627 3300046463 Ga0495653_0052445 Ga0495653_0052445_1042_2394 437
628 3300046472 Ga0495580_0003175 Ga0495580_0003175_9845_11197 437
629 3300046473 Ga0495582_0002422 Ga0495582_0002422_6215_7567 437
630 3300046477 Ga0495664_0003118 Ga0495664_0003118_1038_2390 437
631 3300046507 Ga0495606_0002954 Ga0495606_0002954_12135_13487 437
632 3300046514 Ga0495618_0015313 Ga0495618_0015313_1200_2552 437
633 3300046515 Ga0495620_0025837 Ga0495620_0025837_174_1523 437
634 3300046517 Ga0495630_0001867 Ga0495630_0001867_797_2149 437
635 3300046524 Ga0495648_0004447 Ga0495648_0004447_7567_8919 437
636 3300046526 Ga0495666_0001763 Ga0495666_0001763_2836_4188 437
637 3300046528 Ga0495642_0005507 Ga0495642_0005507_3339_4691 437
638 3300046529 Ga0495652_0027851 Ga0495652_0027851_1536_2888 437
639 3300046530 Ga0495654_0040309 Ga0495654_0040309_607_1959 437
640 3300046533 Ga0495640_0044020 Ga0495640_0044020_678_2030 437
641 3300046536 Ga0495587_0043474 Ga0495587_0043474_591_1943 437
642 3300046542 Ga0495597_0006750 Ga0495597_0006750_140_1489 437
643 3300046543 Ga0495645_0000308 Ga0495645_0000308_18165_19517 437
644 3300046543 Ga0495645_0022747 Ga0495645_0022747_2452_3804 437
645 3300046642 Ga0495634_0003782 Ga0495634_0003782_258_1610 437
646 3300046642 Ga0495634_0071053 Ga0495634_0071053_737_2089 437
647 3300046663 Ga0495635_0061105 Ga0495635_0061105_506_1858 437
648 3300046665 Ga0495661_0009216 Ga0495661_0009216_4967_6319 437
649 3300046678 Ga0495599_0007673 Ga0495599_0007673_2929_4281 437
650 3300046680 Ga0495646_0002308 Ga0495646_0002308_2859_4211 437
651 3300046689 Ga0495613_0004361 Ga0495613_0004361_6360_7712 437
652 3300046689 Ga0495613_0018890 Ga0495613_0018890_87_1439 437
653 3300046794 Ga0495589_0009377 Ga0495589_0009377_1240_2592 437
654 3300046794 Ga0495589_0033249 Ga0495589_0033249_621_1973 437
655 3300046810 Ga0495660_0096975 Ga0495660_0096975_137_1486 437
656 3300047315 Ga0495581_0007802 Ga0495581_0007802_1986_3338 437
657 3300047315 Ga0495581_0061318 Ga0495581_0061318_361_1713 437
658 3300047317 Ga0495604_0013666 Ga0495604_0013666_2823_4175 437
659 3300047319 Ga0495674_0027499 Ga0495674_0027499_3383_4735 437
660 3300047321 Ga0495676_0007935 Ga0495676_0007935_1041_2393 437
661 3300047322 Ga0495680_0016843 Ga0495680_0016843_913_2265 437
662 3300047323 Ga0495683_0001566 Ga0495683_0001566_10496_11845 437
663 3300047444 Ga0495675_0036787 Ga0495675_0036787_754_2106 437
664 3300047446 Ga0495679_002330 Ga0495679_002330_6869_8221 437
665 3300047471 Ga0495684_0090769 Ga0495684_0090769_319_1671 437
666 3300047673 Ga0495593_0004417 Ga0495593_0004417_845_2197 437
667 3300048088 Ga0495602_0015644 Ga0495602_0015644_1200_2552 437
668 3300048089 Ga0495614_0006254 Ga0495614_0006254_592_1944 437
669 3300048089 Ga0495614_0038608 Ga0495614_0038608_357_1709 437
670 3300048904 Ga0496101_0026165 Ga0496101_0026165_1358_2710 437
671 3300048905 Ga0496102_0022584 Ga0496102_0022584_3344_4693 437
672 3300048908 Ga0496105_0021573 Ga0496105_0021573_2606_3958 437
673 3300048910 Ga0496107_0018666 Ga0496107_0018666_499_1848 437
674 3300048914 Ga0496111_0006394 Ga0496111_0006394_3605_4954 437
675 3300048915 Ga0496112_0002364 Ga0496112_0002364_5167_6516 437
676 3300048917 Ga0496114_0000869 Ga0496114_0000869_8332_9684 437
677 3300048918 Ga0496115_0021018 Ga0496115_0021018_1574_2926 437
678 3300048919 Ga0496116_0000899 Ga0496116_0000899_180_1529 437
679 3300048925 Ga0496122_0006588 Ga0496122_0006588_9213_10562 437
680 3300003214 JGI25165J46597_1001010 JGI25165J46597_100101013 438
681 3300003756 Ga0055533_1000137 Ga0055533_100013758 438
682 3300003758 Ga0055532_1000027 Ga0055532_100002720 438
683 3300003760 Ga0055527_1000019 Ga0055527_1000019182 438
684 3300003761 Ga0055535_1000021 Ga0055535_1000021182 438
685 3300003762 Ga0055542_1000032 Ga0055542_100003220 438
686 3300003763 Ga0055529_1000038 Ga0055529_1000038182 438
687 3300025226 Ga0209674_100005 Ga0209674_100005189 438
688 3300025228 Ga0209672_100001 Ga0209672_100001651 438
689 3300025229 Ga0209147_100001 Ga0209147_100001651 438
690 3300025230 Ga0209563_104793 Ga0209563_1047932 438
691 3300025242 Ga0209258_100001 Ga0209258_100001651 438
692 3300025254 Ga0209148_1000003 Ga0209148_1000003651 438
693 3300025256 Ga0209759_1000085 Ga0209759_100008536 438
694 3300025256 Ga0209759_1000161 Ga0209759_100016176 438
695 3300025261 Ga0209233_1000043 Ga0209233_100004376 438
696 3300025272 Ga0209455_1000001 Ga0209455_1000001651 438
697 3300027312 Ga0209371_1008167 Ga0209371_10081671 438
698 3300030500 Ga0268256_1008456 Ga0268256_10084565 438
699 3300044656 Ga0466969_0008115 Ga0466969_0008115_4187_5542 438
700 3300044684 Ga0466966_0027864 Ga0466966_0027864_359_1714 438
701 3300044765 Ga0466970_0003997 Ga0466970_0003997_5170_6525 438
702 3300046454 Ga0495592_0003685 Ga0495592_0003685_3454_4806 438
703 3300046455 Ga0495603_0029609 Ga0495603_0029609_901_2253 438
704 3300046457 Ga0495590_0005975 Ga0495590_0005975_533_1885 438
705 3300046459 Ga0495629_0009388 Ga0495629_0009388_2999_4351 438
706 3300046463 Ga0495653_0003218 Ga0495653_0003218_1978_3330 438
707 3300046471 Ga0495650_0007998 Ga0495650_0007998_2567_3919 438
708 3300046507 Ga0495606_0001644 Ga0495606_0001644_4852_6204 438
709 3300046511 Ga0495608_0003678 Ga0495608_0003678_5203_6555 438
710 3300046516 Ga0495628_0036048 Ga0495628_0036048_1605_2957 438
711 3300046529 Ga0495652_0051284 Ga0495652_0051284_696_2048 438
712 3300046531 Ga0495665_0025694 Ga0495665_0025694_1673_3025 438
713 3300046533 Ga0495640_0013091 Ga0495640_0013091_4169_5521 438
714 3300046663 Ga0495635_0001524 Ga0495635_0001524_11386_12738 438
715 3300046675 Ga0495657_0005049 Ga0495657_0005049_7946_9298 438
716 3300046679 Ga0495623_0007081 Ga0495623_0007081_1605_2957 438
717 3300046680 Ga0495646_0035672 Ga0495646_0035672_784_2136 438
718 3300046694 Ga0495649_0002847 Ga0495649_0002847_2817_4169 438
719 3300046809 Ga0495600_0016638 Ga0495600_0016638_800_2152 438
720 3300047315 Ga0495581_0013578 Ga0495581_0013578_1715_3067 438
721 3300047317 Ga0495604_0072807 Ga0495604_0072807_554_1906 438
722 3300047319 Ga0495674_0068785 Ga0495674_0068785_949_2301 438
723 3300047323 Ga0495683_0000523 Ga0495683_0000523_22860_24212 438
724 3300047443 Ga0495687_018846 Ga0495687_018846_1461_2813 438
725 3300047444 Ga0495675_0004474 Ga0495675_0004474_6071_7423 438
726 3300047673 Ga0495593_0010960 Ga0495593_0010960_1016_2368 438
727 3300048088 Ga0495602_0028841 Ga0495602_0028841_3397_4749 438
728 3300048089 Ga0495614_0008107 Ga0495614_0008107_1715_3067 438
729 3300048906 Ga0496103_0003842 Ga0496103_0003842_4451_5806 438
730 3300048920 Ga0496117_0004613 Ga0496117_0004613_2623_3978 438
731 3300048921 Ga0496118_0001256 Ga0496118_0001256_12347_13702 438

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

84

446

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e9o-assembly2.cif.gz_A e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.8529 12 412
6e9o-assembly1.cif.gz_B e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.8427 16 412
6g9x-assembly2.cif.gz_B crystal structure of a mfs transporter at 2.54 angstroem resolution 0.821 15 411
7t3o-assembly1.cif.gz_A rat vesicular glutamate transporter 2 (vglut2) in low cl condition 0.8184 12 414
6e9o-assembly2.cif.gz_A e. coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form 0.818 12 412
ID Description Score Start End Superfamily
af_P76470_233_424_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.946 237 412 1.20.1250.20
af_O53919_11_216_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.915 7 212 1.20.1250.20
af_P76470_6_212_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9142 5 211 1.20.1250.20
af_O53919_239_423_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9129 243 411 1.20.1250.20
af_Q5A896_302_490_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9122 237 412 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1Q7TXX7-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9786 108 412 GO:0016020
GO:0022857
AF-A0A3M4F023-F1-model_v4 deleted 0.9721 46 412
AF-A0A258K3G0-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9661 70 411 GO:0016020
GO:0022857
AF-A0A6P2FBD3-F1-model_v4 Tartrate transporter 0.9613 1 410 GO:0016020
GO:0022857
AF-A0A2V5RRT2-F1-model_v4 MFS transporter 0.9567 42 412 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
86.47 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map