F477897
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 729 | 421 | 1458 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300059605|Ga0587106_092126|Ga0587106_092126_75_512 |
| Length | 145 |
| Sequence | MARVKRAGNAHQKRREVLERASGYRGQRSRLYRKAKEQMLHSMTYAYRDRRARKGDFRQLWITRINAAARANGMTYNRLIQGLRLAEIEVDRKILADLAVNDAPAFATLVEAAKNALPEDVNAPKAADRGSRWRARGRRDASCGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 78 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 79 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 80 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 81 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 100 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 156 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 157 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 158 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 162 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 164 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 165 | 3300031810 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Unclassified |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 207 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 213 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 214 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 215 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 216 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 217 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 218 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 221 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 233 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 234 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 351 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 355 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 376 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 377 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 378 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 379 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 380 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 381 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 382 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 383 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 384 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 385 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 386 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 387 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 388 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 389 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 390 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 391 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 392 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 393 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 394 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 395 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 396 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 397 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 398 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 399 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 400 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 401 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 402 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 403 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 404 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 405 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 406 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 407 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 408 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 409 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 410 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 411 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 412 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 413 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 414 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 415 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 416 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 417 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 418 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 419 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 420 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 421 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.26 |
| Metatranscriptomes | 10.56 |
| Isolates | 6.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.92 |
| Nodule | 2.06 |
| Rhizoplane | 9.05 |
| Rhizosphere | 80.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0587106_092126 | 3300059605 | Bacteria | 607 |
| 2 | JGI24740J21852_10021807 | 3300001979 | Bacteria | 2214 |
| 3 | JGI24737J22298_10164406 | 3300001990 | Bacteria | 655 |
| 4 | JGI24735J21928_10142262 | 3300002067 | Bacteria | 692 |
| 5 | Ga0006778J45830_1014387 | 3300003162 | Bacteria | 1360 |
| 6 | JGI25406J46586_10016957 | 3300003203 | Bacteria | 3021 |
| 7 | Ga0007429J51699_1006244 | 3300003579 | Bacteria | 1679 |
| 8 | Ga0032354_1023013 | 3300003693 | Bacteria | 762 |
| 9 | Ga0058863_10008729 | 3300004799 | Bacteria | 1581 |
| 10 | Ga0058863_11754618 | 3300004799 | Bacteria | 842 |
| 11 | Ga0070658_10006607 | 3300005327 | Bacteria | 9403 |
| 12 | Ga0070658_10102952 | 3300005327 | Bacteria | 2361 |
| 13 | Ga0070658_10286184 | 3300005327 | Bacteria | 1404 |
| 14 | Ga0070658_11107071 | 3300005327 | Bacteria | 689 |
| 15 | Ga0070683_100277742 | 3300005329 | Bacteria | 1594 |
| 16 | Ga0070682_100191650 | 3300005337 | Bacteria | 1436 |
| 17 | Ga0068868_100154868 | 3300005338 | Bacteria | 1889 |
| 18 | Ga0068868_100326842 | 3300005338 | Bacteria | 1308 |
| 19 | Ga0070660_100133379 | 3300005339 | Bacteria | 1989 |
| 20 | Ga0070660_100205673 | 3300005339 | Bacteria | 1597 |
| 21 | Ga0070689_102242751 | 3300005340 | Bacteria | 501 |
| 22 | Ga0070661_100531016 | 3300005344 | Bacteria | 945 |
| 23 | Ga0070661_100724610 | 3300005344 | Bacteria | 812 |
| 24 | Ga0070692_10049461 | 3300005345 | Bacteria | 2180 |
| 25 | Ga0070668_100192535 | 3300005347 | Bacteria | 1671 |
| 26 | Ga0070668_100199839 | 3300005347 | Bacteria | 1641 |
| 27 | Ga0070669_100739899 | 3300005353 | Bacteria | 833 |
| 28 | Ga0070674_100287101 | 3300005356 | Bacteria | 1307 |
| 29 | Ga0070674_100691863 | 3300005356 | Bacteria | 871 |
| 30 | Ga0070659_100415607 | 3300005366 | Bacteria | 1137 |
| 31 | Ga0070659_101001150 | 3300005366 | Bacteria | 734 |
| 32 | Ga0070709_10485189 | 3300005434 | Bacteria | 936 |
| 33 | Ga0070714_100278130 | 3300005435 | Bacteria | 1554 |
| 34 | Ga0070714_100792359 | 3300005435 | Bacteria | 917 |
| 35 | Ga0070713_100174585 | 3300005436 | Bacteria | 1927 |
| 36 | Ga0070713_100478753 | 3300005436 | Bacteria | 1172 |
| 37 | Ga0070710_11146362 | 3300005437 | Bacteria | 572 |
| 38 | Ga0070700_100660198 | 3300005441 | Bacteria | 827 |
| 39 | Ga0070663_100242828 | 3300005455 | Bacteria | 1422 |
| 40 | Ga0070663_100292344 | 3300005455 | Bacteria | 1302 |
| 41 | Ga0070662_100126697 | 3300005457 | Bacteria | 1963 |
| 42 | Ga0070662_100980993 | 3300005457 | Bacteria | 723 |
| 43 | Ga0070681_10209184 | 3300005458 | Bacteria | 1867 |
| 44 | Ga0070681_10899354 | 3300005458 | Bacteria | 804 |
| 45 | Ga0070685_10231058 | 3300005466 | Bacteria | 1216 |
| 46 | Ga0070685_10553313 | 3300005466 | Bacteria | 822 |
| 47 | Ga0070706_100185724 | 3300005467 | Bacteria | 1942 |
| 48 | Ga0070679_100139905 | 3300005530 | Bacteria | 2400 |
| 49 | Ga0070679_100709574 | 3300005530 | Bacteria | 949 |
| 50 | Ga0070679_100963967 | 3300005530 | Bacteria | 797 |
| 51 | Ga0070684_100002926 | 3300005535 | Bacteria | 12692 |
| 52 | Ga0070684_100050033 | 3300005535 | Bacteria | 3629 |
| 53 | Ga0070684_100172192 | 3300005535 | Bacteria | 1966 |
| 54 | Ga0070684_100455649 | 3300005535 | Bacteria | 1182 |
| 55 | Ga0070684_101666520 | 3300005535 | Bacteria | 602 |
| 56 | Ga0070672_100997748 | 3300005543 | Bacteria | 742 |
| 57 | Ga0070686_100023961 | 3300005544 | Bacteria | 3654 |
| 58 | Ga0070686_100981510 | 3300005544 | Bacteria | 692 |
| 59 | Ga0070665_100004390 | 3300005548 | Bacteria | 14832 |
| 60 | Ga0070665_100656604 | 3300005548 | Bacteria | 1062 |
| 61 | Ga0070665_102433342 | 3300005548 | Bacteria | 526 |
| 62 | Ga0070664_100185440 | 3300005564 | Bacteria | 1851 |
| 63 | Ga0070664_101754223 | 3300005564 | Bacteria | 589 |
| 64 | Ga0068857_101346875 | 3300005577 | Bacteria | 693 |
| 65 | Ga0068857_102113665 | 3300005577 | Bacteria | 552 |
| 66 | Ga0068854_100378591 | 3300005578 | Bacteria | 1166 |
| 67 | Ga0068854_101369787 | 3300005578 | Bacteria | 639 |
| 68 | Ga0068856_100433031 | 3300005614 | Bacteria | 1335 |
| 69 | Ga0068856_101830448 | 3300005614 | Bacteria | 619 |
| 70 | Ga0068852_100340470 | 3300005616 | Bacteria | 1462 |
| 71 | Ga0068852_100518572 | 3300005616 | Bacteria | 1189 |
| 72 | Ga0068852_100943839 | 3300005616 | Bacteria | 881 |
| 73 | Ga0068852_101887698 | 3300005616 | Bacteria | 620 |
| 74 | Ga0068852_102294741 | 3300005616 | Bacteria | 561 |
| 75 | Ga0068859_101478142 | 3300005617 | Bacteria | 750 |
| 76 | Ga0068864_100246009 | 3300005618 | Bacteria | 1658 |
| 77 | Ga0068861_100481198 | 3300005719 | Bacteria | 1118 |
| 78 | Ga0068861_100713776 | 3300005719 | Bacteria | 933 |
| 79 | Ga0068863_100437377 | 3300005841 | Bacteria | 1282 |
| 80 | Ga0068858_100096229 | 3300005842 | Bacteria | 2759 |
| 81 | Ga0068858_100388387 | 3300005842 | Bacteria | 1340 |
| 82 | Ga0068858_101085642 | 3300005842 | Bacteria | 786 |
| 83 | Ga0068860_100520858 | 3300005843 | Bacteria | 1189 |
| 84 | Ga0068860_100630744 | 3300005843 | Bacteria | 1079 |
| 85 | Ga0068862_101609555 | 3300005844 | Bacteria | 657 |
| 86 | Ga0081539_10003164 | 3300005985 | Bacteria | 20878 |
| 87 | Ga0070717_10205556 | 3300006028 | Bacteria | 1726 |
| 88 | Ga0075365_10108161 | 3300006038 | Bacteria | 1909 |
| 89 | Ga0075365_10144508 | 3300006038 | Bacteria | 1652 |
| 90 | Ga0075365_10260514 | 3300006038 | Bacteria | 1219 |
| 91 | Ga0075364_10297460 | 3300006051 | Bacteria | 1099 |
| 92 | Ga0070715_10011147 | 3300006163 | Bacteria | 3228 |
| 93 | Ga0070715_11052779 | 3300006163 | Bacteria | 510 |
| 94 | Ga0070712_100243569 | 3300006175 | Bacteria | 1433 |
| 95 | Ga0070712_101014198 | 3300006175 | Bacteria | 719 |
| 96 | Ga0075367_10156363 | 3300006178 | Bacteria | 1417 |
| 97 | Ga0075367_10235466 | 3300006178 | Bacteria | 1147 |
| 98 | Ga0097621_101700574 | 3300006237 | Bacteria | 601 |
| 99 | Ga0097621_101718689 | 3300006237 | Bacteria | 597 |
| 100 | Ga0075428_100435401 | 3300006844 | Bacteria | 1405 |
| 101 | Ga0075433_10431491 | 3300006852 | Bacteria | 1162 |
| 102 | Ga0075434_100316029 | 3300006871 | Bacteria | 1582 |
| 103 | Ga0068865_101222733 | 3300006881 | Bacteria | 665 |
| 104 | Ga0097620_101478392 | 3300006931 | Bacteria | 750 |
| 105 | Ga0105251_10025205 | 3300009011 | Bacteria | 3046 |
| 106 | Ga0105240_12529356 | 3300009093 | Bacteria | 531 |
| 107 | Ga0111539_11967347 | 3300009094 | Bacteria | 678 |
| 108 | Ga0105245_10185249 | 3300009098 | Bacteria | 1991 |
| 109 | Ga0105245_10226566 | 3300009098 | Bacteria | 1806 |
| 110 | Ga0105245_10285792 | 3300009098 | Bacteria | 1614 |
| 111 | Ga0105247_10000164 | 3300009101 | Bacteria | 64953 |
| 112 | Ga0105247_10271570 | 3300009101 | Bacteria | 1166 |
| 113 | Ga0105247_11587783 | 3300009101 | Bacteria | 537 |
| 114 | Ga0114129_12528975 | 3300009147 | Bacteria | 613 |
| 115 | Ga0105243_10281737 | 3300009148 | Bacteria | 1497 |
| 116 | Ga0105243_10853024 | 3300009148 | Bacteria | 902 |
| 117 | Ga0105241_10543835 | 3300009174 | Bacteria | 1042 |
| 118 | Ga0105242_10138057 | 3300009176 | Bacteria | 2112 |
| 119 | Ga0105242_10273200 | 3300009176 | Bacteria | 1532 |
| 120 | Ga0105248_10014721 | 3300009177 | Bacteria | 8611 |
| 121 | Ga0105248_10315196 | 3300009177 | Bacteria | 1762 |
| 122 | Ga0105248_10686154 | 3300009177 | Bacteria | 1155 |
| 123 | Ga0105237_10437167 | 3300009545 | Bacteria | 1314 |
| 124 | Ga0105238_11560585 | 3300009551 | Bacteria | 690 |
| 125 | Ga0105238_11763376 | 3300009551 | Bacteria | 651 |
| 126 | Ga0105249_10151301 | 3300009553 | Bacteria | 2234 |
| 127 | Ga0105249_10963301 | 3300009553 | Bacteria | 921 |
| 128 | Ga0105249_13456724 | 3300009553 | Bacteria | 508 |
| 129 | Ga0105239_10017093 | 3300010375 | Bacteria | 8018 |
| 130 | Ga0105239_11015283 | 3300010375 | Bacteria | 954 |
| 131 | Ga0105246_10682941 | 3300011119 | Bacteria | 898 |
| 132 | Ga0157337_1012636 | 3300012483 | Bacteria | 684 |
| 133 | Ga0157314_1021045 | 3300012500 | Bacteria | 665 |
| 134 | Ga0157313_1023544 | 3300012503 | Bacteria | 648 |
| 135 | Ga0157315_1054272 | 3300012508 | Bacteria | 547 |
| 136 | Ga0157327_1003544 | 3300012512 | Bacteria | 1157 |
| 137 | Ga0157373_10210901 | 3300013100 | Bacteria | 1370 |
| 138 | Ga0157371_10151454 | 3300013102 | Bacteria | 1654 |
| 139 | Ga0157369_10049601 | 3300013105 | Bacteria | 4550 |
| 140 | Ga0157374_10798259 | 3300013296 | Bacteria | 960 |
| 141 | Ga0157374_11959518 | 3300013296 | Bacteria | 612 |
| 142 | Ga0157374_12163644 | 3300013296 | Bacteria | 583 |
| 143 | Ga0163162_10017244 | 3300013306 | Bacteria | 7065 |
| 144 | Ga0157372_10010523 | 3300013307 | Bacteria | 9844 |
| 145 | Ga0157372_10282833 | 3300013307 | Bacteria | 1929 |
| 146 | Ga0157372_11800077 | 3300013307 | Bacteria | 704 |
| 147 | Ga0157375_10089965 | 3300013308 | Bacteria | 3127 |
| 148 | Ga0157375_12274926 | 3300013308 | Bacteria | 646 |
| 149 | Ga0163163_10051961 | 3300014325 | Bacteria | 4041 |
| 150 | Ga0163163_10467037 | 3300014325 | Bacteria | 1322 |
| 151 | Ga0163163_10589984 | 3300014325 | Bacteria | 1174 |
| 152 | Ga0163163_10639677 | 3300014325 | Bacteria | 1127 |
| 153 | Ga0163163_10663307 | 3300014325 | Bacteria | 1106 |
| 154 | Ga0157380_11168566 | 3300014326 | Bacteria | 812 |
| 155 | Ga0157377_10013190 | 3300014745 | Bacteria | 4178 |
| 156 | Ga0157377_10670909 | 3300014745 | Bacteria | 749 |
| 157 | Ga0157379_10019958 | 3300014968 | Bacteria | 5922 |
| 158 | Ga0157379_10020853 | 3300014968 | Bacteria | 5799 |
| 159 | Ga0163161_10249576 | 3300017792 | Bacteria | 1383 |
| 160 | Ga0184601_113362 | 3300019183 | Bacteria | 525 |
| 161 | Ga0184603_115429 | 3300019192 | Bacteria | 554 |
| 162 | Ga0197907_10044879 | 3300020069 | Bacteria | 678 |
| 163 | Ga0197907_10780904 | 3300020069 | Bacteria | 1789 |
| 164 | Ga0197907_10797632 | 3300020069 | Bacteria | 3670 |
| 165 | Ga0206356_10079378 | 3300020070 | Bacteria | 912 |
| 166 | Ga0206356_10489675 | 3300020070 | Bacteria | 1005 |
| 167 | Ga0206356_10658708 | 3300020070 | Bacteria | 1288 |
| 168 | Ga0206349_1092249 | 3300020075 | Bacteria | 1195 |
| 169 | Ga0206355_1470772 | 3300020076 | Bacteria | 766 |
| 170 | Ga0206351_10048513 | 3300020077 | Bacteria | 1763 |
| 171 | Ga0206351_10890993 | 3300020077 | Bacteria | 657 |
| 172 | Ga0206352_10732892 | 3300020078 | Bacteria | 1022 |
| 173 | Ga0206352_11121663 | 3300020078 | Bacteria | 1057 |
| 174 | Ga0206350_10494723 | 3300020080 | Bacteria | 1071 |
| 175 | Ga0206350_10994755 | 3300020080 | Bacteria | 1063 |
| 176 | Ga0206354_10402661 | 3300020081 | Bacteria | 1113 |
| 177 | Ga0206354_10631430 | 3300020081 | Bacteria | 1160 |
| 178 | Ga0206353_10157446 | 3300020082 | Bacteria | 799 |
| 179 | Ga0206353_10230275 | 3300020082 | Bacteria | 663 |
| 180 | Ga0206353_10340758 | 3300020082 | Bacteria | 738 |
| 181 | Ga0206353_10777893 | 3300020082 | Bacteria | 1759 |
| 182 | Ga0213876_10416479 | 3300021384 | Bacteria | 715 |
| 183 | Ga0213875_10064980 | 3300021388 | Bacteria | 1705 |
| 184 | Ga0224712_10003308 | 3300022467 | Bacteria | 4166 |
| 185 | Ga0224712_10072951 | 3300022467 | Bacteria | 1399 |
| 186 | Ga0224712_10111893 | 3300022467 | Bacteria | 1172 |
| 187 | Ga0224712_10116777 | 3300022467 | Bacteria | 1151 |
| 188 | Ga0207697_10435981 | 3300025315 | Bacteria | 581 |
| 189 | Ga0207713_1047912 | 3300025735 | Bacteria | 1725 |
| 190 | Ga0207692_10095933 | 3300025898 | Bacteria | 1618 |
| 191 | Ga0207692_10907562 | 3300025898 | Bacteria | 580 |
| 192 | Ga0207642_10434565 | 3300025899 | Bacteria | 792 |
| 193 | Ga0207710_10000178 | 3300025900 | Bacteria | 64962 |
| 194 | Ga0207710_10284143 | 3300025900 | Bacteria | 833 |
| 195 | Ga0207688_10117245 | 3300025901 | Bacteria | 1551 |
| 196 | Ga0207688_10471268 | 3300025901 | Bacteria | 784 |
| 197 | Ga0207688_10704730 | 3300025901 | Bacteria | 638 |
| 198 | Ga0207647_10011090 | 3300025904 | Bacteria | 6333 |
| 199 | Ga0207699_10070136 | 3300025906 | Bacteria | 2139 |
| 200 | Ga0207699_10691594 | 3300025906 | Bacteria | 746 |
| 201 | Ga0207705_10104754 | 3300025909 | Bacteria | 2084 |
| 202 | Ga0207705_10298662 | 3300025909 | Bacteria | 1235 |
| 203 | Ga0207705_10540152 | 3300025909 | Bacteria | 906 |
| 204 | Ga0207705_11260863 | 3300025909 | Bacteria | 565 |
| 205 | Ga0207684_10424866 | 3300025910 | Bacteria | 1142 |
| 206 | Ga0207707_10129244 | 3300025912 | Bacteria | 2209 |
| 207 | Ga0207707_10628103 | 3300025912 | Bacteria | 907 |
| 208 | Ga0207671_10191972 | 3300025914 | Bacteria | 1593 |
| 209 | Ga0207663_10095068 | 3300025916 | Bacteria | 1987 |
| 210 | Ga0207657_10143704 | 3300025919 | Bacteria | 1948 |
| 211 | Ga0207649_10402348 | 3300025920 | Bacteria | 1025 |
| 212 | Ga0207649_10473678 | 3300025920 | Bacteria | 949 |
| 213 | Ga0207649_11493641 | 3300025920 | Bacteria | 535 |
| 214 | Ga0207652_10124949 | 3300025921 | Bacteria | 2291 |
| 215 | Ga0207652_11395561 | 3300025921 | Bacteria | 604 |
| 216 | Ga0207681_10922958 | 3300025923 | Bacteria | 731 |
| 217 | Ga0207694_10460284 | 3300025924 | Bacteria | 1063 |
| 218 | Ga0207687_10147656 | 3300025927 | Bacteria | 1790 |
| 219 | Ga0207687_10240885 | 3300025927 | Bacteria | 1433 |
| 220 | Ga0207687_10252583 | 3300025927 | Bacteria | 1402 |
| 221 | Ga0207700_10071902 | 3300025928 | Bacteria | 2665 |
| 222 | Ga0207700_10123881 | 3300025928 | Bacteria | 2099 |
| 223 | Ga0207700_10439531 | 3300025928 | Bacteria | 1148 |
| 224 | Ga0207664_10018246 | 3300025929 | Bacteria | 5160 |
| 225 | Ga0207664_10297919 | 3300025929 | Bacteria | 1418 |
| 226 | Ga0207664_10436052 | 3300025929 | Bacteria | 1168 |
| 227 | Ga0207690_10666381 | 3300025932 | Bacteria | 853 |
| 228 | Ga0207690_10891458 | 3300025932 | Bacteria | 737 |
| 229 | Ga0207706_10143179 | 3300025933 | Bacteria | 2103 |
| 230 | Ga0207706_10161061 | 3300025933 | Bacteria | 1972 |
| 231 | Ga0207706_10712091 | 3300025933 | Bacteria | 857 |
| 232 | Ga0207706_11048550 | 3300025933 | Bacteria | 683 |
| 233 | Ga0207686_10470094 | 3300025934 | Bacteria | 970 |
| 234 | Ga0207686_11228218 | 3300025934 | Bacteria | 614 |
| 235 | Ga0207709_10872606 | 3300025935 | Bacteria | 730 |
| 236 | Ga0207709_11274540 | 3300025935 | Bacteria | 607 |
| 237 | Ga0207669_10396431 | 3300025937 | Bacteria | 1080 |
| 238 | Ga0207669_10594756 | 3300025937 | Bacteria | 898 |
| 239 | Ga0207711_10014264 | 3300025941 | Bacteria | 6601 |
| 240 | Ga0207711_10864930 | 3300025941 | Bacteria | 841 |
| 241 | Ga0207711_10973730 | 3300025941 | Bacteria | 787 |
| 242 | Ga0207689_10232451 | 3300025942 | Bacteria | 1524 |
| 243 | Ga0207661_10167498 | 3300025944 | Bacteria | 1910 |
| 244 | Ga0207661_10208095 | 3300025944 | Bacteria | 1723 |
| 245 | Ga0207661_10839577 | 3300025944 | Bacteria | 846 |
| 246 | Ga0207679_10245169 | 3300025945 | Bacteria | 1520 |
| 247 | Ga0207679_11026405 | 3300025945 | Bacteria | 756 |
| 248 | Ga0207679_11651860 | 3300025945 | Bacteria | 587 |
| 249 | Ga0207712_10960992 | 3300025961 | Bacteria | 757 |
| 250 | Ga0207668_10358672 | 3300025972 | Bacteria | 1221 |
| 251 | Ga0207677_10392291 | 3300026023 | Bacteria | 1175 |
| 252 | Ga0207677_10875477 | 3300026023 | Bacteria | 808 |
| 253 | Ga0207703_10184408 | 3300026035 | Bacteria | 1844 |
| 254 | Ga0207703_10530880 | 3300026035 | Bacteria | 1108 |
| 255 | Ga0207678_10299850 | 3300026067 | Bacteria | 1381 |
| 256 | Ga0207678_10483239 | 3300026067 | Bacteria | 1079 |
| 257 | Ga0207708_10147749 | 3300026075 | Bacteria | 1848 |
| 258 | Ga0207708_10492389 | 3300026075 | Bacteria | 1026 |
| 259 | Ga0207702_10503453 | 3300026078 | Bacteria | 1181 |
| 260 | Ga0207702_10587253 | 3300026078 | Bacteria | 1092 |
| 261 | Ga0207702_10935086 | 3300026078 | Bacteria | 859 |
| 262 | Ga0207702_11129616 | 3300026078 | Bacteria | 778 |
| 263 | Ga0207641_10473658 | 3300026088 | Bacteria | 1213 |
| 264 | Ga0207676_10008515 | 3300026095 | Bacteria | 7295 |
| 265 | Ga0207676_11824072 | 3300026095 | Bacteria | 607 |
| 266 | Ga0207674_10260574 | 3300026116 | Bacteria | 1681 |
| 267 | Ga0207674_10727394 | 3300026116 | Bacteria | 958 |
| 268 | Ga0207674_11689652 | 3300026116 | Bacteria | 601 |
| 269 | Ga0207675_100228941 | 3300026118 | Bacteria | 1793 |
| 270 | Ga0207675_100279687 | 3300026118 | Bacteria | 1621 |
| 271 | Ga0207683_10163639 | 3300026121 | Bacteria | 2013 |
| 272 | Ga0207683_10328640 | 3300026121 | Bacteria | 1401 |
| 273 | Ga0207698_11048091 | 3300026142 | Bacteria | 827 |
| 274 | Ga0207698_11703554 | 3300026142 | Bacteria | 646 |
| 275 | Ga0207698_12425195 | 3300026142 | Bacteria | 535 |
| 276 | Ga0265357_1006776 | 3300028023 | Bacteria | 1092 |
| 277 | Ga0268266_10001679 | 3300028379 | Bacteria | 25483 |
| 278 | Ga0268266_10101993 | 3300028379 | Bacteria | 2531 |
| 279 | Ga0268264_11618464 | 3300028381 | Bacteria | 658 |
| 280 | Ga0268264_12068328 | 3300028381 | Bacteria | 578 |
| 281 | Ga0307515_10635141 | 3300028794 | Bacteria | 680 |
| 282 | Ga0316176_1120532 | 3300030732 | Bacteria | 1062 |
| 283 | Ga0314311_1042396 | 3300030733 | Bacteria | 1002 |
| 284 | Ga0316178_1115534 | 3300030735 | Bacteria | 1015 |
| 285 | Ga0265769_103159 | 3300030888 | Bacteria | 904 |
| 286 | Ga0265768_104344 | 3300030963 | Bacteria | 796 |
| 287 | Ga0307513_10000483 | 3300031456 | Bacteria | 57234 |
| 288 | Ga0310103_127231 | 3300031614 | Bacteria | 701 |
| 289 | Ga0310101_122171 | 3300031690 | Bacteria | 607 |
| 290 | Ga0310101_128597 | 3300031690 | Bacteria | 505 |
| 291 | Ga0316576_10031357 | 3300031727 | Bacteria | 3771 |
| 292 | Ga0316578_10265777 | 3300031728 | Bacteria | 1028 |
| 293 | Ga0316044_117577 | 3300031810 | Bacteria | 768 |
| 294 | Ga0307413_10324163 | 3300031824 | Bacteria | 1178 |
| 295 | Ga0307518_10120417 | 3300031838 | Bacteria | 1858 |
| 296 | Ga0307410_10164260 | 3300031852 | Bacteria | 1667 |
| 297 | Ga0307410_10878240 | 3300031852 | Bacteria | 767 |
| 298 | Ga0307410_11945560 | 3300031852 | Bacteria | 524 |
| 299 | Ga0307412_10983682 | 3300031911 | Bacteria | 744 |
| 300 | Ga0307412_11285749 | 3300031911 | Bacteria | 658 |
| 301 | Ga0307409_102683549 | 3300031995 | Bacteria | 526 |
| 302 | Ga0307416_101070798 | 3300032002 | Bacteria | 910 |
| 303 | Ga0307415_101265645 | 3300032126 | Bacteria | 697 |
| 304 | Ga0316593_10158835 | 3300032168 | Bacteria | 825 |
| 305 | Ga0316593_10225620 | 3300032168 | Bacteria | 697 |
| 306 | Ga0373926_0052795 | 3300035083 | Bacteria | 1469 |
| 307 | Ga0373934_0339848 | 3300035086 | Bacteria | 624 |
| 308 | Ga0373944_0005913 | 3300035089 | Bacteria | 3236 |
| 309 | Ga0373944_0264285 | 3300035089 | Bacteria | 638 |
| 310 | Ga0373923_0082331 | 3300035111 | Bacteria | 1397 |
| 311 | Ga0373923_0668099 | 3300035111 | Bacteria | 514 |
| 312 | Ga0373936_0000493 | 3300035113 | Bacteria | 13336 |
| 313 | Ga0373936_0035601 | 3300035113 | Bacteria | 1982 |
| 314 | Ga0373941_0035130 | 3300035115 | Bacteria | 1516 |
| 315 | Ga0373945_0001253 | 3300035116 | Bacteria | 7725 |
| 316 | Ga0373953_0021997 | 3300035117 | Bacteria | 2399 |
| 317 | Ga0373954_0028926 | 3300035118 | Bacteria | 2550 |
| 318 | Ga0373956_0009324 | 3300035119 | Bacteria | 3991 |
| 319 | Ga0373956_0017695 | 3300035119 | Bacteria | 3009 |
| 320 | Ga0373957_0007773 | 3300035120 | Bacteria | 3444 |
| 321 | Ga0373957_0008339 | 3300035120 | Bacteria | 3350 |
| 322 | Ga0373960_0291396 | 3300035121 | Bacteria | 604 |
| 323 | Ga0373943_0002059 | 3300035170 | Bacteria | 9128 |
| 324 | Ga0373946_0002389 | 3300035171 | Bacteria | 6636 |
| 325 | Ga0373955_0006331 | 3300035172 | Bacteria | 5391 |
| 326 | Ga0373955_0089451 | 3300035172 | Bacteria | 1752 |
| 327 | Ga0373942_0116039 | 3300035207 | Bacteria | 832 |
| 328 | Ga0316574_0006284 | 3300035398 | Bacteria | 6409 |
| 329 | Ga0373924_0071260 | 3300035410 | Bacteria | 1466 |
| 330 | Ga0373924_0397867 | 3300035410 | Bacteria | 615 |
| 331 | Ga0373935_0007327 | 3300035692 | Bacteria | 6596 |
| 332 | Ga0373935_0013045 | 3300035692 | Bacteria | 5010 |
| 333 | Ga0373935_0759919 | 3300035692 | Bacteria | 714 |
| 334 | Ga0373927_0007504 | 3300035695 | Bacteria | 7375 |
| 335 | Ga0373933_0003002 | 3300035724 | Bacteria | 9407 |
| 336 | Ga0373933_0029821 | 3300035724 | Bacteria | 3156 |
| 337 | Ga0373933_0109172 | 3300035724 | Bacteria | 1724 |
| 338 | Ga0373947_0000144 | 3300035725 | Bacteria | 36821 |
| 339 | Ga0373947_0260348 | 3300035725 | Bacteria | 1149 |
| 340 | Ga0373937_0033996 | 3300036401 | Bacteria | 4634 |
| 341 | Ga0373937_0065183 | 3300036401 | Bacteria | 3352 |
| 342 | Ga0373937_0872445 | 3300036401 | Bacteria | 848 |
| 343 | Ga0310112_037625 | 3300036458 | Bacteria | 659 |
| 344 | Ga0316582_0323091 | 3300036647 | Bacteria | 1061 |
| 345 | Ga0316582_0522664 | 3300036647 | Bacteria | 818 |
| 346 | Ga0316584_0633058 | 3300036712 | Bacteria | 739 |
| 347 | Ga0373925_0001639 | 3300037068 | Bacteria | 18853 |
| 348 | Ga0373925_0262560 | 3300037068 | Bacteria | 1387 |
| 349 | Ga0395900_1315509 | 3300037418 | Bacteria | 636 |
| 350 | Ga0395898_0307245 | 3300037466 | Bacteria | 1513 |
| 351 | Ga0436364_0082959 | 3300037853 | Bacteria | 578 |
| 352 | Ga0436364_0774136 | 3300037853 | Bacteria | 1918 |
| 353 | Ga0436364_1159607 | 3300037853 | Bacteria | 1686 |
| 354 | Ga0395901_0245303 | 3300038443 | Bacteria | 1867 |
| 355 | Ga0395901_0441641 | 3300038443 | Bacteria | 1332 |
| 356 | Ga0395901_0459000 | 3300038443 | Bacteria | 1302 |
| 357 | Ga0436365_0783659 | 3300039437 | Bacteria | 1263 |
| 358 | Ga0436365_1057536 | 3300039437 | Bacteria | 806 |
| 359 | Ga0439461_0212649 | 3300041410 | Bacteria | 524 |
| 360 | Ga0451789_0734274 | 3300041443 | Bacteria | 587 |
| 361 | Ga0451797_0590245 | 3300041453 | Bacteria | 1080 |
| 362 | Ga0451797_0799032 | 3300041453 | Bacteria | 995 |
| 363 | Ga0451795_0351429 | 3300041456 | Bacteria | 835 |
| 364 | Ga0451795_1029081 | 3300041456 | Bacteria | 1039 |
| 365 | Ga0451798_0088860 | 3300041458 | Bacteria | 529 |
| 366 | Ga0451807_0481825 | 3300041486 | Bacteria | 520 |
| 367 | Ga0451807_1069947 | 3300041486 | Bacteria | 821 |
| 368 | Ga0451833_0909349 | 3300041491 | Bacteria | 1218 |
| 369 | Ga0451835_0418266 | 3300041492 | Bacteria | 550 |
| 370 | Ga0451837_1308254 | 3300041494 | Bacteria | 1319 |
| 371 | Ga0451841_0330528 | 3300041498 | Bacteria | 674 |
| 372 | Ga0451849_0388172 | 3300041505 | Bacteria | 780 |
| 373 | Ga0451850_40182 | 3300041506 | Bacteria | 791 |
| 374 | Ga0451855_1212382 | 3300041511 | Bacteria | 550 |
| 375 | Ga0451853_3849916 | 3300041512 | Bacteria | 558 |
| 376 | Ga0439463_031708 | 3300042016 | Bacteria | 1335 |
| 377 | Ga0450900_018948 | 3300042136 | Bacteria | 947 |
| 378 | Ga0439434_0046747 | 3300042435 | Bacteria | 1336 |
| 379 | Ga0439464_0120063 | 3300042439 | Bacteria | 809 |
| 380 | Ga0439440_0050958 | 3300042993 | Bacteria | 1034 |
| 381 | Ga0466972_0011350 | 3300044658 | Bacteria | 4470 |
| 382 | Ga0466972_0067863 | 3300044658 | Bacteria | 1703 |
| 383 | Ga0466965_0011382 | 3300044683 | Bacteria | 4169 |
| 384 | Ga0466966_0050250 | 3300044684 | Bacteria | 2653 |
| 385 | Ga0466961_0123519 | 3300044693 | Bacteria | 1624 |
| 386 | Ga0466963_0028619 | 3300044694 | Bacteria | 3580 |
| 387 | Ga0466963_0042453 | 3300044694 | Bacteria | 2987 |
| 388 | Ga0466963_0271572 | 3300044694 | Bacteria | 1191 |
| 389 | Ga0466963_0681696 | 3300044694 | Bacteria | 725 |
| 390 | Ga0466963_1236908 | 3300044694 | Bacteria | 524 |
| 391 | Ga0466964_0104739 | 3300044706 | Bacteria | 1253 |
| 392 | Ga0466964_0247145 | 3300044706 | Bacteria | 878 |
| 393 | Ga0466964_0787241 | 3300044706 | Bacteria | 536 |
| 394 | Ga0453684_0000493 | 3300044712 | Bacteria | 155450 |
| 395 | Ga0453684_0771776 | 3300044712 | Bacteria | 1039 |
| 396 | Ga0466971_0028623 | 3300044719 | Bacteria | 2492 |
| 397 | Ga0466971_0053178 | 3300044719 | Bacteria | 1825 |
| 398 | Ga0466971_0368284 | 3300044719 | Bacteria | 697 |
| 399 | Ga0466971_0369291 | 3300044719 | Bacteria | 696 |
| 400 | Ga0466968_0179650 | 3300044735 | Bacteria | 984 |
| 401 | Ga0466970_0041656 | 3300044765 | Bacteria | 2440 |
| 402 | Ga0466957_0020855 | 3300044842 | Bacteria | 3855 |
| 403 | Ga0466957_0112465 | 3300044842 | Bacteria | 1728 |
| 404 | Ga0466957_0595974 | 3300044842 | Bacteria | 773 |
| 405 | Ga0466960_0071186 | 3300044901 | Bacteria | 1731 |
| 406 | Ga0466960_0152020 | 3300044901 | Bacteria | 1237 |
| 407 | Ga0466960_0452581 | 3300044901 | Bacteria | 746 |
| 408 | Ga0466959_0007502 | 3300045049 | Bacteria | 7659 |
| 409 | Ga0466958_0018203 | 3300045836 | Bacteria | 4073 |
| 410 | Ga0466958_0067415 | 3300045836 | Bacteria | 2186 |
| 411 | Ga0466967_0003056 | 3300045976 | Bacteria | 10743 |
| 412 | Ga0466967_0009385 | 3300045976 | Bacteria | 7256 |
| 413 | Ga0466967_0014261 | 3300045976 | Bacteria | 6183 |
| 414 | Ga0466967_0018188 | 3300045976 | Bacteria | 5607 |
| 415 | Ga0466967_0033910 | 3300045976 | Bacteria | 4326 |
| 416 | Ga0466967_0243418 | 3300045976 | Bacteria | 1716 |
| 417 | Ga0466967_0433518 | 3300045976 | Bacteria | 1282 |
| 418 | Ga0466967_0611989 | 3300045976 | Bacteria | 1076 |
| 419 | Ga0466967_0695041 | 3300045976 | Bacteria | 1007 |
| 420 | Ga0466967_0904250 | 3300045976 | Bacteria | 878 |
| 421 | Ga0466967_1463429 | 3300045976 | Bacteria | 680 |
| 422 | Ga0466967_2078078 | 3300045976 | Bacteria | 564 |
| 423 | Ga0466967_2448462 | 3300045976 | Bacteria | 517 |
| 424 | Ga0495592_0044061 | 3300046454 | Bacteria | 3336 |
| 425 | Ga0495592_0119313 | 3300046454 | Bacteria | 1857 |
| 426 | Ga0495641_0009970 | 3300046461 | Bacteria | 5580 |
| 427 | Ga0495651_0036578 | 3300046462 | Bacteria | 3822 |
| 428 | Ga0495651_0094201 | 3300046462 | Bacteria | 2241 |
| 429 | Ga0495651_0145460 | 3300046462 | Bacteria | 1714 |
| 430 | Ga0495653_0000707 | 3300046463 | Bacteria | 25513 |
| 431 | Ga0495653_0006033 | 3300046463 | Bacteria | 9923 |
| 432 | Ga0495653_0049828 | 3300046463 | Bacteria | 3223 |
| 433 | Ga0495582_0451195 | 3300046473 | Bacteria | 742 |
| 434 | Ga0495639_0120689 | 3300046475 | Bacteria | 1250 |
| 435 | Ga0495664_0015162 | 3300046477 | Bacteria | 4379 |
| 436 | Ga0495608_0022195 | 3300046511 | Bacteria | 4350 |
| 437 | Ga0495608_0108714 | 3300046511 | Bacteria | 1783 |
| 438 | Ga0495608_0152099 | 3300046511 | Bacteria | 1474 |
| 439 | Ga0495618_0040934 | 3300046514 | Bacteria | 2917 |
| 440 | Ga0495618_0267747 | 3300046514 | Bacteria | 1068 |
| 441 | Ga0495628_0039067 | 3300046516 | Bacteria | 3796 |
| 442 | Ga0495628_0106077 | 3300046516 | Bacteria | 2164 |
| 443 | Ga0495630_0047532 | 3300046517 | Bacteria | 3210 |
| 444 | Ga0495630_0141352 | 3300046517 | Bacteria | 1830 |
| 445 | Ga0495648_0035512 | 3300046524 | Bacteria | 3231 |
| 446 | Ga0495652_0020282 | 3300046529 | Bacteria | 5909 |
| 447 | Ga0495652_0290457 | 3300046529 | Bacteria | 1193 |
| 448 | Ga0495665_0005340 | 3300046531 | Bacteria | 6924 |
| 449 | Ga0495640_0034295 | 3300046533 | Bacteria | 3600 |
| 450 | Ga0495640_0187078 | 3300046533 | Bacteria | 1317 |
| 451 | Ga0495640_0220080 | 3300046533 | Bacteria | 1198 |
| 452 | Ga0495640_0281173 | 3300046533 | Bacteria | 1036 |
| 453 | Ga0495586_0064157 | 3300046535 | Bacteria | 2001 |
| 454 | Ga0495587_0022832 | 3300046536 | Bacteria | 3849 |
| 455 | Ga0495621_0327877 | 3300046539 | Bacteria | 639 |
| 456 | Ga0495645_0053382 | 3300046543 | Bacteria | 2938 |
| 457 | Ga0495667_0024008 | 3300046559 | Bacteria | 4106 |
| 458 | Ga0495667_0026247 | 3300046559 | Bacteria | 3924 |
| 459 | Ga0495667_0033807 | 3300046559 | Bacteria | 3421 |
| 460 | Ga0495667_0524267 | 3300046559 | Bacteria | 741 |
| 461 | Ga0495656_0436298 | 3300046615 | Bacteria | 689 |
| 462 | Ga0495634_0096727 | 3300046642 | Bacteria | 1912 |
| 463 | Ga0495634_0164611 | 3300046642 | Bacteria | 1396 |
| 464 | Ga0495634_0863404 | 3300046642 | Bacteria | 513 |
| 465 | Ga0495635_0007325 | 3300046663 | Bacteria | 7701 |
| 466 | Ga0495635_0010265 | 3300046663 | Bacteria | 6548 |
| 467 | Ga0495635_0023818 | 3300046663 | Bacteria | 4266 |
| 468 | Ga0495635_0599269 | 3300046663 | Bacteria | 719 |
| 469 | Ga0495635_0869527 | 3300046663 | Bacteria | 578 |
| 470 | Ga0495657_0018611 | 3300046675 | Bacteria | 5021 |
| 471 | Ga0495657_0033980 | 3300046675 | Bacteria | 3545 |
| 472 | Ga0495657_0052311 | 3300046675 | Bacteria | 2738 |
| 473 | Ga0495599_0022974 | 3300046678 | Bacteria | 3895 |
| 474 | Ga0495599_0343711 | 3300046678 | Bacteria | 895 |
| 475 | Ga0495623_0319541 | 3300046679 | Bacteria | 853 |
| 476 | Ga0495646_0115569 | 3300046680 | Bacteria | 1523 |
| 477 | Ga0495646_0204417 | 3300046680 | Bacteria | 1074 |
| 478 | Ga0495669_0231031 | 3300046684 | Bacteria | 887 |
| 479 | Ga0495613_0685859 | 3300046689 | Bacteria | 675 |
| 480 | Ga0495624_0005225 | 3300046690 | Bacteria | 9382 |
| 481 | Ga0495670_0539721 | 3300046691 | Bacteria | 634 |
| 482 | Ga0495600_0204659 | 3300046809 | Bacteria | 1266 |
| 483 | Ga0495604_0085070 | 3300047317 | Bacteria | 2360 |
| 484 | Ga0495604_0295612 | 3300047317 | Bacteria | 1089 |
| 485 | Ga0495674_0000793 | 3300047319 | Bacteria | 29978 |
| 486 | Ga0495674_0029092 | 3300047319 | Bacteria | 5033 |
| 487 | Ga0495674_0549467 | 3300047319 | Bacteria | 919 |
| 488 | Ga0495674_0585461 | 3300047319 | Bacteria | 885 |
| 489 | Ga0495672_0042916 | 3300047320 | Bacteria | 2723 |
| 490 | Ga0495672_0404703 | 3300047320 | Bacteria | 623 |
| 491 | Ga0495676_0042140 | 3300047321 | Bacteria | 3751 |
| 492 | Ga0495676_0664952 | 3300047321 | Bacteria | 675 |
| 493 | Ga0495680_0027984 | 3300047322 | Bacteria | 4625 |
| 494 | Ga0495680_0087542 | 3300047322 | Bacteria | 2342 |
| 495 | Ga0495684_0029121 | 3300047471 | Bacteria | 4238 |
| 496 | Ga0495684_0240237 | 3300047471 | Bacteria | 1321 |
| 497 | Ga0495602_0040806 | 3300048088 | Bacteria | 4248 |
| 498 | Ga0495602_0269777 | 3300048088 | Bacteria | 1258 |
| 499 | Ga0495626_0356758 | 3300048091 | Bacteria | 570 |
| 500 | Ga0496100_0783392 | 3300048903 | Bacteria | 747 |
| 501 | Ga0496100_1034854 | 3300048903 | Bacteria | 646 |
| 502 | Ga0496101_0487511 | 3300048904 | Bacteria | 973 |
| 503 | Ga0496102_0013726 | 3300048905 | Bacteria | 7025 |
| 504 | Ga0496102_0023774 | 3300048905 | Bacteria | 5445 |
| 505 | Ga0496102_0040757 | 3300048905 | Bacteria | 4202 |
| 506 | Ga0496102_0312080 | 3300048905 | Bacteria | 1482 |
| 507 | Ga0496102_0601180 | 3300048905 | Bacteria | 1023 |
| 508 | Ga0496102_0940471 | 3300048905 | Bacteria | 785 |
| 509 | Ga0496102_1413575 | 3300048905 | Bacteria | 615 |
| 510 | Ga0496103_0035238 | 3300048906 | Bacteria | 3064 |
| 511 | Ga0496103_0129122 | 3300048906 | Bacteria | 1613 |
| 512 | Ga0496104_0042373 | 3300048907 | Bacteria | 4271 |
| 513 | Ga0496104_0399763 | 3300048907 | Bacteria | 1286 |
| 514 | Ga0496105_0002612 | 3300048908 | Bacteria | 13107 |
| 515 | Ga0496105_0463272 | 3300048908 | Bacteria | 999 |
| 516 | Ga0496106_0048931 | 3300048909 | Bacteria | 3184 |
| 517 | Ga0496106_0107906 | 3300048909 | Bacteria | 2165 |
| 518 | Ga0496106_0534687 | 3300048909 | Bacteria | 941 |
| 519 | Ga0496107_0110697 | 3300048910 | Bacteria | 2018 |
| 520 | Ga0496107_0645484 | 3300048910 | Bacteria | 780 |
| 521 | Ga0496107_0998677 | 3300048910 | Bacteria | 607 |
| 522 | Ga0496108_0078195 | 3300048911 | Bacteria | 2799 |
| 523 | Ga0496108_0084713 | 3300048911 | Bacteria | 2690 |
| 524 | Ga0496108_0110794 | 3300048911 | Bacteria | 2347 |
| 525 | Ga0496108_0388152 | 3300048911 | Bacteria | 1219 |
| 526 | Ga0496108_0480590 | 3300048911 | Bacteria | 1085 |
| 527 | Ga0496108_0988269 | 3300048911 | Bacteria | 719 |
| 528 | Ga0496108_1539387 | 3300048911 | Bacteria | 552 |
| 529 | Ga0496109_0006343 | 3300048912 | Bacteria | 9960 |
| 530 | Ga0496109_0054704 | 3300048912 | Bacteria | 3640 |
| 531 | Ga0496109_0054991 | 3300048912 | Bacteria | 3631 |
| 532 | Ga0496109_0080634 | 3300048912 | Bacteria | 2998 |
| 533 | Ga0496109_0266911 | 3300048912 | Bacteria | 1612 |
| 534 | Ga0496109_0280503 | 3300048912 | Bacteria | 1570 |
| 535 | Ga0496110_0109779 | 3300048913 | Bacteria | 2478 |
| 536 | Ga0496110_0380343 | 3300048913 | Bacteria | 1286 |
| 537 | Ga0496110_0492644 | 3300048913 | Bacteria | 1116 |
| 538 | Ga0496110_0814516 | 3300048913 | Bacteria | 838 |
| 539 | Ga0496111_0009913 | 3300048914 | Bacteria | 6367 |
| 540 | Ga0496111_0051155 | 3300048914 | Bacteria | 2982 |
| 541 | Ga0496111_0238035 | 3300048914 | Bacteria | 1352 |
| 542 | Ga0496111_0559510 | 3300048914 | Bacteria | 839 |
| 543 | Ga0496112_0231555 | 3300048915 | Bacteria | 1802 |
| 544 | Ga0496113_0100859 | 3300048916 | Bacteria | 2237 |
| 545 | Ga0496113_0151191 | 3300048916 | Bacteria | 1831 |
| 546 | Ga0496113_0389366 | 3300048916 | Bacteria | 1119 |
| 547 | Ga0496113_0437046 | 3300048916 | Bacteria | 1051 |
| 548 | Ga0496114_0011670 | 3300048917 | Bacteria | 7028 |
| 549 | Ga0496114_0089616 | 3300048917 | Bacteria | 2610 |
| 550 | Ga0496114_0127495 | 3300048917 | Bacteria | 2195 |
| 551 | Ga0496114_0338808 | 3300048917 | Bacteria | 1330 |
| 552 | Ga0496114_0388078 | 3300048917 | Bacteria | 1236 |
| 553 | Ga0496114_0776011 | 3300048917 | Bacteria | 836 |
| 554 | Ga0496115_0002770 | 3300048918 | Bacteria | 12597 |
| 555 | Ga0496115_0043806 | 3300048918 | Bacteria | 3568 |
| 556 | Ga0496115_1082677 | 3300048918 | Bacteria | 608 |
| 557 | Ga0496119_0000375 | 3300048922 | Bacteria | 61774 |
| 558 | Ga0496119_0596185 | 3300048922 | Bacteria | 503 |
| 559 | Ga0496120_0000453 | 3300048923 | Bacteria | 64868 |
| 560 | Ga0496121_0324229 | 3300048924 | Bacteria | 1036 |
| 561 | Ga0496126_0000676 | 3300048929 | Bacteria | 62750 |
| 562 | Ga0496126_0189308 | 3300048929 | Bacteria | 1744 |
| 563 | Ga0496126_0567953 | 3300048929 | Bacteria | 898 |
| 564 | Ga0496126_0798608 | 3300048929 | Bacteria | 724 |
| 565 | Ga0501310_013224 | 3300049130 | Bacteria | 955 |
| 566 | Ga0501307_015721 | 3300049162 | Bacteria | 937 |
| 567 | Ga0501311_009913 | 3300049527 | Bacteria | 1146 |
| 568 | Ga0501313_026934 | 3300049529 | Bacteria | 733 |
| 569 | Ga0501315_025470 | 3300049531 | Bacteria | 824 |
| 570 | Ga0501317_002182 | 3300049533 | Bacteria | 1816 |
| 571 | Ga0501318_015147 | 3300049534 | Bacteria | 918 |
| 572 | Ga0501320_033085 | 3300049536 | Bacteria | 651 |
| 573 | Ga0501322_002910 | 3300049538 | Bacteria | 1080 |
| 574 | Ga0501323_020646 | 3300049539 | Bacteria | 866 |
| 575 | Ga0501324_012422 | 3300049540 | Bacteria | 797 |
| 576 | Ga0501330_009540 | 3300049546 | Bacteria | 679 |
| 577 | Ga0501031_0140312 | 3300049568 | Bacteria | 1579 |
| 578 | Ga0501031_0258139 | 3300049568 | Bacteria | 1132 |
| 579 | Ga0501032_0083756 | 3300049569 | Bacteria | 2120 |
| 580 | Ga0501032_0354152 | 3300049569 | Bacteria | 945 |
| 581 | Ga0501033_0457925 | 3300049570 | Bacteria | 885 |
| 582 | Ga0501033_1047632 | 3300049570 | Bacteria | 544 |
| 583 | Ga0501034_0011290 | 3300049571 | Bacteria | 9267 |
| 584 | Ga0501034_0136958 | 3300049571 | Bacteria | 2429 |
| 585 | Ga0501034_0162720 | 3300049571 | Bacteria | 2202 |
| 586 | Ga0501034_0466620 | 3300049571 | Bacteria | 1179 |
| 587 | Ga0501036_0329162 | 3300049572 | Bacteria | 1276 |
| 588 | Ga0501036_0424651 | 3300049572 | Bacteria | 1108 |
| 589 | Ga0501038_0000236 | 3300049574 | Bacteria | 46834 |
| 590 | Ga0501038_0093948 | 3300049574 | Bacteria | 2508 |
| 591 | Ga0501039_0080372 | 3300049575 | Bacteria | 2537 |
| 592 | Ga0501039_0273146 | 3300049575 | Bacteria | 1329 |
| 593 | Ga0501039_0281009 | 3300049575 | Bacteria | 1308 |
| 594 | Ga0501040_0147026 | 3300049576 | Bacteria | 1661 |
| 595 | Ga0501041_0903238 | 3300049577 | Bacteria | 567 |
| 596 | Ga0501042_0247338 | 3300049578 | Bacteria | 1287 |
| 597 | Ga0501043_0091820 | 3300049579 | Bacteria | 2387 |
| 598 | Ga0501043_0587003 | 3300049579 | Bacteria | 824 |
| 599 | Ga0501046_0001520 | 3300049580 | Bacteria | 22125 |
| 600 | Ga0501047_0009156 | 3300049581 | Bacteria | 9347 |
| 601 | Ga0501047_0097625 | 3300049581 | Bacteria | 2816 |
| 602 | Ga0501048_0326498 | 3300049582 | Bacteria | 1093 |
| 603 | Ga0501067_0003678 | 3300049583 | Bacteria | 8451 |
| 604 | Ga0501068_0022198 | 3300049584 | Bacteria | 3709 |
| 605 | Ga0501068_0623232 | 3300049584 | Bacteria | 703 |
| 606 | Ga0501070_0008855 | 3300049586 | Bacteria | 8506 |
| 607 | Ga0501070_0032172 | 3300049586 | Bacteria | 4391 |
| 608 | Ga0501070_0354575 | 3300049586 | Bacteria | 1190 |
| 609 | Ga0501070_0382454 | 3300049586 | Bacteria | 1140 |
| 610 | Ga0501070_0789297 | 3300049586 | Bacteria | 746 |
| 611 | Ga0501071_0048943 | 3300049587 | Bacteria | 3041 |
| 612 | Ga0501071_0323203 | 3300049587 | Bacteria | 1172 |
| 613 | Ga0501072_0059462 | 3300049588 | Bacteria | 3013 |
| 614 | Ga0501073_0003004 | 3300049589 | Bacteria | 12639 |
| 615 | Ga0501073_0242651 | 3300049589 | Bacteria | 1244 |
| 616 | Ga0501073_1025862 | 3300049589 | Bacteria | 567 |
| 617 | Ga0501074_0005115 | 3300049590 | Bacteria | 9425 |
| 618 | Ga0501074_0513939 | 3300049590 | Bacteria | 848 |
| 619 | Ga0501075_0399564 | 3300049591 | Bacteria | 1048 |
| 620 | Ga0501076_0278949 | 3300049592 | Bacteria | 1369 |
| 621 | Ga0501077_0222923 | 3300049593 | Bacteria | 1198 |
| 622 | Ga0501079_0091853 | 3300049741 | Bacteria | 2352 |
| 623 | Ga0501079_0483735 | 3300049741 | Bacteria | 973 |
| 624 | Ga0501080_0014903 | 3300049742 | Bacteria | 7157 |
| 625 | Ga0501080_0109487 | 3300049742 | Bacteria | 2561 |
| 626 | Ga0501081_0196491 | 3300049743 | Bacteria | 1462 |
| 627 | Ga0501083_0057154 | 3300049744 | Bacteria | 2612 |
| 628 | Ga0501083_0069429 | 3300049744 | Bacteria | 2344 |
| 629 | Ga0501083_0208704 | 3300049744 | Bacteria | 1274 |
| 630 | Ga0501083_0353130 | 3300049744 | Bacteria | 956 |
| 631 | Ga0501083_0874443 | 3300049744 | Bacteria | 585 |
| 632 | Ga0501035_0077266 | 3300049822 | Bacteria | 2942 |
| 633 | Ga0501035_0139818 | 3300049822 | Bacteria | 2106 |
| 634 | Ga0501035_0415680 | 3300049822 | Bacteria | 1117 |
| 635 | Ga0501044_0309928 | 3300049823 | Bacteria | 1505 |
| 636 | Ga0501044_1526121 | 3300049823 | Bacteria | 533 |
| 637 | Ga0501045_0256739 | 3300049824 | Bacteria | 1301 |
| 638 | Ga0501045_0375318 | 3300049824 | Bacteria | 1058 |
| 639 | nmdc:mga00v17_436191_c1 | 3300050491 | Bacteria | 851 |
| 640 | nmdc:mga0yw44_129889_c1 | 3300050492 | Bacteria | 1630 |
| 641 | nmdc:mga0yw44_263200_c1 | 3300050492 | Bacteria | 1150 |
| 642 | nmdc:mga06z11_205837_c1 | 3300050494 | Bacteria | 1145 |
| 643 | nmdc:mga06z11_214829_c1 | 3300050494 | Bacteria | 1122 |
| 644 | nmdc:mga08y16_1112434_c1 | 3300050511 | Bacteria | 764 |
| 645 | Ga0495601_0112283 | 3300053077 | Bacteria | 1765 |
| 646 | Ga0495612_0061734 | 3300053078 | Bacteria | 1553 |
| 647 | Ga0495619_0063783 | 3300053085 | Bacteria | 2455 |
| 648 | Ga0495619_0530438 | 3300053085 | Bacteria | 808 |
| 649 | Ga0500590_297913 | 3300053148 | Bacteria | 609 |
| 650 | Ga0500604_0007038 | 3300053151 | Bacteria | 2977 |
| 651 | Ga0500616_0006992 | 3300053153 | Bacteria | 7258 |
| 652 | Ga0501084_0022188 | 3300054114 | Bacteria | 5297 |
| 653 | Ga0501084_0479398 | 3300054114 | Bacteria | 1051 |
| 654 | Ga0590075_063968 | 3300059424 | Bacteria | 949 |
| 655 | Ga0587084_055812 | 3300059477 | Bacteria | 711 |
| 656 | Ga0587077_174522 | 3300059493 | Bacteria | 578 |
| 657 | Ga0587080_034987 | 3300059503 | Bacteria | 893 |
| 658 | Ga0587082_034894 | 3300059504 | Bacteria | 895 |
| 659 | Ga0587083_0084392 | 3300059505 | Bacteria | 763 |
| 660 | Ga0587083_0253813 | 3300059505 | Bacteria | 525 |
| 661 | Ga0587086_028418 | 3300059507 | Bacteria | 808 |
| 662 | Ga0587088_141057 | 3300059508 | Bacteria | 575 |
| 663 | Ga0587090_029455 | 3300059510 | Bacteria | 910 |
| 664 | Ga0587098_013499 | 3300059604 | Bacteria | 951 |
| 665 | Ga0587101_130728 | 3300059623 | Bacteria | 528 |
| 666 | Ga0587128_003279 | 3300059630 | Bacteria | 1782 |
| 667 | Ga0587128_124117 | 3300059630 | Bacteria | 565 |
| 668 | Ga0587068_047301 | 3300059641 | Bacteria | 796 |
| 669 | Ga0587069_014490 | 3300059642 | Bacteria | 1100 |
| 670 | Ga0587072_039755 | 3300059643 | Bacteria | 910 |
| 671 | Ga0587072_146894 | 3300059643 | Bacteria | 567 |
| 672 | Ga0587076_188813 | 3300059645 | Bacteria | 523 |
| 673 | Ga0587079_126855 | 3300059647 | Bacteria | 637 |
| 674 | Ga0587107_021834 | 3300059652 | Bacteria | 900 |
| 675 | Ga0587107_063047 | 3300059652 | Bacteria | 659 |
| 676 | Ga0587119_001807 | 3300059658 | Bacteria | 1832 |
| 677 | Ga0587111_0018916 | 3300060346 | Bacteria | 1301 |
| 678 | Ga0501082_0005659 | 3300060353 | Bacteria | 10844 |
| 679 | Ga0501082_0009062 | 3300060353 | Bacteria | 8583 |
| 680 | Ga0501082_0271235 | 3300060353 | Bacteria | 1477 |
| 681 | Ga0501082_0518551 | 3300060353 | Bacteria | 1042 |
| 682 | Ga0501082_1107796 | 3300060353 | Bacteria | 692 |
| 683 | Ga0466962_0043993 | 3300061719 | Bacteria | 2136 |
| 684 | Ga0530510_0855081 | 3300061734 | Bacteria | 695 |
| 685 | 2528205540 | 2527291627 | Bacteria | 5309833 |
| 686 | 2528214983 | 2527291629 | Bacteria | 5267418 |
| 687 | 2546950317 | 2546825537 | Bacteria | 5389291 |
| 688 | 2579750233 | 2576861822 | Bacteria | 5004595 |
| 689 | 2579856461 | 2579778521 | Bacteria | 7624758 |
| 690 | 2619858093 | 2619618881 | Bacteria | 7521104 |
| 691 | 2620352602 | 2619619003 | Bacteria | 7619552 |
| 692 | 2626639653 | 2626541554 | Bacteria | 7741902 |
| 693 | 2671839083 | 2671180195 | Bacteria | 9757215 |
| 694 | 2676476030 | 2675903058 | Bacteria | 6822861 |
| 695 | 2676491299 | 2675903060 | Bacteria | 10051191 |
| 696 | 2686537810 | 2684623035 | Bacteria | 8032739 |
| 697 | 2686543123 | 2684623036 | Bacteria | 5199090 |
| 698 | 2689991637 | 2687453743 | Bacteria | 8361025 |
| 699 | 2710603799 | 2710264753 | Bacteria | 5455564 |
| 700 | 2739604264 | 2739367653 | Bacteria | 2780952 |
| 701 | 2740169278 | 2739367898 | Bacteria | 4367674 |
| 702 | 2774857239 | 2773857922 | Bacteria | 9757215 |
| 703 | 2774866114 | 2773857924 | Bacteria | 5256821 |
| 704 | 2776370678 | 2775506925 | Bacteria | 7237746 |
| 705 | 2804843892 | 2802429296 | Bacteria | 7227771 |
| 706 | 2817509480 | 2816332305 | Bacteria | 2697803 |
| 707 | 2827630592 | 2827628540 | Bacteria | 6858585 |
| 708 | 2848553054 | 2848551377 | Bacteria | 3720646 |
| 709 | 2856743267 | 2856741275 | Bacteria | 8096094 |
| 710 | 2857728861 | 2857727296 | Bacteria | 2745552 |
| 711 | 2863072229 | 2863067949 | Bacteria | 8541735 |
| 712 | 2873319298 | 2873314349 | Bacteria | 8512634 |
| 713 | 2884700695 | 2884693830 | Bacteria | 11273186 |
| 714 | 2891403629 | 2891395885 | Bacteria | 9251614 |
| 715 | 2891556122 | 2891554331 | Bacteria | 8812224 |
| 716 | 2891569397 | 2891562705 | Bacteria | 8039471 |
| 717 | 2895429173 | 2895427314 | Bacteria | 13147766 |
| 718 | 2895452588 | 2895442618 | Bacteria | 11027144 |
| 719 | 2895888726 | 2895880812 | Bacteria | 11255272 |
| 720 | 2932398915 | 2932398195 | Bacteria | 3847976 |
| 721 | 637880504 | 637000116 | Bacteria | 5433628 |
| 722 | 8025419198 | 8025413630 | Bacteria | 7014048 |
| 723 | 8054914086 | 8054913762 | Bacteria | 7713009 |
| 724 | 8054923102 | 8054920844 | Bacteria | 7068637 |
| 725 | 8055068498 | 8055066027 | Bacteria | 9479577 |
| 726 | 8055160832 | 8055157932 | Bacteria | 6429399 |
| 727 | 8055181458 | 8055172936 | Bacteria | 9305943 |
| 728 | 8056210669 | 8056207758 | Bacteria | 8639239 |
| 729 | 8057568530 | 8057568493 | Bacteria | 7221719 |
| 730 | Ga0587106_092126 | |||
| 731 | JGI24740J21852_10021807 | |||
| 732 | JGI24737J22298_10164406 | |||
| 733 | JGI24735J21928_10142262 | |||
| 734 | Ga0006778J45830_1014387 | |||
| 735 | JGI25406J46586_10016957 | |||
| 736 | Ga0007429J51699_1006244 | |||
| 737 | Ga0032354_1023013 | |||
| 738 | Ga0058863_10008729 | |||
| 739 | Ga0058863_11754618 | |||
| 740 | Ga0070658_10006607 | |||
| 741 | Ga0070658_10102952 | |||
| 742 | Ga0070658_10286184 | |||
| 743 | Ga0070658_11107071 | |||
| 744 | Ga0070683_100277742 | |||
| 745 | Ga0070682_100191650 | |||
| 746 | Ga0068868_100154868 | |||
| 747 | Ga0068868_100326842 | |||
| 748 | Ga0070660_100133379 | |||
| 749 | Ga0070660_100205673 | |||
| 750 | Ga0070689_102242751 | |||
| 751 | Ga0070661_100531016 | |||
| 752 | Ga0070661_100724610 | |||
| 753 | Ga0070692_10049461 | |||
| 754 | Ga0070668_100192535 | |||
| 755 | Ga0070668_100199839 | |||
| 756 | Ga0070669_100739899 | |||
| 757 | Ga0070674_100287101 | |||
| 758 | Ga0070674_100691863 | |||
| 759 | Ga0070659_100415607 | |||
| 760 | Ga0070659_101001150 | |||
| 761 | Ga0070709_10485189 | |||
| 762 | Ga0070714_100278130 | |||
| 763 | Ga0070714_100792359 | |||
| 764 | Ga0070713_100174585 | |||
| 765 | Ga0070713_100478753 | |||
| 766 | Ga0070710_11146362 | |||
| 767 | Ga0070700_100660198 | |||
| 768 | Ga0070663_100242828 | |||
| 769 | Ga0070663_100292344 | |||
| 770 | Ga0070662_100126697 | |||
| 771 | Ga0070662_100980993 | |||
| 772 | Ga0070681_10209184 | |||
| 773 | Ga0070681_10899354 | |||
| 774 | Ga0070685_10231058 | |||
| 775 | Ga0070685_10553313 | |||
| 776 | Ga0070706_100185724 | |||
| 777 | Ga0070679_100139905 | |||
| 778 | Ga0070679_100709574 | |||
| 779 | Ga0070679_100963967 | |||
| 780 | Ga0070684_100002926 | |||
| 781 | Ga0070684_100050033 | |||
| 782 | Ga0070684_100172192 | |||
| 783 | Ga0070684_100455649 | |||
| 784 | Ga0070684_101666520 | |||
| 785 | Ga0070672_100997748 | |||
| 786 | Ga0070686_100023961 | |||
| 787 | Ga0070686_100981510 | |||
| 788 | Ga0070665_100004390 | |||
| 789 | Ga0070665_100656604 | |||
| 790 | Ga0070665_102433342 | |||
| 791 | Ga0070664_100185440 | |||
| 792 | Ga0070664_101754223 | |||
| 793 | Ga0068857_101346875 | |||
| 794 | Ga0068857_102113665 | |||
| 795 | Ga0068854_100378591 | |||
| 796 | Ga0068854_101369787 | |||
| 797 | Ga0068856_100433031 | |||
| 798 | Ga0068856_101830448 | |||
| 799 | Ga0068852_100340470 | |||
| 800 | Ga0068852_100518572 | |||
| 801 | Ga0068852_100943839 | |||
| 802 | Ga0068852_101887698 | |||
| 803 | Ga0068852_102294741 | |||
| 804 | Ga0068859_101478142 | |||
| 805 | Ga0068864_100246009 | |||
| 806 | Ga0068861_100481198 | |||
| 807 | Ga0068861_100713776 | |||
| 808 | Ga0068863_100437377 | |||
| 809 | Ga0068858_100096229 | |||
| 810 | Ga0068858_100388387 | |||
| 811 | Ga0068858_101085642 | |||
| 812 | Ga0068860_100520858 | |||
| 813 | Ga0068860_100630744 | |||
| 814 | Ga0068862_101609555 | |||
| 815 | Ga0081539_10003164 | |||
| 816 | Ga0070717_10205556 | |||
| 817 | Ga0075365_10108161 | |||
| 818 | Ga0075365_10144508 | |||
| 819 | Ga0075365_10260514 | |||
| 820 | Ga0075364_10297460 | |||
| 821 | Ga0070715_10011147 | |||
| 822 | Ga0070715_11052779 | |||
| 823 | Ga0070712_100243569 | |||
| 824 | Ga0070712_101014198 | |||
| 825 | Ga0075367_10156363 | |||
| 826 | Ga0075367_10235466 | |||
| 827 | Ga0097621_101700574 | |||
| 828 | Ga0097621_101718689 | |||
| 829 | Ga0075428_100435401 | |||
| 830 | Ga0075433_10431491 | |||
| 831 | Ga0075434_100316029 | |||
| 832 | Ga0068865_101222733 | |||
| 833 | Ga0097620_101478392 | |||
| 834 | Ga0105251_10025205 | |||
| 835 | Ga0105240_12529356 | |||
| 836 | Ga0111539_11967347 | |||
| 837 | Ga0105245_10185249 | |||
| 838 | Ga0105245_10226566 | |||
| 839 | Ga0105245_10285792 | |||
| 840 | Ga0105247_10000164 | |||
| 841 | Ga0105247_10271570 | |||
| 842 | Ga0105247_11587783 | |||
| 843 | Ga0114129_12528975 | |||
| 844 | Ga0105243_10281737 | |||
| 845 | Ga0105243_10853024 | |||
| 846 | Ga0105241_10543835 | |||
| 847 | Ga0105242_10138057 | |||
| 848 | Ga0105242_10273200 | |||
| 849 | Ga0105248_10014721 | |||
| 850 | Ga0105248_10315196 | |||
| 851 | Ga0105248_10686154 | |||
| 852 | Ga0105237_10437167 | |||
| 853 | Ga0105238_11560585 | |||
| 854 | Ga0105238_11763376 | |||
| 855 | Ga0105249_10151301 | |||
| 856 | Ga0105249_10963301 | |||
| 857 | Ga0105249_13456724 | |||
| 858 | Ga0105239_10017093 | |||
| 859 | Ga0105239_11015283 | |||
| 860 | Ga0105246_10682941 | |||
| 861 | Ga0157337_1012636 | |||
| 862 | Ga0157314_1021045 | |||
| 863 | Ga0157313_1023544 | |||
| 864 | Ga0157315_1054272 | |||
| 865 | Ga0157327_1003544 | |||
| 866 | Ga0157373_10210901 | |||
| 867 | Ga0157371_10151454 | |||
| 868 | Ga0157369_10049601 | |||
| 869 | Ga0157374_10798259 | |||
| 870 | Ga0157374_11959518 | |||
| 871 | Ga0157374_12163644 | |||
| 872 | Ga0163162_10017244 | |||
| 873 | Ga0157372_10010523 | |||
| 874 | Ga0157372_10282833 | |||
| 875 | Ga0157372_11800077 | |||
| 876 | Ga0157375_10089965 | |||
| 877 | Ga0157375_12274926 | |||
| 878 | Ga0163163_10051961 | |||
| 879 | Ga0163163_10467037 | |||
| 880 | Ga0163163_10589984 | |||
| 881 | Ga0163163_10639677 | |||
| 882 | Ga0163163_10663307 | |||
| 883 | Ga0157380_11168566 | |||
| 884 | Ga0157377_10013190 | |||
| 885 | Ga0157377_10670909 | |||
| 886 | Ga0157379_10019958 | |||
| 887 | Ga0157379_10020853 | |||
| 888 | Ga0163161_10249576 | |||
| 889 | Ga0184601_113362 | |||
| 890 | Ga0184603_115429 | |||
| 891 | Ga0197907_10044879 | |||
| 892 | Ga0197907_10780904 | |||
| 893 | Ga0197907_10797632 | |||
| 894 | Ga0206356_10079378 | |||
| 895 | Ga0206356_10489675 | |||
| 896 | Ga0206356_10658708 | |||
| 897 | Ga0206349_1092249 | |||
| 898 | Ga0206355_1470772 | |||
| 899 | Ga0206351_10048513 | |||
| 900 | Ga0206351_10890993 | |||
| 901 | Ga0206352_10732892 | |||
| 902 | Ga0206352_11121663 | |||
| 903 | Ga0206350_10494723 | |||
| 904 | Ga0206350_10994755 | |||
| 905 | Ga0206354_10402661 | |||
| 906 | Ga0206354_10631430 | |||
| 907 | Ga0206353_10157446 | |||
| 908 | Ga0206353_10230275 | |||
| 909 | Ga0206353_10340758 | |||
| 910 | Ga0206353_10777893 | |||
| 911 | Ga0213876_10416479 | |||
| 912 | Ga0213875_10064980 | |||
| 913 | Ga0224712_10003308 | |||
| 914 | Ga0224712_10072951 | |||
| 915 | Ga0224712_10111893 | |||
| 916 | Ga0224712_10116777 | |||
| 917 | Ga0207697_10435981 | |||
| 918 | Ga0207713_1047912 | |||
| 919 | Ga0207692_10095933 | |||
| 920 | Ga0207692_10907562 | |||
| 921 | Ga0207642_10434565 | |||
| 922 | Ga0207710_10000178 | |||
| 923 | Ga0207710_10284143 | |||
| 924 | Ga0207688_10117245 | |||
| 925 | Ga0207688_10471268 | |||
| 926 | Ga0207688_10704730 | |||
| 927 | Ga0207647_10011090 | |||
| 928 | Ga0207699_10070136 | |||
| 929 | Ga0207699_10691594 | |||
| 930 | Ga0207705_10104754 | |||
| 931 | Ga0207705_10298662 | |||
| 932 | Ga0207705_10540152 | |||
| 933 | Ga0207705_11260863 | |||
| 934 | Ga0207684_10424866 | |||
| 935 | Ga0207707_10129244 | |||
| 936 | Ga0207707_10628103 | |||
| 937 | Ga0207671_10191972 | |||
| 938 | Ga0207663_10095068 | |||
| 939 | Ga0207657_10143704 | |||
| 940 | Ga0207649_10402348 | |||
| 941 | Ga0207649_10473678 | |||
| 942 | Ga0207649_11493641 | |||
| 943 | Ga0207652_10124949 | |||
| 944 | Ga0207652_11395561 | |||
| 945 | Ga0207681_10922958 | |||
| 946 | Ga0207694_10460284 | |||
| 947 | Ga0207687_10147656 | |||
| 948 | Ga0207687_10240885 | |||
| 949 | Ga0207687_10252583 | |||
| 950 | Ga0207700_10071902 | |||
| 951 | Ga0207700_10123881 | |||
| 952 | Ga0207700_10439531 | |||
| 953 | Ga0207664_10018246 | |||
| 954 | Ga0207664_10297919 | |||
| 955 | Ga0207664_10436052 | |||
| 956 | Ga0207690_10666381 | |||
| 957 | Ga0207690_10891458 | |||
| 958 | Ga0207706_10143179 | |||
| 959 | Ga0207706_10161061 | |||
| 960 | Ga0207706_10712091 | |||
| 961 | Ga0207706_11048550 | |||
| 962 | Ga0207686_10470094 | |||
| 963 | Ga0207686_11228218 | |||
| 964 | Ga0207709_10872606 | |||
| 965 | Ga0207709_11274540 | |||
| 966 | Ga0207669_10396431 | |||
| 967 | Ga0207669_10594756 | |||
| 968 | Ga0207711_10014264 | |||
| 969 | Ga0207711_10864930 | |||
| 970 | Ga0207711_10973730 | |||
| 971 | Ga0207689_10232451 | |||
| 972 | Ga0207661_10167498 | |||
| 973 | Ga0207661_10208095 | |||
| 974 | Ga0207661_10839577 | |||
| 975 | Ga0207679_10245169 | |||
| 976 | Ga0207679_11026405 | |||
| 977 | Ga0207679_11651860 | |||
| 978 | Ga0207712_10960992 | |||
| 979 | Ga0207668_10358672 | |||
| 980 | Ga0207677_10392291 | |||
| 981 | Ga0207677_10875477 | |||
| 982 | Ga0207703_10184408 | |||
| 983 | Ga0207703_10530880 | |||
| 984 | Ga0207678_10299850 | |||
| 985 | Ga0207678_10483239 | |||
| 986 | Ga0207708_10147749 | |||
| 987 | Ga0207708_10492389 | |||
| 988 | Ga0207702_10503453 | |||
| 989 | Ga0207702_10587253 | |||
| 990 | Ga0207702_10935086 | |||
| 991 | Ga0207702_11129616 | |||
| 992 | Ga0207641_10473658 | |||
| 993 | Ga0207676_10008515 | |||
| 994 | Ga0207676_11824072 | |||
| 995 | Ga0207674_10260574 | |||
| 996 | Ga0207674_10727394 | |||
| 997 | Ga0207674_11689652 | |||
| 998 | Ga0207675_100228941 | |||
| 999 | Ga0207675_100279687 | |||
| 1000 | Ga0207683_10163639 | |||
| 1001 | Ga0207683_10328640 | |||
| 1002 | Ga0207698_11048091 | |||
| 1003 | Ga0207698_11703554 | |||
| 1004 | Ga0207698_12425195 | |||
| 1005 | Ga0265357_1006776 | |||
| 1006 | Ga0268266_10001679 | |||
| 1007 | Ga0268266_10101993 | |||
| 1008 | Ga0268264_11618464 | |||
| 1009 | Ga0268264_12068328 | |||
| 1010 | Ga0307515_10635141 | |||
| 1011 | Ga0316176_1120532 | |||
| 1012 | Ga0314311_1042396 | |||
| 1013 | Ga0316178_1115534 | |||
| 1014 | Ga0265769_103159 | |||
| 1015 | Ga0265768_104344 | |||
| 1016 | Ga0307513_10000483 | |||
| 1017 | Ga0310103_127231 | |||
| 1018 | Ga0310101_122171 | |||
| 1019 | Ga0310101_128597 | |||
| 1020 | Ga0316576_10031357 | |||
| 1021 | Ga0316578_10265777 | |||
| 1022 | Ga0316044_117577 | |||
| 1023 | Ga0307413_10324163 | |||
| 1024 | Ga0307518_10120417 | |||
| 1025 | Ga0307410_10164260 | |||
| 1026 | Ga0307410_10878240 | |||
| 1027 | Ga0307410_11945560 | |||
| 1028 | Ga0307412_10983682 | |||
| 1029 | Ga0307412_11285749 | |||
| 1030 | Ga0307409_102683549 | |||
| 1031 | Ga0307416_101070798 | |||
| 1032 | Ga0307415_101265645 | |||
| 1033 | Ga0316593_10158835 | |||
| 1034 | Ga0316593_10225620 | |||
| 1035 | Ga0373926_0052795 | |||
| 1036 | Ga0373934_0339848 | |||
| 1037 | Ga0373944_0005913 | |||
| 1038 | Ga0373944_0264285 | |||
| 1039 | Ga0373923_0082331 | |||
| 1040 | Ga0373923_0668099 | |||
| 1041 | Ga0373936_0000493 | |||
| 1042 | Ga0373936_0035601 | |||
| 1043 | Ga0373941_0035130 | |||
| 1044 | Ga0373945_0001253 | |||
| 1045 | Ga0373953_0021997 | |||
| 1046 | Ga0373954_0028926 | |||
| 1047 | Ga0373956_0009324 | |||
| 1048 | Ga0373956_0017695 | |||
| 1049 | Ga0373957_0007773 | |||
| 1050 | Ga0373957_0008339 | |||
| 1051 | Ga0373960_0291396 | |||
| 1052 | Ga0373943_0002059 | |||
| 1053 | Ga0373946_0002389 | |||
| 1054 | Ga0373955_0006331 | |||
| 1055 | Ga0373955_0089451 | |||
| 1056 | Ga0373942_0116039 | |||
| 1057 | Ga0316574_0006284 | |||
| 1058 | Ga0373924_0071260 | |||
| 1059 | Ga0373924_0397867 | |||
| 1060 | Ga0373935_0007327 | |||
| 1061 | Ga0373935_0013045 | |||
| 1062 | Ga0373935_0759919 | |||
| 1063 | Ga0373927_0007504 | |||
| 1064 | Ga0373933_0003002 | |||
| 1065 | Ga0373933_0029821 | |||
| 1066 | Ga0373933_0109172 | |||
| 1067 | Ga0373947_0000144 | |||
| 1068 | Ga0373947_0260348 | |||
| 1069 | Ga0373937_0033996 | |||
| 1070 | Ga0373937_0065183 | |||
| 1071 | Ga0373937_0872445 | |||
| 1072 | Ga0310112_037625 | |||
| 1073 | Ga0316582_0323091 | |||
| 1074 | Ga0316582_0522664 | |||
| 1075 | Ga0316584_0633058 | |||
| 1076 | Ga0373925_0001639 | |||
| 1077 | Ga0373925_0262560 | |||
| 1078 | Ga0395900_1315509 | |||
| 1079 | Ga0395898_0307245 | |||
| 1080 | Ga0436364_0082959 | |||
| 1081 | Ga0436364_0774136 | |||
| 1082 | Ga0436364_1159607 | |||
| 1083 | Ga0395901_0245303 | |||
| 1084 | Ga0395901_0441641 | |||
| 1085 | Ga0395901_0459000 | |||
| 1086 | Ga0436365_0783659 | |||
| 1087 | Ga0436365_1057536 | |||
| 1088 | Ga0439461_0212649 | |||
| 1089 | Ga0451789_0734274 | |||
| 1090 | Ga0451797_0590245 | |||
| 1091 | Ga0451797_0799032 | |||
| 1092 | Ga0451795_0351429 | |||
| 1093 | Ga0451795_1029081 | |||
| 1094 | Ga0451798_0088860 | |||
| 1095 | Ga0451807_0481825 | |||
| 1096 | Ga0451807_1069947 | |||
| 1097 | Ga0451833_0909349 | |||
| 1098 | Ga0451835_0418266 | |||
| 1099 | Ga0451837_1308254 | |||
| 1100 | Ga0451841_0330528 | |||
| 1101 | Ga0451849_0388172 | |||
| 1102 | Ga0451850_40182 | |||
| 1103 | Ga0451855_1212382 | |||
| 1104 | Ga0451853_3849916 | |||
| 1105 | Ga0439463_031708 | |||
| 1106 | Ga0450900_018948 | |||
| 1107 | Ga0439434_0046747 | |||
| 1108 | Ga0439464_0120063 | |||
| 1109 | Ga0439440_0050958 | |||
| 1110 | Ga0466972_0011350 | |||
| 1111 | Ga0466972_0067863 | |||
| 1112 | Ga0466965_0011382 | |||
| 1113 | Ga0466966_0050250 | |||
| 1114 | Ga0466961_0123519 | |||
| 1115 | Ga0466963_0028619 | |||
| 1116 | Ga0466963_0042453 | |||
| 1117 | Ga0466963_0271572 | |||
| 1118 | Ga0466963_0681696 | |||
| 1119 | Ga0466963_1236908 | |||
| 1120 | Ga0466964_0104739 | |||
| 1121 | Ga0466964_0247145 | |||
| 1122 | Ga0466964_0787241 | |||
| 1123 | Ga0453684_0000493 | |||
| 1124 | Ga0453684_0771776 | |||
| 1125 | Ga0466971_0028623 | |||
| 1126 | Ga0466971_0053178 | |||
| 1127 | Ga0466971_0368284 | |||
| 1128 | Ga0466971_0369291 | |||
| 1129 | Ga0466968_0179650 | |||
| 1130 | Ga0466970_0041656 | |||
| 1131 | Ga0466957_0020855 | |||
| 1132 | Ga0466957_0112465 | |||
| 1133 | Ga0466957_0595974 | |||
| 1134 | Ga0466960_0071186 | |||
| 1135 | Ga0466960_0152020 | |||
| 1136 | Ga0466960_0452581 | |||
| 1137 | Ga0466959_0007502 | |||
| 1138 | Ga0466958_0018203 | |||
| 1139 | Ga0466958_0067415 | |||
| 1140 | Ga0466967_0003056 | |||
| 1141 | Ga0466967_0009385 | |||
| 1142 | Ga0466967_0014261 | |||
| 1143 | Ga0466967_0018188 | |||
| 1144 | Ga0466967_0033910 | |||
| 1145 | Ga0466967_0243418 | |||
| 1146 | Ga0466967_0433518 | |||
| 1147 | Ga0466967_0611989 | |||
| 1148 | Ga0466967_0695041 | |||
| 1149 | Ga0466967_0904250 | |||
| 1150 | Ga0466967_1463429 | |||
| 1151 | Ga0466967_2078078 | |||
| 1152 | Ga0466967_2448462 | |||
| 1153 | Ga0495592_0044061 | |||
| 1154 | Ga0495592_0119313 | |||
| 1155 | Ga0495641_0009970 | |||
| 1156 | Ga0495651_0036578 | |||
| 1157 | Ga0495651_0094201 | |||
| 1158 | Ga0495651_0145460 | |||
| 1159 | Ga0495653_0000707 | |||
| 1160 | Ga0495653_0006033 | |||
| 1161 | Ga0495653_0049828 | |||
| 1162 | Ga0495582_0451195 | |||
| 1163 | Ga0495639_0120689 | |||
| 1164 | Ga0495664_0015162 | |||
| 1165 | Ga0495608_0022195 | |||
| 1166 | Ga0495608_0108714 | |||
| 1167 | Ga0495608_0152099 | |||
| 1168 | Ga0495618_0040934 | |||
| 1169 | Ga0495618_0267747 | |||
| 1170 | Ga0495628_0039067 | |||
| 1171 | Ga0495628_0106077 | |||
| 1172 | Ga0495630_0047532 | |||
| 1173 | Ga0495630_0141352 | |||
| 1174 | Ga0495648_0035512 | |||
| 1175 | Ga0495652_0020282 | |||
| 1176 | Ga0495652_0290457 | |||
| 1177 | Ga0495665_0005340 | |||
| 1178 | Ga0495640_0034295 | |||
| 1179 | Ga0495640_0187078 | |||
| 1180 | Ga0495640_0220080 | |||
| 1181 | Ga0495640_0281173 | |||
| 1182 | Ga0495586_0064157 | |||
| 1183 | Ga0495587_0022832 | |||
| 1184 | Ga0495621_0327877 | |||
| 1185 | Ga0495645_0053382 | |||
| 1186 | Ga0495667_0024008 | |||
| 1187 | Ga0495667_0026247 | |||
| 1188 | Ga0495667_0033807 | |||
| 1189 | Ga0495667_0524267 | |||
| 1190 | Ga0495656_0436298 | |||
| 1191 | Ga0495634_0096727 | |||
| 1192 | Ga0495634_0164611 | |||
| 1193 | Ga0495634_0863404 | |||
| 1194 | Ga0495635_0007325 | |||
| 1195 | Ga0495635_0010265 | |||
| 1196 | Ga0495635_0023818 | |||
| 1197 | Ga0495635_0599269 | |||
| 1198 | Ga0495635_0869527 | |||
| 1199 | Ga0495657_0018611 | |||
| 1200 | Ga0495657_0033980 | |||
| 1201 | Ga0495657_0052311 | |||
| 1202 | Ga0495599_0022974 | |||
| 1203 | Ga0495599_0343711 | |||
| 1204 | Ga0495623_0319541 | |||
| 1205 | Ga0495646_0115569 | |||
| 1206 | Ga0495646_0204417 | |||
| 1207 | Ga0495669_0231031 | |||
| 1208 | Ga0495613_0685859 | |||
| 1209 | Ga0495624_0005225 | |||
| 1210 | Ga0495670_0539721 | |||
| 1211 | Ga0495600_0204659 | |||
| 1212 | Ga0495604_0085070 | |||
| 1213 | Ga0495604_0295612 | |||
| 1214 | Ga0495674_0000793 | |||
| 1215 | Ga0495674_0029092 | |||
| 1216 | Ga0495674_0549467 | |||
| 1217 | Ga0495674_0585461 | |||
| 1218 | Ga0495672_0042916 | |||
| 1219 | Ga0495672_0404703 | |||
| 1220 | Ga0495676_0042140 | |||
| 1221 | Ga0495676_0664952 | |||
| 1222 | Ga0495680_0027984 | |||
| 1223 | Ga0495680_0087542 | |||
| 1224 | Ga0495684_0029121 | |||
| 1225 | Ga0495684_0240237 | |||
| 1226 | Ga0495602_0040806 | |||
| 1227 | Ga0495602_0269777 | |||
| 1228 | Ga0495626_0356758 | |||
| 1229 | Ga0496100_0783392 | |||
| 1230 | Ga0496100_1034854 | |||
| 1231 | Ga0496101_0487511 | |||
| 1232 | Ga0496102_0013726 | |||
| 1233 | Ga0496102_0023774 | |||
| 1234 | Ga0496102_0040757 | |||
| 1235 | Ga0496102_0312080 | |||
| 1236 | Ga0496102_0601180 | |||
| 1237 | Ga0496102_0940471 | |||
| 1238 | Ga0496102_1413575 | |||
| 1239 | Ga0496103_0035238 | |||
| 1240 | Ga0496103_0129122 | |||
| 1241 | Ga0496104_0042373 | |||
| 1242 | Ga0496104_0399763 | |||
| 1243 | Ga0496105_0002612 | |||
| 1244 | Ga0496105_0463272 | |||
| 1245 | Ga0496106_0048931 | |||
| 1246 | Ga0496106_0107906 | |||
| 1247 | Ga0496106_0534687 | |||
| 1248 | Ga0496107_0110697 | |||
| 1249 | Ga0496107_0645484 | |||
| 1250 | Ga0496107_0998677 | |||
| 1251 | Ga0496108_0078195 | |||
| 1252 | Ga0496108_0084713 | |||
| 1253 | Ga0496108_0110794 | |||
| 1254 | Ga0496108_0388152 | |||
| 1255 | Ga0496108_0480590 | |||
| 1256 | Ga0496108_0988269 | |||
| 1257 | Ga0496108_1539387 | |||
| 1258 | Ga0496109_0006343 | |||
| 1259 | Ga0496109_0054704 | |||
| 1260 | Ga0496109_0054991 | |||
| 1261 | Ga0496109_0080634 | |||
| 1262 | Ga0496109_0266911 | |||
| 1263 | Ga0496109_0280503 | |||
| 1264 | Ga0496110_0109779 | |||
| 1265 | Ga0496110_0380343 | |||
| 1266 | Ga0496110_0492644 | |||
| 1267 | Ga0496110_0814516 | |||
| 1268 | Ga0496111_0009913 | |||
| 1269 | Ga0496111_0051155 | |||
| 1270 | Ga0496111_0238035 | |||
| 1271 | Ga0496111_0559510 | |||
| 1272 | Ga0496112_0231555 | |||
| 1273 | Ga0496113_0100859 | |||
| 1274 | Ga0496113_0151191 | |||
| 1275 | Ga0496113_0389366 | |||
| 1276 | Ga0496113_0437046 | |||
| 1277 | Ga0496114_0011670 | |||
| 1278 | Ga0496114_0089616 | |||
| 1279 | Ga0496114_0127495 | |||
| 1280 | Ga0496114_0338808 | |||
| 1281 | Ga0496114_0388078 | |||
| 1282 | Ga0496114_0776011 | |||
| 1283 | Ga0496115_0002770 | |||
| 1284 | Ga0496115_0043806 | |||
| 1285 | Ga0496115_1082677 | |||
| 1286 | Ga0496119_0000375 | |||
| 1287 | Ga0496119_0596185 | |||
| 1288 | Ga0496120_0000453 | |||
| 1289 | Ga0496121_0324229 | |||
| 1290 | Ga0496126_0000676 | |||
| 1291 | Ga0496126_0189308 | |||
| 1292 | Ga0496126_0567953 | |||
| 1293 | Ga0496126_0798608 | |||
| 1294 | Ga0501310_013224 | |||
| 1295 | Ga0501307_015721 | |||
| 1296 | Ga0501311_009913 | |||
| 1297 | Ga0501313_026934 | |||
| 1298 | Ga0501315_025470 | |||
| 1299 | Ga0501317_002182 | |||
| 1300 | Ga0501318_015147 | |||
| 1301 | Ga0501320_033085 | |||
| 1302 | Ga0501322_002910 | |||
| 1303 | Ga0501323_020646 | |||
| 1304 | Ga0501324_012422 | |||
| 1305 | Ga0501330_009540 | |||
| 1306 | Ga0501031_0140312 | |||
| 1307 | Ga0501031_0258139 | |||
| 1308 | Ga0501032_0083756 | |||
| 1309 | Ga0501032_0354152 | |||
| 1310 | Ga0501033_0457925 | |||
| 1311 | Ga0501033_1047632 | |||
| 1312 | Ga0501034_0011290 | |||
| 1313 | Ga0501034_0136958 | |||
| 1314 | Ga0501034_0162720 | |||
| 1315 | Ga0501034_0466620 | |||
| 1316 | Ga0501036_0329162 | |||
| 1317 | Ga0501036_0424651 | |||
| 1318 | Ga0501038_0000236 | |||
| 1319 | Ga0501038_0093948 | |||
| 1320 | Ga0501039_0080372 | |||
| 1321 | Ga0501039_0273146 | |||
| 1322 | Ga0501039_0281009 | |||
| 1323 | Ga0501040_0147026 | |||
| 1324 | Ga0501041_0903238 | |||
| 1325 | Ga0501042_0247338 | |||
| 1326 | Ga0501043_0091820 | |||
| 1327 | Ga0501043_0587003 | |||
| 1328 | Ga0501046_0001520 | |||
| 1329 | Ga0501047_0009156 | |||
| 1330 | Ga0501047_0097625 | |||
| 1331 | Ga0501048_0326498 | |||
| 1332 | Ga0501067_0003678 | |||
| 1333 | Ga0501068_0022198 | |||
| 1334 | Ga0501068_0623232 | |||
| 1335 | Ga0501070_0008855 | |||
| 1336 | Ga0501070_0032172 | |||
| 1337 | Ga0501070_0354575 | |||
| 1338 | Ga0501070_0382454 | |||
| 1339 | Ga0501070_0789297 | |||
| 1340 | Ga0501071_0048943 | |||
| 1341 | Ga0501071_0323203 | |||
| 1342 | Ga0501072_0059462 | |||
| 1343 | Ga0501073_0003004 | |||
| 1344 | Ga0501073_0242651 | |||
| 1345 | Ga0501073_1025862 | |||
| 1346 | Ga0501074_0005115 | |||
| 1347 | Ga0501074_0513939 | |||
| 1348 | Ga0501075_0399564 | |||
| 1349 | Ga0501076_0278949 | |||
| 1350 | Ga0501077_0222923 | |||
| 1351 | Ga0501079_0091853 | |||
| 1352 | Ga0501079_0483735 | |||
| 1353 | Ga0501080_0014903 | |||
| 1354 | Ga0501080_0109487 | |||
| 1355 | Ga0501081_0196491 | |||
| 1356 | Ga0501083_0057154 | |||
| 1357 | Ga0501083_0069429 | |||
| 1358 | Ga0501083_0208704 | |||
| 1359 | Ga0501083_0353130 | |||
| 1360 | Ga0501083_0874443 | |||
| 1361 | Ga0501035_0077266 | |||
| 1362 | Ga0501035_0139818 | |||
| 1363 | Ga0501035_0415680 | |||
| 1364 | Ga0501044_0309928 | |||
| 1365 | Ga0501044_1526121 | |||
| 1366 | Ga0501045_0256739 | |||
| 1367 | Ga0501045_0375318 | |||
| 1368 | nmdc:mga00v17_436191_c1 | |||
| 1369 | nmdc:mga0yw44_129889_c1 | |||
| 1370 | nmdc:mga0yw44_263200_c1 | |||
| 1371 | nmdc:mga06z11_205837_c1 | |||
| 1372 | nmdc:mga06z11_214829_c1 | |||
| 1373 | nmdc:mga08y16_1112434_c1 | |||
| 1374 | Ga0495601_0112283 | |||
| 1375 | Ga0495612_0061734 | |||
| 1376 | Ga0495619_0063783 | |||
| 1377 | Ga0495619_0530438 | |||
| 1378 | Ga0500590_297913 | |||
| 1379 | Ga0500604_0007038 | |||
| 1380 | Ga0500616_0006992 | |||
| 1381 | Ga0501084_0022188 | |||
| 1382 | Ga0501084_0479398 | |||
| 1383 | Ga0590075_063968 | |||
| 1384 | Ga0587084_055812 | |||
| 1385 | Ga0587077_174522 | |||
| 1386 | Ga0587080_034987 | |||
| 1387 | Ga0587082_034894 | |||
| 1388 | Ga0587083_0084392 | |||
| 1389 | Ga0587083_0253813 | |||
| 1390 | Ga0587086_028418 | |||
| 1391 | Ga0587088_141057 | |||
| 1392 | Ga0587090_029455 | |||
| 1393 | Ga0587098_013499 | |||
| 1394 | Ga0587101_130728 | |||
| 1395 | Ga0587128_003279 | |||
| 1396 | Ga0587128_124117 | |||
| 1397 | Ga0587068_047301 | |||
| 1398 | Ga0587069_014490 | |||
| 1399 | Ga0587072_039755 | |||
| 1400 | Ga0587072_146894 | |||
| 1401 | Ga0587076_188813 | |||
| 1402 | Ga0587079_126855 | |||
| 1403 | Ga0587107_021834 | |||
| 1404 | Ga0587107_063047 | |||
| 1405 | Ga0587119_001807 | |||
| 1406 | Ga0587111_0018916 | |||
| 1407 | Ga0501082_0005659 | |||
| 1408 | Ga0501082_0009062 | |||
| 1409 | Ga0501082_0271235 | |||
| 1410 | Ga0501082_0518551 | |||
| 1411 | Ga0501082_1107796 | |||
| 1412 | Ga0466962_0043993 | |||
| 1413 | Ga0530510_0855081 | |||
| 1414 | 2528205540 | |||
| 1415 | 2528214983 | |||
| 1416 | 2546950317 | |||
| 1417 | 2579750233 | |||
| 1418 | 2579856461 | |||
| 1419 | 2619858093 | |||
| 1420 | 2620352602 | |||
| 1421 | 2626639653 | |||
| 1422 | 2671839083 | |||
| 1423 | 2676476030 | |||
| 1424 | 2676491299 | |||
| 1425 | 2686537810 | |||
| 1426 | 2686543123 | |||
| 1427 | 2689991637 | |||
| 1428 | 2710603799 | |||
| 1429 | 2739604264 | |||
| 1430 | 2740169278 | |||
| 1431 | 2774857239 | |||
| 1432 | 2774866114 | |||
| 1433 | 2776370678 | |||
| 1434 | 2804843892 | |||
| 1435 | 2817509480 | |||
| 1436 | 2827630592 | |||
| 1437 | 2848553054 | |||
| 1438 | 2856743267 | |||
| 1439 | 2857728861 | |||
| 1440 | 2863072229 | |||
| 1441 | 2873319298 | |||
| 1442 | 2884700695 | |||
| 1443 | 2891403629 | |||
| 1444 | 2891556122 | |||
| 1445 | 2891569397 | |||
| 1446 | 2895429173 | |||
| 1447 | 2895452588 | |||
| 1448 | 2895888726 | |||
| 1449 | 2932398915 | |||
| 1450 | 637880504 | |||
| 1451 | 8025419198 | |||
| 1452 | 8054914086 | |||
| 1453 | 8054923102 | |||
| 1454 | 8055068498 | |||
| 1455 | 8055160832 | |||
| 1456 | 8055181458 | |||
| 1457 | 8056210669 | |||
| 1458 | 8057568530 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8353 | 61 | 120 |
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.8235 | 61 | 120 |
| 6o8y-assembly1.cif.gz_R | cryo-em image reconstruction of the 70s ribosome enterococcus faecalis class03 | 0.8183 | 23 | 116 |
| 6xyw-assembly1.cif.gz_Aq | structure of the plant mitochondrial ribosome | 0.7772 | 19 | 117 |
| 7nsi-assembly1.cif.gz_BU | 55s mammalian mitochondrial ribosome with mtrrf (pre) and trna(p/e) | 0.7714 | 18 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9278 | 53 | 120 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9024 | 53 | 120 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8956 | 58 | 116 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8353 | 61 | 120 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8235 | 61 | 120 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354QTS7-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.004 | 53 | 115 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-G6EM08-F1-model_v4 | deleted | 1.004 | 57 | 115 |
|
| AF-A0A1G9GV44-F1-model_v4 | deleted | 1.003 | 65 | 116 |
|
| AF-A0A357L7L9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.002 | 61 | 116 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A659UR08-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 1.001 | 56 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |