F477869

General Info

Members Datasets Scaffolds Average Seq Length
729 367 1457 111

Family's Representative Sequence

Representative Sequence 3300032005|Ga0307411_10046050|Ga0307411_100460503
Length 133
Sequence MREGELAAGFGSCVCRLVARDPALIRVDAVWLAVEPLDMRAGTEAALVRVVTVFGSARPHHAYLFANKRANRMKVLVHDGIGVWLAARRLNSGRFVWPKDSGGTLTLTRAQLDALVLGLPWQRIGEAGVITVL

Samples

Sample ID Description Type Environment
1 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
78 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
79 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
96 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
97 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
156 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
188 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
189 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
190 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
191 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
195 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
198 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
199 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
200 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
205 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
210 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
211 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
212 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
215 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
218 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
219 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
220 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
221 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
222 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
223 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
224 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
225 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
228 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
229 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
232 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
327 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
328 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
329 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
330 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
333 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
349 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
353 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
357 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
358 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
359 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
360 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
366 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
367 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.14
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.31
Nodule 0.14
Rhizoplane 4.53
Rhizosphere 72.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307411_10046050 3300032005 Bacteria 2809
2 JGI24735J21928_10012629 3300002067 Bacteria 2668
3 JGI24744J21845_10001040 3300002077 Bacteria 5343
4 JGI24744J21845_10095367 3300002077 Bacteria 547
5 JGI25156J39149_1007078 3300002705 Bacteria 2992
6 JGI25154J39366_1003779 3300002738 Bacteria 2992
7 JGI25157J39369_1003744 3300002741 Bacteria 2992
8 JGI25153J46596_10021332 3300003215 Bacteria 2417
9 rootH1_10011074 3300003316 Bacteria 16023
10 rootH1_10011074 3300003323 Bacteria 5334
11 rootH1_10012705 3300003316 Bacteria 40164
12 rootH1_10051619 3300003316 Bacteria 1650
13 rootL2_10055089 3300003322 Bacteria 4831
14 rootL2_10057448 3300003322 Bacteria 1474
15 rootH1_10016840 3300003323 Bacteria 4682
16 rootH1_10050138 3300003323 Bacteria 7216
17 rootH1_10259278 3300003323 Bacteria 4829
18 rootH1_10338839 3300003323 Bacteria 1100
19 Ga0006562J51391_1069309 3300003578 Bacteria 951
20 Ga0055539_1002263 3300003752 Bacteria 3025
21 Ga0055524_1012854 3300003775 Bacteria 3192
22 Ga0055536_1016264 3300003781 Bacteria 2495
23 Ga0055536_1035256 3300003781 Bacteria 1254
24 Ga0055530_10101420 3300003791 Bacteria 577
25 Ga0055540_1077716 3300003792 Bacteria 640
26 Ga0055531_10006120 3300003794 Bacteria 6889
27 Ga0065165_1043296 3300005262 Bacteria 1323
28 Ga0065714_10121429 3300005288 Bacteria 1344
29 Ga0065714_10509287 3300005288 Bacteria 519
30 Ga0065704_10319710 3300005289 Bacteria 855
31 Ga0065707_10086369 3300005295 Bacteria 5506
32 Ga0065707_10104090 3300005295 Bacteria 2713
33 Ga0070676_10742861 3300005328 Bacteria 720
34 Ga0070670_100070726 3300005331 Bacteria 2995
35 Ga0070670_100968967 3300005331 Bacteria 773
36 Ga0070677_10029320 3300005333 Bacteria 2086
37 Ga0070666_11352722 3300005335 Bacteria 532
38 Ga0068868_101711835 3300005338 Bacteria 593
39 Ga0070689_100281445 3300005340 Bacteria 1380
40 Ga0070668_100218806 3300005347 Bacteria 1570
41 Ga0070669_100064927 3300005353 Bacteria 2688
42 Ga0070669_101360296 3300005353 Bacteria 616
43 Ga0070675_100045462 3300005354 Bacteria 3593
44 Ga0070675_100756087 3300005354 Bacteria 887
45 Ga0070671_100063526 3300005355 Bacteria 3075
46 Ga0070671_100315529 3300005355 Bacteria 1332
47 Ga0070674_100209027 3300005356 Bacteria 1511
48 Ga0070674_100313122 3300005356 Bacteria 1256
49 Ga0070674_100633786 3300005356 Bacteria 907
50 Ga0070674_101304079 3300005356 Bacteria 647
51 Ga0070673_100086543 3300005364 Bacteria 2553
52 Ga0070673_100200779 3300005364 Bacteria 1717
53 Ga0070673_100340736 3300005364 Bacteria 1328
54 Ga0070673_100769442 3300005364 Bacteria 887
55 Ga0070667_100198901 3300005367 Bacteria 1778
56 Ga0070667_100204096 3300005367 Bacteria 1755
57 Ga0070667_100656575 3300005367 Bacteria 968
58 Ga0070678_100233521 3300005456 Bacteria 1534
59 Ga0070678_100339654 3300005456 Bacteria 1288
60 Ga0070678_100808758 3300005456 Bacteria 851
61 Ga0070678_101115710 3300005456 Bacteria 729
62 Ga0070662_100062128 3300005457 Bacteria 2728
63 Ga0068867_100214575 3300005459 Bacteria 1548
64 Ga0068867_100811547 3300005459 Bacteria 835
65 Ga0070699_100177401 3300005518 Bacteria 1890
66 Ga0068853_100247874 3300005539 Bacteria 1634
67 Ga0068853_100595658 3300005539 Bacteria 1049
68 Ga0068853_101124361 3300005539 Bacteria 758
69 Ga0070672_100188094 3300005543 Bacteria 1723
70 Ga0070672_100194539 3300005543 Bacteria 1694
71 Ga0070672_100380333 3300005543 Bacteria 1207
72 Ga0070672_101408048 3300005543 Bacteria 624
73 Ga0070672_101492158 3300005543 Bacteria 606
74 Ga0070686_100707555 3300005544 Bacteria 804
75 Ga0070665_100401328 3300005548 Bacteria 1379
76 Ga0070665_100987632 3300005548 Bacteria 854
77 Ga0070704_100423008 3300005549 Bacteria 1141
78 Ga0068854_100114367 3300005578 Bacteria 2040
79 Ga0068854_100956400 3300005578 Bacteria 756
80 Ga0068854_102083168 3300005578 Bacteria 524
81 Ga0068856_100070354 3300005614 Bacteria 3461
82 Ga0068852_100323309 3300005616 Bacteria 1499
83 Ga0068852_100984746 3300005616 Bacteria 862
84 Ga0068852_101942181 3300005616 Bacteria 611
85 Ga0068864_100847421 3300005618 Bacteria 900
86 Ga0068864_100905169 3300005618 Bacteria 871
87 Ga0068866_10831251 3300005718 Bacteria 644
88 Ga0068861_100365165 3300005719 Bacteria 1271
89 Ga0068851_10148475 3300005834 Bacteria 1280
90 Ga0068870_10078164 3300005840 Bacteria 1822
91 Ga0068863_100316404 3300005841 Bacteria 1516
92 Ga0068860_100827139 3300005843 Bacteria 940
93 Ga0068860_101144364 3300005843 Bacteria 798
94 Ga0068860_102347117 3300005843 Bacteria 554
95 Ga0068862_100139149 3300005844 Bacteria 2154
96 Ga0081455_10092946 3300005937 Bacteria 2439
97 Ga0075363_100357684 3300006048 Bacteria 853
98 Ga0075432_10469770 3300006058 Bacteria 555
99 Ga0075362_10113065 3300006177 Bacteria 1280
100 Ga0075367_10127737 3300006178 Bacteria 1570
101 Ga0075367_10181851 3300006178 Bacteria 1311
102 Ga0075367_10267368 3300006178 Bacteria 1074
103 Ga0075369_10137211 3300006186 Bacteria 1114
104 Ga0075369_10192156 3300006186 Bacteria 941
105 Ga0075366_10029676 3300006195 Bacteria 3214
106 Ga0075366_10036861 3300006195 Bacteria 2884
107 Ga0075366_10048530 3300006195 Bacteria 2518
108 Ga0075366_10052932 3300006195 Bacteria 2411
109 Ga0075366_10062290 3300006195 Bacteria 2217
110 Ga0075366_10342389 3300006195 Bacteria 917
111 Ga0075366_10383424 3300006195 Bacteria 864
112 Ga0097621_100150392 3300006237 Bacteria 1996
113 Ga0097621_100537328 3300006237 Bacteria 1063
114 Ga0097621_101293220 3300006237 Bacteria 689
115 Ga0075370_10002098 3300006353 Bacteria 9090
116 Ga0075370_10104141 3300006353 Bacteria 1644
117 Ga0075370_10125136 3300006353 Bacteria 1498
118 Ga0075370_10139598 3300006353 Bacteria 1416
119 Ga0075370_10153183 3300006353 Bacteria 1351
120 Ga0075370_10202612 3300006353 Bacteria 1171
121 Ga0075370_10319571 3300006353 Bacteria 925
122 Ga0075370_10347813 3300006353 Bacteria 885
123 Ga0075370_10430108 3300006353 Bacteria 793
124 Ga0068871_100032996 3300006358 Bacteria 4095
125 Ga0068871_100146082 3300006358 Bacteria 2014
126 Ga0068871_100698768 3300006358 Bacteria 929
127 Ga0068871_101604171 3300006358 Bacteria 616
128 Ga0075428_100098258 3300006844 Bacteria 3192
129 Ga0075428_100244642 3300006844 Bacteria 1935
130 Ga0075429_100541931 3300006880 Bacteria 1020
131 Ga0068865_100030090 3300006881 Bacteria 3608
132 Ga0068865_100371563 3300006881 Bacteria 1164
133 Ga0068865_100472040 3300006881 Bacteria 1041
134 Ga0068865_101383154 3300006881 Bacteria 628
135 Ga0099826_10105176 3300006948 Bacteria 1694
136 Ga0105245_10183328 3300009098 Bacteria 2001
137 Ga0105245_10895121 3300009098 Bacteria 929
138 Ga0114129_11311227 3300009147 Bacteria 897
139 Ga0105243_10032599 3300009148 Bacteria 4026
140 Ga0105242_10042038 3300009176 Bacteria 3689
141 Ga0105248_10003485 3300009177 Bacteria 17469
142 Ga0105248_10043221 3300009177 Bacteria 5053
143 Ga0105248_10157562 3300009177 Bacteria 2562
144 Ga0105248_10827480 3300009177 Bacteria 1045
145 Ga0105237_10046153 3300009545 Bacteria 4383
146 Ga0105238_10700839 3300009551 Bacteria 1025
147 Ga0105249_10224867 3300009553 Bacteria 1848
148 Ga0105249_10273915 3300009553 Bacteria 1682
149 Ga0105029_100524 3300009984 Bacteria 2092
150 Ga0157319_1000021 3300012497 Bacteria 84514
151 Ga0157347_1030729 3300012502 Bacteria 671
152 Ga0157373_10058429 3300013100 Bacteria 2735
153 Ga0157370_10076897 3300013104 Bacteria 3144
154 Ga0157370_10338854 3300013104 Bacteria 1386
155 Ga0157370_10352165 3300013104 Bacteria 1357
156 Ga0157369_10005989 3300013105 Bacteria 14124
157 Ga0157369_10613795 3300013105 Bacteria 1122
158 Ga0157378_10866066 3300013297 Bacteria 932
159 Ga0157378_10868552 3300013297 Bacteria 931
160 Ga0163162_10456278 3300013306 Bacteria 1410
161 Ga0163162_10629736 3300013306 Bacteria 1197
162 Ga0163162_10745106 3300013306 Bacteria 1099
163 Ga0157375_10103016 3300013308 Bacteria 2940
164 Ga0157375_10368441 3300013308 Bacteria 1603
165 Ga0157375_11232773 3300013308 Bacteria 878
166 Ga0157375_11652487 3300013308 Bacteria 758
167 Ga0157375_12228535 3300013308 Bacteria 653
168 Ga0163163_10059609 3300014325 Bacteria 3776
169 Ga0163163_10318463 3300014325 Bacteria 1609
170 Ga0157380_10065993 3300014326 Bacteria 2910
171 Ga0157380_10385862 3300014326 Bacteria 1324
172 Ga0182008_10000645 3300014497 Bacteria 25460
173 Ga0182008_10043413 3300014497 Bacteria 2238
174 Ga0182008_10102707 3300014497 Bacteria 1414
175 Ga0157379_10044430 3300014968 Bacteria 3966
176 Ga0157379_10076984 3300014968 Bacteria 2987
177 Ga0157379_10420323 3300014968 Bacteria 1231
178 Ga0157379_10538640 3300014968 Bacteria 1085
179 Ga0157376_10437922 3300014969 Bacteria 1272
180 Ga0157376_10468786 3300014969 Bacteria 1232
181 Ga0157376_12017734 3300014969 Bacteria 615
182 Ga0182006_1043647 3300015261 Bacteria 1752
183 Ga0182006_1045984 3300015261 Bacteria 1697
184 Ga0163161_10058717 3300017792 Bacteria 2796
185 Ga0163161_10177080 3300017792 Bacteria 1633
186 Ga0163161_10203676 3300017792 Bacteria 1526
187 Ga0163161_10341103 3300017792 Bacteria 1189
188 Ga0163161_10583043 3300017792 Bacteria 920
189 Ga0163161_10604999 3300017792 Bacteria 904
190 Ga0209674_103160 3300025226 Bacteria 3127
191 Ga0207427_103813 3300025231 Bacteria 2892
192 Ga0209646_1001075 3300025246 Bacteria 8195
193 Ga0209026_1000021 3300025250 Bacteria 375165
194 Ga0209677_106024 3300025253 Bacteria 2992
195 Ga0209759_1009249 3300025256 Bacteria 2992
196 Ga0209130_1000858 3300025284 Bacteria 25186
197 Ga0209130_1013422 3300025284 Bacteria 2097
198 Ga0209675_1018375 3300025291 Bacteria 1958
199 Ga0209676_1001864 3300025292 Bacteria 17343
200 Ga0209676_1011015 3300025292 Bacteria 3695
201 Ga0209676_1017837 3300025292 Bacteria 2497
202 Ga0209676_1026728 3300025292 Bacteria 1827
203 Ga0209758_1021927 3300025297 Bacteria 2953
204 Ga0209050_1030065 3300025298 Bacteria 1721
205 Ga0209256_1000633 3300025299 Bacteria 48078
206 Ga0207426_1050463 3300025302 Bacteria 1240
207 Ga0209051_1000788 3300025303 Bacteria 33348
208 Ga0209257_1001611 3300025304 Bacteria 25856
209 Ga0209257_1001725 3300025304 Bacteria 24402
210 Ga0209257_1009630 3300025304 Bacteria 5116
211 Ga0207697_10021654 3300025315 Bacteria 2632
212 Ga0207682_10020538 3300025893 Bacteria 2593
213 Ga0207680_10196845 3300025903 Bacteria 1371
214 Ga0207680_10230633 3300025903 Bacteria 1272
215 Ga0207680_10536780 3300025903 Bacteria 835
216 Ga0207680_10978859 3300025903 Bacteria 606
217 Ga0207645_10596609 3300025907 Bacteria 750
218 Ga0207645_10637876 3300025907 Bacteria 724
219 Ga0207643_10038504 3300025908 Bacteria 2686
220 Ga0207684_10024482 3300025910 Bacteria 5146
221 Ga0207671_10028876 3300025914 Bacteria 4143
222 Ga0207671_10168073 3300025914 Bacteria 1701
223 Ga0207694_10267282 3300025924 Bacteria 1402
224 Ga0207650_10765880 3300025925 Bacteria 817
225 Ga0207659_10061624 3300025926 Bacteria 2704
226 Ga0207659_10858660 3300025926 Bacteria 780
227 Ga0207659_11277838 3300025926 Bacteria 630
228 Ga0207687_10040987 3300025927 Bacteria 3177
229 Ga0207687_10864709 3300025927 Bacteria 773
230 Ga0207644_10169891 3300025931 Bacteria 1701
231 Ga0207644_10215830 3300025931 Bacteria 1518
232 Ga0207690_10131569 3300025932 Bacteria 1832
233 Ga0207706_10040610 3300025933 Bacteria 4123
234 Ga0207706_10427505 3300025933 Bacteria 1147
235 Ga0207686_10035053 3300025934 Bacteria 3009
236 Ga0207686_10585343 3300025934 Bacteria 876
237 Ga0207709_10023329 3300025935 Bacteria 3520
238 Ga0207709_10345599 3300025935 Bacteria 1121
239 Ga0207670_10081249 3300025936 Bacteria 2268
240 Ga0207669_10113705 3300025937 Bacteria 1820
241 Ga0207669_11098115 3300025937 Bacteria 671
242 Ga0207704_10383978 3300025938 Bacteria 1103
243 Ga0207704_11269239 3300025938 Bacteria 629
244 Ga0207691_10098830 3300025940 Bacteria 2606
245 Ga0207691_10102600 3300025940 Bacteria 2551
246 Ga0207691_10159106 3300025940 Bacteria 1982
247 Ga0207691_10826767 3300025940 Bacteria 777
248 Ga0207691_11635999 3300025940 Bacteria 523
249 Ga0207711_10036392 3300025941 Bacteria 4177
250 Ga0207711_10084301 3300025941 Bacteria 2781
251 Ga0207711_11026244 3300025941 Bacteria 765
252 Ga0207679_10118457 3300025945 Bacteria 2103
253 Ga0207679_11428077 3300025945 Bacteria 635
254 Ga0207679_11661134 3300025945 Bacteria 585
255 Ga0207651_10184779 3300025960 Bacteria 1657
256 Ga0207651_10348948 3300025960 Bacteria 1245
257 Ga0207651_10480784 3300025960 Bacteria 1070
258 Ga0207712_10668653 3300025961 Bacteria 904
259 Ga0207668_10247374 3300025972 Bacteria 1446
260 Ga0207668_10412061 3300025972 Bacteria 1145
261 Ga0207640_10297567 3300025981 Bacteria 1275
262 Ga0207640_11302048 3300025981 Bacteria 649
263 Ga0207658_10111505 3300025986 Bacteria 2163
264 Ga0207658_10512914 3300025986 Bacteria 1069
265 Ga0207658_10887807 3300025986 Bacteria 811
266 Ga0207677_10871001 3300026023 Bacteria 810
267 Ga0207677_11086941 3300026023 Bacteria 729
268 Ga0207703_10004460 3300026035 Bacteria 11495
269 Ga0207703_10708778 3300026035 Bacteria 957
270 Ga0207639_10751469 3300026041 Bacteria 907
271 Ga0207639_10985305 3300026041 Bacteria 789
272 Ga0207708_10058202 3300026075 Bacteria 2949
273 Ga0207641_10809908 3300026088 Bacteria 927
274 Ga0207648_10155374 3300026089 Bacteria 2019
275 Ga0207648_10227803 3300026089 Bacteria 1657
276 Ga0207648_10416894 3300026089 Bacteria 1219
277 Ga0207648_11211707 3300026089 Bacteria 709
278 Ga0207648_12223045 3300026089 Bacteria 509
279 Ga0207676_10194062 3300026095 Bacteria 1789
280 Ga0207676_11778900 3300026095 Bacteria 615
281 Ga0207674_10356866 3300026116 Bacteria 1413
282 Ga0207674_11061903 3300026116 Bacteria 779
283 Ga0207675_100085009 3300026118 Bacteria 2969
284 Ga0207683_10266183 3300026121 Bacteria 1565
285 Ga0207683_10337748 3300026121 Bacteria 1381
286 Ga0207698_10252123 3300026142 Bacteria 1616
287 Ga0207698_10283718 3300026142 Bacteria 1533
288 Ga0268266_10249610 3300028379 Bacteria 1641
289 Ga0268266_10324685 3300028379 Bacteria 1441
290 Ga0268265_10275876 3300028380 Bacteria 1502
291 Ga0268264_10512376 3300028381 Bacteria 1171
292 Ga0265334_10014225 3300028573 Bacteria 3317
293 Ga0265318_10319914 3300028577 Bacteria 566
294 Ga0265336_10000006 3300028666 Bacteria 348453
295 Ga0307517_10284267 3300028786 Bacteria 940
296 Ga0307515_10003671 3300028794 Bacteria 32237
297 Ga0307515_10166905 3300028794 Bacteria 2214
298 Ga0307515_10199512 3300028794 Bacteria 1881
299 Ga0307515_10200464 3300028794 Bacteria 1873
300 Ga0307515_10206508 3300028794 Bacteria 1822
301 Ga0307515_10282512 3300028794 Bacteria 1365
302 Ga0307515_10882951 3300028794 Bacteria 523
303 Ga0265324_10003162 3300029957 Bacteria 7984
304 Ga0307512_10015452 3300030522 Bacteria 7076
305 Ga0314311_1090374 3300030733 Bacteria 1716
306 Ga0265320_10290291 3300031240 Bacteria 724
307 Ga0307513_10073615 3300031456 Bacteria 3556
308 Ga0307513_10156368 3300031456 Bacteria 2179
309 Ga0307513_10343959 3300031456 Bacteria 1241
310 Ga0307513_10507069 3300031456 Bacteria 923
311 Ga0307513_10781900 3300031456 Bacteria 660
312 Ga0307509_10082672 3300031507 Bacteria 3312
313 Ga0307509_10122533 3300031507 Bacteria 2574
314 Ga0307509_10127869 3300031507 Bacteria 2503
315 Ga0307509_10183336 3300031507 Bacteria 1955
316 Ga0307509_10737402 3300031507 Bacteria 651
317 Ga0307408_100001047 3300031548 Bacteria 21244
318 Ga0307408_100083169 3300031548 Bacteria 2398
319 Ga0307408_100158568 3300031548 Bacteria 1795
320 Ga0307408_100229184 3300031548 Bacteria 1520
321 Ga0307408_100289001 3300031548 Bacteria 1368
322 Ga0307408_100686312 3300031548 Bacteria 919
323 Ga0307408_100828203 3300031548 Bacteria 842
324 Ga0307408_101293787 3300031548 Bacteria 683
325 Ga0307508_10064103 3300031616 Bacteria 3240
326 Ga0307508_10097761 3300031616 Bacteria 2528
327 Ga0307508_10175240 3300031616 Bacteria 1747
328 Ga0307508_10388875 3300031616 Bacteria 986
329 Ga0307508_10416531 3300031616 Bacteria 935
330 Ga0307514_10069507 3300031649 Bacteria 2649
331 Ga0307516_10058042 3300031730 Bacteria 3769
332 Ga0307516_10128479 3300031730 Bacteria 2316
333 Ga0307516_10250682 3300031730 Bacteria 1465
334 Ga0307405_10046980 3300031731 Bacteria 2656
335 Ga0307405_10125326 3300031731 Bacteria 1765
336 Ga0307405_10356802 3300031731 Bacteria 1130
337 Ga0307405_12086438 3300031731 Bacteria 508
338 Ga0307413_11482790 3300031824 Bacteria 599
339 Ga0307410_10498827 3300031852 Bacteria 1001
340 Ga0307410_10586014 3300031852 Bacteria 928
341 Ga0307406_10151967 3300031901 Bacteria 1653
342 Ga0307406_10752130 3300031901 Bacteria 818
343 Ga0307407_10324478 3300031903 Bacteria 1082
344 Ga0307412_10113269 3300031911 Bacteria 1940
345 Ga0307412_10193752 3300031911 Bacteria 1538
346 Ga0307412_10389253 3300031911 Bacteria 1131
347 Ga0307412_11226751 3300031911 Bacteria 672
348 Ga0307409_100074312 3300031995 Bacteria 2716
349 Ga0307409_100266847 3300031995 Bacteria 1574
350 Ga0307409_102683068 3300031995 Bacteria 526
351 Ga0307416_100147342 3300032002 Bacteria 2152
352 Ga0307416_100809535 3300032002 Bacteria 1033
353 Ga0307416_101291962 3300032002 Bacteria 835
354 Ga0307414_10556706 3300032004 Bacteria 1023
355 Ga0307414_10751368 3300032004 Bacteria 886
356 Ga0307414_11467590 3300032004 Bacteria 634
357 Ga0307411_10066054 3300032005 Bacteria 2429
358 Ga0307411_10300023 3300032005 Bacteria 1288
359 Ga0307411_12233422 3300032005 Bacteria 513
360 Ga0307507_10126126 3300033179 Bacteria 2024
361 Ga0307507_10316089 3300033179 Bacteria 944
362 Ga0307510_10003340 3300033180 Bacteria 18697
363 Ga0307510_10543701 3300033180 Bacteria 607
364 Ga0373958_0115007 3300034819 Bacteria 644
365 Ga0373934_0044530 3300035086 Bacteria 1754
366 Ga0373939_0042018 3300035114 Bacteria 1380
367 Ga0373957_0377213 3300035120 Bacteria 608
368 Ga0373955_0114941 3300035172 Bacteria 1559
369 Ga0373942_0034283 3300035207 Bacteria 1357
370 Ga0373931_0026307 3300035691 Bacteria 2960
371 Ga0373937_0684649 3300036401 Bacteria 972
372 Ga0373925_0506720 3300037068 Bacteria 991
373 Ga0395898_1184513 3300037466 Bacteria 695
374 Ga0395905_0037244 3300037471 Bacteria 4568
375 Ga0395905_0062435 3300037471 Bacteria 3485
376 Ga0395905_0125033 3300037471 Bacteria 2418
377 Ga0395901_0079485 3300038443 Bacteria 3425
378 Ga0395901_1385930 3300038443 Bacteria 662
379 Ga0439436_0000043 3300041404 Bacteria 37576
380 Ga0439436_0004287 3300041404 Bacteria 4369
381 Ga0439436_0188709 3300041404 Bacteria 588
382 Ga0439439_0000035 3300041406 Bacteria 17803
383 Ga0439439_0027027 3300041406 Bacteria 1448
384 Ga0439439_0038829 3300041406 Bacteria 1229
385 Ga0439447_005094 3300041407 Bacteria 4415
386 Ga0439447_041765 3300041407 Bacteria 1115
387 Ga0439453_0010091 3300041408 Bacteria 1550
388 Ga0439453_0033126 3300041408 Bacteria 986
389 Ga0439461_0011163 3300041410 Bacteria 1662
390 Ga0439466_0008522 3300041411 Bacteria 3865
391 Ga0439466_0026832 3300041411 Bacteria 1999
392 Ga0439465_0189458 3300041413 Bacteria 746
393 Ga0451787_665265 3300041441 Bacteria 571
394 Ga0451795_0512318 3300041456 Bacteria 612
395 Ga0451800_0754544 3300041459 Bacteria 625
396 Ga0451837_1410426 3300041494 Bacteria 569
397 Ga0451839_1186745 3300041496 Bacteria 664
398 Ga0451847_0978295 3300041503 Bacteria 785
399 Ga0451851_0007257 3300041507 Bacteria 1445
400 Ga0451843_1434249 3300041509 Bacteria 1284
401 Ga0451843_1606693 3300041509 Bacteria 729
402 Ga0451853_2442688 3300041512 Bacteria 954
403 Ga0451853_2808455 3300041512 Bacteria 1498
404 Ga0439431_0001334 3300041997 Bacteria 5432
405 Ga0439431_0010556 3300041997 Bacteria 2097
406 Ga0439433_0008328 3300041999 Bacteria 2247
407 Ga0439433_0024480 3300041999 Bacteria 1360
408 Ga0439433_0123984 3300041999 Bacteria 653
409 Ga0439442_008577 3300042002 Bacteria 2062
410 Ga0439442_013748 3300042002 Bacteria 1662
411 Ga0439445_0006531 3300042004 Bacteria 2682
412 Ga0439445_0010839 3300042004 Bacteria 2164
413 Ga0439445_0041322 3300042004 Bacteria 1226
414 Ga0439448_0043290 3300042005 Bacteria 1461
415 Ga0439432_000520 3300042006 Bacteria 14325
416 Ga0439432_012527 3300042006 Bacteria 2899
417 Ga0439432_022345 3300042006 Bacteria 2089
418 Ga0439449_0006369 3300042007 Bacteria 4512
419 Ga0439449_0010910 3300042007 Bacteria 3428
420 Ga0439449_0021148 3300042007 Bacteria 2436
421 Ga0439450_047768 3300042008 Bacteria 1010
422 Ga0439452_015661 3300042010 Bacteria 2074
423 Ga0439452_016047 3300042010 Bacteria 2040
424 Ga0439452_036412 3300042010 Bacteria 1179
425 Ga0439454_091594 3300042011 Bacteria 563
426 Ga0439455_0000557 3300042012 Bacteria 5292
427 Ga0439455_0003086 3300042012 Bacteria 3131
428 Ga0439455_0033793 3300042012 Bacteria 1284
429 Ga0439456_026786 3300042013 Bacteria 1227
430 Ga0439457_007821 3300042014 Bacteria 2550
431 Ga0439457_012826 3300042014 Bacteria 1886
432 Ga0439462_0000020 3300042015 Bacteria 28308
433 Ga0439462_0001852 3300042015 Bacteria 4801
434 Ga0439462_0009979 3300042015 Bacteria 2404
435 Ga0450911_000280 3300042115 Bacteria 18782
436 Ga0450911_000830 3300042115 Bacteria 8441
437 Ga0450911_001518 3300042115 Bacteria 5269
438 Ga0450921_001370 3300042123 Bacteria 1454
439 Ga0450923_003649 3300042125 Bacteria 2348
440 Ga0450923_005092 3300042125 Bacteria 2104
441 Ga0450923_154566 3300042125 Bacteria 556
442 Ga0450897_000062 3300042128 Bacteria 4845
443 Ga0450897_000550 3300042128 Bacteria 2133
444 Ga0450894_029696 3300042131 Bacteria 759
445 Ga0450894_048750 3300042131 Bacteria 620
446 Ga0450896_009988 3300042133 Bacteria 1328
447 Ga0450898_000730 3300042134 Bacteria 4003
448 Ga0450899_001186 3300042135 Bacteria 2961
449 Ga0450906_002494 3300042145 Bacteria 4027
450 Ga0439446_0001688 3300042156 Bacteria 5118
451 Ga0439446_0023864 3300042156 Bacteria 1742
452 Ga0439446_0111137 3300042156 Bacteria 874
453 Ga0439458_0004980 3300042157 Bacteria 3008
454 Ga0439458_0006192 3300042157 Bacteria 2669
455 Ga0439458_0107720 3300042157 Bacteria 727
456 Ga0450908_002325 3300042184 Bacteria 3721
457 Ga0450909_001604 3300042185 Bacteria 3156
458 Ga0439434_0004227 3300042435 Bacteria 4196
459 Ga0439434_0012830 3300042435 Bacteria 2483
460 Ga0439459_0042383 3300042438 Bacteria 972
461 Ga0450893_0145066 3300042532 Bacteria 509
462 Ga0451577_0008226 3300042876 Bacteria 10168
463 Ga0451577_0065106 3300042876 Bacteria 3250
464 Ga0451577_0202224 3300042876 Bacteria 1793
465 Ga0451577_1101235 3300042876 Bacteria 711
466 Ga0466969_0017439 3300044656 Bacteria 3748
467 Ga0466969_0019757 3300044656 Bacteria 3495
468 Ga0466969_0030042 3300044656 Bacteria 2770
469 Ga0466965_0014248 3300044683 Bacteria 3762
470 Ga0466965_0020862 3300044683 Bacteria 3153
471 Ga0466965_0029391 3300044683 Bacteria 2674
472 Ga0466965_0060674 3300044683 Bacteria 1889
473 Ga0466965_0161920 3300044683 Bacteria 1173
474 Ga0466965_0196570 3300044683 Bacteria 1068
475 Ga0466966_0004271 3300044684 Bacteria 9422
476 Ga0466966_0008304 3300044684 Bacteria 6881
477 Ga0466966_0025424 3300044684 Bacteria 3867
478 Ga0466966_0130303 3300044684 Bacteria 1540
479 Ga0466961_0000979 3300044693 Bacteria 17710
480 Ga0466961_0034446 3300044693 Bacteria 3251
481 Ga0466961_0058356 3300044693 Bacteria 2455
482 Ga0466963_0050269 3300044694 Bacteria 2759
483 Ga0466963_0074255 3300044694 Bacteria 2293
484 Ga0466963_0640111 3300044694 Bacteria 750
485 Ga0466964_0013658 3300044706 Bacteria 3081
486 Ga0466964_0044283 3300044706 Bacteria 1807
487 Ga0466964_0206096 3300044706 Bacteria 947
488 Ga0453684_0064576 3300044712 Bacteria 4675
489 Ga0466971_0000335 3300044719 Bacteria 18017
490 Ga0466971_0002764 3300044719 Bacteria 7416
491 Ga0466971_0006673 3300044719 Bacteria 5022
492 Ga0466971_0062521 3300044719 Bacteria 1684
493 Ga0466971_0163138 3300044719 Bacteria 1043
494 Ga0466968_0061079 3300044735 Bacteria 1625
495 Ga0466970_0014347 3300044765 Bacteria 4067
496 Ga0466957_0038275 3300044842 Bacteria 2889
497 Ga0466957_0046677 3300044842 Bacteria 2630
498 Ga0466957_0319934 3300044842 Bacteria 1046
499 Ga0466959_0002493 3300045049 Bacteria 11790
500 Ga0466959_0022822 3300045049 Bacteria 4625
501 Ga0466959_0053088 3300045049 Bacteria 2964
502 Ga0466959_0076327 3300045049 Bacteria 2419
503 Ga0466959_0167438 3300045049 Bacteria 1542
504 Ga0466959_0598844 3300045049 Bacteria 741
505 Ga0451576_0027141 3300045051 Bacteria 6153
506 Ga0466958_0025776 3300045836 Bacteria 3469
507 Ga0466958_0052879 3300045836 Bacteria 2462
508 Ga0466958_0262492 3300045836 Bacteria 1105
509 Ga0466958_0318404 3300045836 Bacteria 999
510 Ga0466967_0038283 3300045976 Bacteria 4111
511 Ga0466967_0091108 3300045976 Bacteria 2770
512 Ga0466967_0177404 3300045976 Bacteria 2007
513 Ga0495617_170558 3300046452 Bacteria 687
514 Ga0495590_0301086 3300046457 Bacteria 603
515 Ga0495629_1151750 3300046459 Bacteria 500
516 Ga0495638_0039495 3300046460 Bacteria 2996
517 Ga0495639_0025823 3300046475 Bacteria 2592
518 Ga0495594_0626206 3300046499 Bacteria 610
519 Ga0495607_0175911 3300046501 Bacteria 1077
520 Ga0495583_0115334 3300046506 Bacteria 1135
521 Ga0495606_0058619 3300046507 Bacteria 2474
522 Ga0495606_0110403 3300046507 Bacteria 1660
523 Ga0495630_0380212 3300046517 Bacteria 1082
524 Ga0495632_0125806 3300046519 Bacteria 1195
525 Ga0495632_0128352 3300046519 Bacteria 1181
526 Ga0495632_0179485 3300046519 Bacteria 970
527 Ga0495632_0185489 3300046519 Bacteria 952
528 Ga0495632_0293037 3300046519 Bacteria 723
529 Ga0495637_0139220 3300046520 Bacteria 922
530 Ga0495643_0030394 3300046522 Bacteria 3016
531 Ga0495643_0223010 3300046522 Bacteria 893
532 Ga0495648_0292225 3300046524 Bacteria 767
533 Ga0495648_0327948 3300046524 Bacteria 707
534 Ga0495642_0030180 3300046528 Bacteria 2168
535 Ga0495586_0194776 3300046535 Bacteria 1148
536 Ga0495598_0071776 3300046537 Bacteria 1092
537 Ga0495598_0239822 3300046537 Bacteria 668
538 Ga0495621_0011063 3300046539 Bacteria 2780
539 Ga0495597_0080860 3300046542 Bacteria 1390
540 Ga0495597_0283773 3300046542 Bacteria 645
541 Ga0495633_0253386 3300046558 Bacteria 803
542 Ga0495656_0449749 3300046615 Bacteria 678
543 Ga0495668_0488011 3300046616 Bacteria 679
544 Ga0495625_0068634 3300046660 Bacteria 2492
545 Ga0495635_0163384 3300046663 Bacteria 1515
546 Ga0495624_0538358 3300046690 Bacteria 698
547 Ga0495670_0516160 3300046691 Bacteria 649
548 Ga0495670_0766021 3300046691 Bacteria 526
549 Ga0495671_0020739 3300046692 Bacteria 3461
550 Ga0495671_0203959 3300046692 Bacteria 959
551 Ga0495600_0874320 3300046809 Bacteria 532
552 Ga0495676_0275359 3300047321 Bacteria 1141
553 Ga0495683_0325848 3300047323 Bacteria 654
554 Ga0495687_002270 3300047443 Bacteria 15752
555 Ga0495686_0002484 3300047472 Bacteria 17360
556 Ga0495686_0058745 3300047472 Bacteria 2396
557 Ga0495615_0102559 3300048090 Bacteria 810
558 Ga0496100_0071180 3300048903 Bacteria 2321
559 Ga0496100_0320809 3300048903 Bacteria 1164
560 Ga0496100_0575825 3300048903 Bacteria 873
561 Ga0496100_0649603 3300048903 Bacteria 821
562 Ga0496101_0059651 3300048904 Bacteria 2766
563 Ga0496101_0343268 3300048904 Bacteria 1173
564 Ga0496102_1130961 3300048905 Bacteria 703
565 Ga0496104_0458858 3300048907 Bacteria 1186
566 Ga0496105_0578800 3300048908 Bacteria 874
567 Ga0496106_0176969 3300048909 Bacteria 1693
568 Ga0496106_0339033 3300048909 Bacteria 1207
569 Ga0496108_0097460 3300048911 Bacteria 2506
570 Ga0496108_0130492 3300048911 Bacteria 2160
571 Ga0496109_0223515 3300048912 Bacteria 1771
572 Ga0496109_0397866 3300048912 Bacteria 1301
573 Ga0496109_1800067 3300048912 Bacteria 545
574 Ga0496109_1990898 3300048912 Bacteria 513
575 Ga0496110_0083293 3300048913 Bacteria 2853
576 Ga0496110_0201247 3300048913 Bacteria 1810
577 Ga0496110_0421871 3300048913 Bacteria 1216
578 Ga0496110_1745848 3300048913 Bacteria 532
579 Ga0496111_0089675 3300048914 Bacteria 2252
580 Ga0496111_0184369 3300048914 Bacteria 1552
581 Ga0496111_1210948 3300048914 Bacteria 535
582 Ga0496113_0235263 3300048916 Bacteria 1461
583 Ga0496114_0081600 3300048917 Bacteria 2732
584 Ga0496114_0096630 3300048917 Bacteria 2515
585 Ga0496114_0109017 3300048917 Bacteria 2371
586 Ga0496114_1154491 3300048917 Bacteria 660
587 Ga0496114_1566186 3300048917 Bacteria 547
588 Ga0496117_0195593 3300048920 Bacteria 1147
589 Ga0496118_0021039 3300048921 Bacteria 5759
590 Ga0496121_0000511 3300048924 Bacteria 73863
591 Ga0496121_0073038 3300048924 Bacteria 2751
592 Ga0496121_0331113 3300048924 Bacteria 1021
593 Ga0496122_0055115 3300048925 Bacteria 2978
594 Ga0496123_0334416 3300048926 Bacteria 710
595 Ga0496124_0060364 3300048927 Bacteria 3181
596 Ga0496124_0379014 3300048927 Bacteria 990
597 Ga0496124_0477120 3300048927 Bacteria 843
598 Ga0496124_0799928 3300048927 Bacteria 584
599 Ga0496125_0072044 3300048928 Bacteria 2695
600 Ga0496125_0105458 3300048928 Bacteria 2060
601 Ga0496125_0128765 3300048928 Bacteria 1787
602 Ga0496126_0092457 3300048929 Bacteria 2658
603 Ga0496126_0877010 3300048929 Bacteria 682
604 Ga0501031_0252999 3300049568 Bacteria 1145
605 Ga0501032_0194413 3300049569 Bacteria 1325
606 Ga0501033_0087510 3300049570 Bacteria 2280
607 Ga0501033_0464297 3300049570 Bacteria 878
608 Ga0501034_0078923 3300049571 Bacteria 3295
609 Ga0501034_0334281 3300049571 Bacteria 1446
610 Ga0501036_0091046 3300049572 Bacteria 2576
611 Ga0501036_0207212 3300049572 Bacteria 1648
612 Ga0501037_0064125 3300049573 Bacteria 2678
613 Ga0501037_0067068 3300049573 Bacteria 2613
614 Ga0501038_0097241 3300049574 Bacteria 2456
615 Ga0501038_0100722 3300049574 Bacteria 2406
616 Ga0501039_0530717 3300049575 Bacteria 924
617 Ga0501039_0678080 3300049575 Bacteria 806
618 Ga0501040_0084457 3300049576 Bacteria 2202
619 Ga0501041_0049387 3300049577 Bacteria 2562
620 Ga0501042_0048467 3300049578 Bacteria 3029
621 Ga0501043_0104569 3300049579 Bacteria 2225
622 Ga0501043_0239010 3300049579 Bacteria 1401
623 Ga0501043_0445984 3300049579 Bacteria 973
624 Ga0501046_0068610 3300049580 Bacteria 2759
625 Ga0501046_0084354 3300049580 Bacteria 2450
626 Ga0501047_0033898 3300049581 Bacteria 4928
627 Ga0501047_0451774 3300049581 Bacteria 1114
628 Ga0501048_0080794 3300049582 Bacteria 2293
629 Ga0501068_0064878 3300049584 Bacteria 2222
630 Ga0501070_0468497 3300049586 Bacteria 1014
631 Ga0501071_0063961 3300049587 Bacteria 2668
632 Ga0501071_0696146 3300049587 Bacteria 782
633 Ga0501072_0052949 3300049588 Bacteria 3195
634 Ga0501072_1075035 3300049588 Bacteria 626
635 Ga0501073_0091867 3300049589 Bacteria 2110
636 Ga0501074_0027649 3300049590 Bacteria 4113
637 Ga0501074_0070572 3300049590 Bacteria 2511
638 Ga0501074_0447901 3300049590 Bacteria 915
639 Ga0501075_0053625 3300049591 Bacteria 3032
640 Ga0501075_0751082 3300049591 Bacteria 742
641 Ga0501076_0018897 3300049592 Bacteria 5259
642 Ga0501076_0591785 3300049592 Bacteria 915
643 Ga0501076_0601072 3300049592 Bacteria 907
644 Ga0501077_0219213 3300049593 Bacteria 1209
645 Ga0501209_118415 3300049656 Bacteria 785
646 Ga0501222_000134 3300049662 Bacteria 15759
647 Ga0501222_002295 3300049662 Bacteria 2657
648 Ga0501224_019611 3300049664 Bacteria 1007
649 Ga0501236_016887 3300049670 Bacteria 1038
650 Ga0501079_0058340 3300049741 Bacteria 2978
651 Ga0501079_0508863 3300049741 Bacteria 947
652 Ga0501080_0031582 3300049742 Bacteria 4935
653 Ga0501080_0117583 3300049742 Bacteria 2464
654 Ga0501080_0651334 3300049742 Bacteria 932
655 Ga0501081_0098426 3300049743 Bacteria 2065
656 Ga0501081_0399823 3300049743 Bacteria 1017
657 Ga0501280_003237 3300049776 Bacteria 2535
658 Ga0501035_0030692 3300049822 Bacteria 4899
659 Ga0501035_0121027 3300049822 Bacteria 2288
660 Ga0501035_0129327 3300049822 Bacteria 2202
661 Ga0501035_0441722 3300049822 Bacteria 1077
662 Ga0501035_0882558 3300049822 Bacteria 709
663 Ga0501035_1523998 3300049822 Bacteria 509
664 Ga0501035_1570202 3300049822 Bacteria 500
665 Ga0501044_0051224 3300049823 Bacteria 4257
666 Ga0501044_0193581 3300049823 Bacteria 1995
667 Ga0501045_0077888 3300049824 Bacteria 2443
668 nmdc:mga03683_34760_c1 3300050489 Bacteria 2041
669 nmdc:mga03683_94754_c1 3300050489 Bacteria 988
670 nmdc:mga03n38_17609_c1 3300050490 Bacteria 2802
671 nmdc:mga03n38_510677_c1 3300050490 Bacteria 675
672 nmdc:mga0yw44_1093028_c1 3300050492 Bacteria 539
673 nmdc:mga0k408_10735_c1 3300050493 Bacteria 4962
674 nmdc:mga0k408_198489_c2 3300050493 Bacteria 805
675 nmdc:mga0k408_28881_c1 3300050493 Bacteria 3154
676 nmdc:mga0k408_354632_c1 3300050493 Bacteria 874
677 nmdc:mga0k408_42914_c1 3300050493 Bacteria 2605
678 nmdc:mga0k408_46174_c1 3300050493 Bacteria 2515
679 nmdc:mga0k408_47758_c1 3300050493 Bacteria 2475
680 nmdc:mga0k408_47821_c1 3300050493 Bacteria 1804
681 nmdc:mga0k408_639380_c1 3300050493 Bacteria 626
682 nmdc:mga0k408_76217_c1 3300050493 Bacteria 1960
683 nmdc:mga0k408_918_c1 3300050493 Bacteria 16117
684 nmdc:mga06z11_235306_c1 3300050494 Bacteria 1074
685 nmdc:mga06z11_26263_c1 3300050494 Bacteria 2769
686 nmdc:mga04h51_300577_c1 3300050495 Bacteria 654
687 nmdc:mga07m45_167870_c1 3300050496 Bacteria 1275
688 nmdc:mga07m45_268171_c1 3300050496 Bacteria 696
689 nmdc:mga07m45_268822_c1 3300050496 Bacteria 992
690 nmdc:mga07m45_300616_c1 3300050496 Bacteria 933
691 nmdc:mga07m45_3072_c1 3300050496 Bacteria 3851
692 nmdc:mga07m45_319284_c1 3300050496 Bacteria 903
693 nmdc:mga07m45_33231_c1 3300050496 Bacteria 2864
694 nmdc:mga07m45_34085_c1 3300050496 Bacteria 2829
695 nmdc:mga07m45_596216_c1 3300050496 Bacteria 638
696 nmdc:mga07m45_59986_c1 3300050496 Bacteria 2153
697 nmdc:mga09592_1364912_c1 3300050508 Bacteria 581
698 nmdc:mga0sz30_17261_c1 3300050516 Bacteria 2876
699 nmdc:mga0sz30_9364_c1 3300050516 Bacteria 3725
700 Ga0500610_0082835 3300053079 Bacteria 1671
701 Ga0495619_0969211 3300053085 Bacteria 570
702 Ga0500644_0014842 3300053088 Bacteria 2207
703 Ga0500646_0030728 3300053090 Bacteria 1475
704 Ga0500646_0174304 3300053090 Bacteria 725
705 Ga0500651_0042839 3300053093 Bacteria 2852
706 Ga0500641_0252725 3300053096 Bacteria 738
707 Ga0500556_0007854 3300053104 Bacteria 3059
708 Ga0500556_0231114 3300053104 Bacteria 729
709 Ga0500560_038412 3300053107 Bacteria 1489
710 Ga0500658_0034103 3300053134 Bacteria 2006
711 Ga0500559_0033524 3300053136 Bacteria 2211
712 Ga0500588_0401495 3300053146 Bacteria 522
713 Ga0500589_008173 3300053147 Bacteria 4339
714 Ga0500627_0023198 3300053158 Bacteria 2527
715 Ga0500634_0022344 3300053161 Bacteria 3432
716 Ga0500587_080980 3300053739 Bacteria 523
717 Ga0501084_0100683 3300054114 Bacteria 2426
718 Ga0501084_0457821 3300054114 Bacteria 1078
719 Ga0590077_126218 3300059426 Bacteria 606
720 Ga0501082_0100045 3300060353 Bacteria 2507
721 Ga0466962_0000469 3300061719 Bacteria 17542
722 Ga0466962_0031995 3300061719 Bacteria 2518
723 Ga0466962_0053909 3300061719 Bacteria 1921
724 Ga0466962_0179994 3300061719 Bacteria 1030
725 Ga0466962_0230735 3300061719 Bacteria 907
726 Ga0466962_0330947 3300061719 Bacteria 756
727 Ga0530510_0051808 3300061734 Bacteria 2966
728 2513230338 2513020051 Bacteria 6053213
729 2928120917 2928115317 Bacteria 6477646
730 Ga0307411_10046050
731 JGI24735J21928_10012629
732 JGI24744J21845_10001040
733 JGI24744J21845_10095367
734 JGI25156J39149_1007078
735 JGI25154J39366_1003779
736 JGI25157J39369_1003744
737 JGI25153J46596_10021332
738 rootH1_10011074
739 rootH1_10012705
740 rootH1_10051619
741 rootL2_10055089
742 rootL2_10057448
743 rootH1_10016840
744 rootH1_10050138
745 rootH1_10259278
746 rootH1_10338839
747 Ga0006562J51391_1069309
748 Ga0055539_1002263
749 Ga0055524_1012854
750 Ga0055536_1016264
751 Ga0055536_1035256
752 Ga0055530_10101420
753 Ga0055540_1077716
754 Ga0055531_10006120
755 Ga0065165_1043296
756 Ga0065714_10121429
757 Ga0065714_10509287
758 Ga0065704_10319710
759 Ga0065707_10086369
760 Ga0065707_10104090
761 Ga0070676_10742861
762 Ga0070670_100070726
763 Ga0070670_100968967
764 Ga0070677_10029320
765 Ga0070666_11352722
766 Ga0068868_101711835
767 Ga0070689_100281445
768 Ga0070668_100218806
769 Ga0070669_100064927
770 Ga0070669_101360296
771 Ga0070675_100045462
772 Ga0070675_100756087
773 Ga0070671_100063526
774 Ga0070671_100315529
775 Ga0070674_100209027
776 Ga0070674_100313122
777 Ga0070674_100633786
778 Ga0070674_101304079
779 Ga0070673_100086543
780 Ga0070673_100200779
781 Ga0070673_100340736
782 Ga0070673_100769442
783 Ga0070667_100198901
784 Ga0070667_100204096
785 Ga0070667_100656575
786 Ga0070678_100233521
787 Ga0070678_100339654
788 Ga0070678_100808758
789 Ga0070678_101115710
790 Ga0070662_100062128
791 Ga0068867_100214575
792 Ga0068867_100811547
793 Ga0070699_100177401
794 Ga0068853_100247874
795 Ga0068853_100595658
796 Ga0068853_101124361
797 Ga0070672_100188094
798 Ga0070672_100194539
799 Ga0070672_100380333
800 Ga0070672_101408048
801 Ga0070672_101492158
802 Ga0070686_100707555
803 Ga0070665_100401328
804 Ga0070665_100987632
805 Ga0070704_100423008
806 Ga0068854_100114367
807 Ga0068854_100956400
808 Ga0068854_102083168
809 Ga0068856_100070354
810 Ga0068852_100323309
811 Ga0068852_100984746
812 Ga0068852_101942181
813 Ga0068864_100847421
814 Ga0068864_100905169
815 Ga0068866_10831251
816 Ga0068861_100365165
817 Ga0068851_10148475
818 Ga0068870_10078164
819 Ga0068863_100316404
820 Ga0068860_100827139
821 Ga0068860_101144364
822 Ga0068860_102347117
823 Ga0068862_100139149
824 Ga0081455_10092946
825 Ga0075363_100357684
826 Ga0075432_10469770
827 Ga0075362_10113065
828 Ga0075367_10127737
829 Ga0075367_10181851
830 Ga0075367_10267368
831 Ga0075369_10137211
832 Ga0075369_10192156
833 Ga0075366_10029676
834 Ga0075366_10036861
835 Ga0075366_10048530
836 Ga0075366_10052932
837 Ga0075366_10062290
838 Ga0075366_10342389
839 Ga0075366_10383424
840 Ga0097621_100150392
841 Ga0097621_100537328
842 Ga0097621_101293220
843 Ga0075370_10002098
844 Ga0075370_10104141
845 Ga0075370_10125136
846 Ga0075370_10139598
847 Ga0075370_10153183
848 Ga0075370_10202612
849 Ga0075370_10319571
850 Ga0075370_10347813
851 Ga0075370_10430108
852 Ga0068871_100032996
853 Ga0068871_100146082
854 Ga0068871_100698768
855 Ga0068871_101604171
856 Ga0075428_100098258
857 Ga0075428_100244642
858 Ga0075429_100541931
859 Ga0068865_100030090
860 Ga0068865_100371563
861 Ga0068865_100472040
862 Ga0068865_101383154
863 Ga0099826_10105176
864 Ga0105245_10183328
865 Ga0105245_10895121
866 Ga0114129_11311227
867 Ga0105243_10032599
868 Ga0105242_10042038
869 Ga0105248_10003485
870 Ga0105248_10043221
871 Ga0105248_10157562
872 Ga0105248_10827480
873 Ga0105237_10046153
874 Ga0105238_10700839
875 Ga0105249_10224867
876 Ga0105249_10273915
877 Ga0105029_100524
878 Ga0157319_1000021
879 Ga0157347_1030729
880 Ga0157373_10058429
881 Ga0157370_10076897
882 Ga0157370_10338854
883 Ga0157370_10352165
884 Ga0157369_10005989
885 Ga0157369_10613795
886 Ga0157378_10866066
887 Ga0157378_10868552
888 Ga0163162_10456278
889 Ga0163162_10629736
890 Ga0163162_10745106
891 Ga0157375_10103016
892 Ga0157375_10368441
893 Ga0157375_11232773
894 Ga0157375_11652487
895 Ga0157375_12228535
896 Ga0163163_10059609
897 Ga0163163_10318463
898 Ga0157380_10065993
899 Ga0157380_10385862
900 Ga0182008_10000645
901 Ga0182008_10043413
902 Ga0182008_10102707
903 Ga0157379_10044430
904 Ga0157379_10076984
905 Ga0157379_10420323
906 Ga0157379_10538640
907 Ga0157376_10437922
908 Ga0157376_10468786
909 Ga0157376_12017734
910 Ga0182006_1043647
911 Ga0182006_1045984
912 Ga0163161_10058717
913 Ga0163161_10177080
914 Ga0163161_10203676
915 Ga0163161_10341103
916 Ga0163161_10583043
917 Ga0163161_10604999
918 Ga0209674_103160
919 Ga0207427_103813
920 Ga0209646_1001075
921 Ga0209026_1000021
922 Ga0209677_106024
923 Ga0209759_1009249
924 Ga0209130_1000858
925 Ga0209130_1013422
926 Ga0209675_1018375
927 Ga0209676_1001864
928 Ga0209676_1011015
929 Ga0209676_1017837
930 Ga0209676_1026728
931 Ga0209758_1021927
932 Ga0209050_1030065
933 Ga0209256_1000633
934 Ga0207426_1050463
935 Ga0209051_1000788
936 Ga0209257_1001611
937 Ga0209257_1001725
938 Ga0209257_1009630
939 Ga0207697_10021654
940 Ga0207682_10020538
941 Ga0207680_10196845
942 Ga0207680_10230633
943 Ga0207680_10536780
944 Ga0207680_10978859
945 Ga0207645_10596609
946 Ga0207645_10637876
947 Ga0207643_10038504
948 Ga0207684_10024482
949 Ga0207671_10028876
950 Ga0207671_10168073
951 Ga0207694_10267282
952 Ga0207650_10765880
953 Ga0207659_10061624
954 Ga0207659_10858660
955 Ga0207659_11277838
956 Ga0207687_10040987
957 Ga0207687_10864709
958 Ga0207644_10169891
959 Ga0207644_10215830
960 Ga0207690_10131569
961 Ga0207706_10040610
962 Ga0207706_10427505
963 Ga0207686_10035053
964 Ga0207686_10585343
965 Ga0207709_10023329
966 Ga0207709_10345599
967 Ga0207670_10081249
968 Ga0207669_10113705
969 Ga0207669_11098115
970 Ga0207704_10383978
971 Ga0207704_11269239
972 Ga0207691_10098830
973 Ga0207691_10102600
974 Ga0207691_10159106
975 Ga0207691_10826767
976 Ga0207691_11635999
977 Ga0207711_10036392
978 Ga0207711_10084301
979 Ga0207711_11026244
980 Ga0207679_10118457
981 Ga0207679_11428077
982 Ga0207679_11661134
983 Ga0207651_10184779
984 Ga0207651_10348948
985 Ga0207651_10480784
986 Ga0207712_10668653
987 Ga0207668_10247374
988 Ga0207668_10412061
989 Ga0207640_10297567
990 Ga0207640_11302048
991 Ga0207658_10111505
992 Ga0207658_10512914
993 Ga0207658_10887807
994 Ga0207677_10871001
995 Ga0207677_11086941
996 Ga0207703_10004460
997 Ga0207703_10708778
998 Ga0207639_10751469
999 Ga0207639_10985305
1000 Ga0207708_10058202
1001 Ga0207641_10809908
1002 Ga0207648_10155374
1003 Ga0207648_10227803
1004 Ga0207648_10416894
1005 Ga0207648_11211707
1006 Ga0207648_12223045
1007 Ga0207676_10194062
1008 Ga0207676_11778900
1009 Ga0207674_10356866
1010 Ga0207674_11061903
1011 Ga0207675_100085009
1012 Ga0207683_10266183
1013 Ga0207683_10337748
1014 Ga0207698_10252123
1015 Ga0207698_10283718
1016 Ga0268266_10249610
1017 Ga0268266_10324685
1018 Ga0268265_10275876
1019 Ga0268264_10512376
1020 Ga0265334_10014225
1021 Ga0265318_10319914
1022 Ga0265336_10000006
1023 Ga0307517_10284267
1024 Ga0307515_10003671
1025 Ga0307515_10166905
1026 Ga0307515_10199512
1027 Ga0307515_10200464
1028 Ga0307515_10206508
1029 Ga0307515_10282512
1030 Ga0307515_10882951
1031 Ga0265324_10003162
1032 Ga0307512_10015452
1033 Ga0314311_1090374
1034 Ga0265320_10290291
1035 Ga0307513_10073615
1036 Ga0307513_10156368
1037 Ga0307513_10343959
1038 Ga0307513_10507069
1039 Ga0307513_10781900
1040 Ga0307509_10082672
1041 Ga0307509_10122533
1042 Ga0307509_10127869
1043 Ga0307509_10183336
1044 Ga0307509_10737402
1045 Ga0307408_100001047
1046 Ga0307408_100083169
1047 Ga0307408_100158568
1048 Ga0307408_100229184
1049 Ga0307408_100289001
1050 Ga0307408_100686312
1051 Ga0307408_100828203
1052 Ga0307408_101293787
1053 Ga0307508_10064103
1054 Ga0307508_10097761
1055 Ga0307508_10175240
1056 Ga0307508_10388875
1057 Ga0307508_10416531
1058 Ga0307514_10069507
1059 Ga0307516_10058042
1060 Ga0307516_10128479
1061 Ga0307516_10250682
1062 Ga0307405_10046980
1063 Ga0307405_10125326
1064 Ga0307405_10356802
1065 Ga0307405_12086438
1066 Ga0307413_11482790
1067 Ga0307410_10498827
1068 Ga0307410_10586014
1069 Ga0307406_10151967
1070 Ga0307406_10752130
1071 Ga0307407_10324478
1072 Ga0307412_10113269
1073 Ga0307412_10193752
1074 Ga0307412_10389253
1075 Ga0307412_11226751
1076 Ga0307409_100074312
1077 Ga0307409_100266847
1078 Ga0307409_102683068
1079 Ga0307416_100147342
1080 Ga0307416_100809535
1081 Ga0307416_101291962
1082 Ga0307414_10556706
1083 Ga0307414_10751368
1084 Ga0307414_11467590
1085 Ga0307411_10066054
1086 Ga0307411_10300023
1087 Ga0307411_12233422
1088 Ga0307507_10126126
1089 Ga0307507_10316089
1090 Ga0307510_10003340
1091 Ga0307510_10543701
1092 Ga0373958_0115007
1093 Ga0373934_0044530
1094 Ga0373939_0042018
1095 Ga0373957_0377213
1096 Ga0373955_0114941
1097 Ga0373942_0034283
1098 Ga0373931_0026307
1099 Ga0373937_0684649
1100 Ga0373925_0506720
1101 Ga0395898_1184513
1102 Ga0395905_0037244
1103 Ga0395905_0062435
1104 Ga0395905_0125033
1105 Ga0395901_0079485
1106 Ga0395901_1385930
1107 Ga0439436_0000043
1108 Ga0439436_0004287
1109 Ga0439436_0188709
1110 Ga0439439_0000035
1111 Ga0439439_0027027
1112 Ga0439439_0038829
1113 Ga0439447_005094
1114 Ga0439447_041765
1115 Ga0439453_0010091
1116 Ga0439453_0033126
1117 Ga0439461_0011163
1118 Ga0439466_0008522
1119 Ga0439466_0026832
1120 Ga0439465_0189458
1121 Ga0451787_665265
1122 Ga0451795_0512318
1123 Ga0451800_0754544
1124 Ga0451837_1410426
1125 Ga0451839_1186745
1126 Ga0451847_0978295
1127 Ga0451851_0007257
1128 Ga0451843_1434249
1129 Ga0451843_1606693
1130 Ga0451853_2442688
1131 Ga0451853_2808455
1132 Ga0439431_0001334
1133 Ga0439431_0010556
1134 Ga0439433_0008328
1135 Ga0439433_0024480
1136 Ga0439433_0123984
1137 Ga0439442_008577
1138 Ga0439442_013748
1139 Ga0439445_0006531
1140 Ga0439445_0010839
1141 Ga0439445_0041322
1142 Ga0439448_0043290
1143 Ga0439432_000520
1144 Ga0439432_012527
1145 Ga0439432_022345
1146 Ga0439449_0006369
1147 Ga0439449_0010910
1148 Ga0439449_0021148
1149 Ga0439450_047768
1150 Ga0439452_015661
1151 Ga0439452_016047
1152 Ga0439452_036412
1153 Ga0439454_091594
1154 Ga0439455_0000557
1155 Ga0439455_0003086
1156 Ga0439455_0033793
1157 Ga0439456_026786
1158 Ga0439457_007821
1159 Ga0439457_012826
1160 Ga0439462_0000020
1161 Ga0439462_0001852
1162 Ga0439462_0009979
1163 Ga0450911_000280
1164 Ga0450911_000830
1165 Ga0450911_001518
1166 Ga0450921_001370
1167 Ga0450923_003649
1168 Ga0450923_005092
1169 Ga0450923_154566
1170 Ga0450897_000062
1171 Ga0450897_000550
1172 Ga0450894_029696
1173 Ga0450894_048750
1174 Ga0450896_009988
1175 Ga0450898_000730
1176 Ga0450899_001186
1177 Ga0450906_002494
1178 Ga0439446_0001688
1179 Ga0439446_0023864
1180 Ga0439446_0111137
1181 Ga0439458_0004980
1182 Ga0439458_0006192
1183 Ga0439458_0107720
1184 Ga0450908_002325
1185 Ga0450909_001604
1186 Ga0439434_0004227
1187 Ga0439434_0012830
1188 Ga0439459_0042383
1189 Ga0450893_0145066
1190 Ga0451577_0008226
1191 Ga0451577_0065106
1192 Ga0451577_0202224
1193 Ga0451577_1101235
1194 Ga0466969_0017439
1195 Ga0466969_0019757
1196 Ga0466969_0030042
1197 Ga0466965_0014248
1198 Ga0466965_0020862
1199 Ga0466965_0029391
1200 Ga0466965_0060674
1201 Ga0466965_0161920
1202 Ga0466965_0196570
1203 Ga0466966_0004271
1204 Ga0466966_0008304
1205 Ga0466966_0025424
1206 Ga0466966_0130303
1207 Ga0466961_0000979
1208 Ga0466961_0034446
1209 Ga0466961_0058356
1210 Ga0466963_0050269
1211 Ga0466963_0074255
1212 Ga0466963_0640111
1213 Ga0466964_0013658
1214 Ga0466964_0044283
1215 Ga0466964_0206096
1216 Ga0453684_0064576
1217 Ga0466971_0000335
1218 Ga0466971_0002764
1219 Ga0466971_0006673
1220 Ga0466971_0062521
1221 Ga0466971_0163138
1222 Ga0466968_0061079
1223 Ga0466970_0014347
1224 Ga0466957_0038275
1225 Ga0466957_0046677
1226 Ga0466957_0319934
1227 Ga0466959_0002493
1228 Ga0466959_0022822
1229 Ga0466959_0053088
1230 Ga0466959_0076327
1231 Ga0466959_0167438
1232 Ga0466959_0598844
1233 Ga0451576_0027141
1234 Ga0466958_0025776
1235 Ga0466958_0052879
1236 Ga0466958_0262492
1237 Ga0466958_0318404
1238 Ga0466967_0038283
1239 Ga0466967_0091108
1240 Ga0466967_0177404
1241 Ga0495617_170558
1242 Ga0495590_0301086
1243 Ga0495629_1151750
1244 Ga0495638_0039495
1245 Ga0495639_0025823
1246 Ga0495594_0626206
1247 Ga0495607_0175911
1248 Ga0495583_0115334
1249 Ga0495606_0058619
1250 Ga0495606_0110403
1251 Ga0495630_0380212
1252 Ga0495632_0125806
1253 Ga0495632_0128352
1254 Ga0495632_0179485
1255 Ga0495632_0185489
1256 Ga0495632_0293037
1257 Ga0495637_0139220
1258 Ga0495643_0030394
1259 Ga0495643_0223010
1260 Ga0495648_0292225
1261 Ga0495648_0327948
1262 Ga0495642_0030180
1263 Ga0495586_0194776
1264 Ga0495598_0071776
1265 Ga0495598_0239822
1266 Ga0495621_0011063
1267 Ga0495597_0080860
1268 Ga0495597_0283773
1269 Ga0495633_0253386
1270 Ga0495656_0449749
1271 Ga0495668_0488011
1272 Ga0495625_0068634
1273 Ga0495635_0163384
1274 Ga0495624_0538358
1275 Ga0495670_0516160
1276 Ga0495670_0766021
1277 Ga0495671_0020739
1278 Ga0495671_0203959
1279 Ga0495600_0874320
1280 Ga0495676_0275359
1281 Ga0495683_0325848
1282 Ga0495687_002270
1283 Ga0495686_0002484
1284 Ga0495686_0058745
1285 Ga0495615_0102559
1286 Ga0496100_0071180
1287 Ga0496100_0320809
1288 Ga0496100_0575825
1289 Ga0496100_0649603
1290 Ga0496101_0059651
1291 Ga0496101_0343268
1292 Ga0496102_1130961
1293 Ga0496104_0458858
1294 Ga0496105_0578800
1295 Ga0496106_0176969
1296 Ga0496106_0339033
1297 Ga0496108_0097460
1298 Ga0496108_0130492
1299 Ga0496109_0223515
1300 Ga0496109_0397866
1301 Ga0496109_1800067
1302 Ga0496109_1990898
1303 Ga0496110_0083293
1304 Ga0496110_0201247
1305 Ga0496110_0421871
1306 Ga0496110_1745848
1307 Ga0496111_0089675
1308 Ga0496111_0184369
1309 Ga0496111_1210948
1310 Ga0496113_0235263
1311 Ga0496114_0081600
1312 Ga0496114_0096630
1313 Ga0496114_0109017
1314 Ga0496114_1154491
1315 Ga0496114_1566186
1316 Ga0496117_0195593
1317 Ga0496118_0021039
1318 Ga0496121_0000511
1319 Ga0496121_0073038
1320 Ga0496121_0331113
1321 Ga0496122_0055115
1322 Ga0496123_0334416
1323 Ga0496124_0060364
1324 Ga0496124_0379014
1325 Ga0496124_0477120
1326 Ga0496124_0799928
1327 Ga0496125_0072044
1328 Ga0496125_0105458
1329 Ga0496125_0128765
1330 Ga0496126_0092457
1331 Ga0496126_0877010
1332 Ga0501031_0252999
1333 Ga0501032_0194413
1334 Ga0501033_0087510
1335 Ga0501033_0464297
1336 Ga0501034_0078923
1337 Ga0501034_0334281
1338 Ga0501036_0091046
1339 Ga0501036_0207212
1340 Ga0501037_0064125
1341 Ga0501037_0067068
1342 Ga0501038_0097241
1343 Ga0501038_0100722
1344 Ga0501039_0530717
1345 Ga0501039_0678080
1346 Ga0501040_0084457
1347 Ga0501041_0049387
1348 Ga0501042_0048467
1349 Ga0501043_0104569
1350 Ga0501043_0239010
1351 Ga0501043_0445984
1352 Ga0501046_0068610
1353 Ga0501046_0084354
1354 Ga0501047_0033898
1355 Ga0501047_0451774
1356 Ga0501048_0080794
1357 Ga0501068_0064878
1358 Ga0501070_0468497
1359 Ga0501071_0063961
1360 Ga0501071_0696146
1361 Ga0501072_0052949
1362 Ga0501072_1075035
1363 Ga0501073_0091867
1364 Ga0501074_0027649
1365 Ga0501074_0070572
1366 Ga0501074_0447901
1367 Ga0501075_0053625
1368 Ga0501075_0751082
1369 Ga0501076_0018897
1370 Ga0501076_0591785
1371 Ga0501076_0601072
1372 Ga0501077_0219213
1373 Ga0501209_118415
1374 Ga0501222_000134
1375 Ga0501222_002295
1376 Ga0501224_019611
1377 Ga0501236_016887
1378 Ga0501079_0058340
1379 Ga0501079_0508863
1380 Ga0501080_0031582
1381 Ga0501080_0117583
1382 Ga0501080_0651334
1383 Ga0501081_0098426
1384 Ga0501081_0399823
1385 Ga0501280_003237
1386 Ga0501035_0030692
1387 Ga0501035_0121027
1388 Ga0501035_0129327
1389 Ga0501035_0441722
1390 Ga0501035_0882558
1391 Ga0501035_1523998
1392 Ga0501035_1570202
1393 Ga0501044_0051224
1394 Ga0501044_0193581
1395 Ga0501045_0077888
1396 nmdc:mga03683_34760_c1
1397 nmdc:mga03683_94754_c1
1398 nmdc:mga03n38_17609_c1
1399 nmdc:mga03n38_510677_c1
1400 nmdc:mga0yw44_1093028_c1
1401 nmdc:mga0k408_10735_c1
1402 nmdc:mga0k408_198489_c2
1403 nmdc:mga0k408_28881_c1
1404 nmdc:mga0k408_354632_c1
1405 nmdc:mga0k408_42914_c1
1406 nmdc:mga0k408_46174_c1
1407 nmdc:mga0k408_47758_c1
1408 nmdc:mga0k408_47821_c1
1409 nmdc:mga0k408_639380_c1
1410 nmdc:mga0k408_76217_c1
1411 nmdc:mga0k408_918_c1
1412 nmdc:mga06z11_235306_c1
1413 nmdc:mga06z11_26263_c1
1414 nmdc:mga04h51_300577_c1
1415 nmdc:mga07m45_167870_c1
1416 nmdc:mga07m45_268171_c1
1417 nmdc:mga07m45_268822_c1
1418 nmdc:mga07m45_300616_c1
1419 nmdc:mga07m45_3072_c1
1420 nmdc:mga07m45_319284_c1
1421 nmdc:mga07m45_33231_c1
1422 nmdc:mga07m45_34085_c1
1423 nmdc:mga07m45_596216_c1
1424 nmdc:mga07m45_59986_c1
1425 nmdc:mga09592_1364912_c1
1426 nmdc:mga0sz30_17261_c1
1427 nmdc:mga0sz30_9364_c1
1428 Ga0500610_0082835
1429 Ga0495619_0969211
1430 Ga0500644_0014842
1431 Ga0500646_0030728
1432 Ga0500646_0174304
1433 Ga0500651_0042839
1434 Ga0500641_0252725
1435 Ga0500556_0007854
1436 Ga0500556_0231114
1437 Ga0500560_038412
1438 Ga0500658_0034103
1439 Ga0500559_0033524
1440 Ga0500588_0401495
1441 Ga0500589_008173
1442 Ga0500627_0023198
1443 Ga0500634_0022344
1444 Ga0500587_080980
1445 Ga0501084_0100683
1446 Ga0501084_0457821
1447 Ga0590077_126218
1448 Ga0501082_0100045
1449 Ga0466962_0000469
1450 Ga0466962_0031995
1451 Ga0466962_0053909
1452 Ga0466962_0179994
1453 Ga0466962_0230735
1454 Ga0466962_0330947
1455 Ga0530510_0051808
1456 2513230338
1457 2928120917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05717

TnpB_IS66

IS66 Orf2 like protein

28

126

0.94

Map