F477850

General Info

Members Datasets Scaffolds Average Seq Length
729 203 1458 119

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100111186|Ga0070708_1001111864
Length 117
Sequence VTAVAATDRKVRLAARAALDRKALDLVVLDVQGLSSVTDFFVVCSGRSTTHVASIADAVRATMKTEARLLHAEGTPESGWTLLDYGDVLVHVFLEETRLYYALERLWGDAPSVPLER

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 99.31
Stem 0
Stem Tuber 0
Unclassified 19.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100111186 3300005445 Unclassified 2518
2 JGI25406J46586_10096425 3300003203 Unclassified 886
3 JGI25407J50210_10070849 3300003373 Viruses 870
4 Ga0065707_10419103 3300005295 Bacteria 833
5 Ga0065707_10544575 3300005295 Unclassified 710
6 Ga0070676_10534084 3300005328 Unclassified 837
7 Ga0070690_100812645 3300005330 Bacteria 726
8 Ga0070670_100542260 3300005331 Bacteria 1037
9 Ga0068869_101450413 3300005334 Bacteria 608
10 Ga0070680_100149357 3300005336 Bacteria 1961
11 Ga0070680_100348148 3300005336 Unclassified 1260
12 Ga0070680_100364176 3300005336 Bacteria 1230
13 Ga0070689_100388016 3300005340 Bacteria 1178
14 Ga0070691_10019277 3300005341 Bacteria 3146
15 Ga0070692_10003278 3300005345 Bacteria 6530
16 Ga0070692_10238517 3300005345 Bacteria 1083
17 Ga0070668_100404033 3300005347 Unclassified 1167
18 Ga0070668_100583570 3300005347 Bacteria 976
19 Ga0070669_100067397 3300005353 Bacteria 2641
20 Ga0070669_100257144 3300005353 Unclassified 1392
21 Ga0070669_100511556 3300005353 Bacteria 997
22 Ga0070669_100736965 3300005353 Bacteria 834
23 Ga0070669_101409793 3300005353 Bacteria 605
24 Ga0070671_101125598 3300005355 Unclassified 690
25 Ga0070703_10028611 3300005406 Bacteria 1667
26 Ga0070703_10094110 3300005406 Bacteria 1044
27 Ga0070703_10095217 3300005406 Bacteria 1040
28 Ga0070703_10118588 3300005406 Unclassified 957
29 Ga0070703_10305851 3300005406 Bacteria 664
30 Ga0070703_10319557 3300005406 Unclassified 653
31 Ga0070709_10093036 3300005434 Bacteria 1992
32 Ga0070701_10004112 3300005438 Bacteria 5841
33 Ga0070711_100002410 3300005439 Bacteria 10664
34 Ga0070705_100002658 3300005440 Bacteria 8947
35 Ga0070705_100036980 3300005440 Bacteria 2750
36 Ga0070705_100124182 3300005440 Bacteria 1672
37 Ga0070705_100707340 3300005440 Bacteria 792
38 Ga0070700_100025706 3300005441 Bacteria 3468
39 Ga0070700_100421881 3300005441 Unclassified 1008
40 Ga0070700_101556824 3300005441 Unclassified 563
41 Ga0070694_100037042 3300005444 Bacteria 3234
42 Ga0070694_100082534 3300005444 Bacteria 2238
43 Ga0070694_100178592 3300005444 Bacteria 1569
44 Ga0070694_100301357 3300005444 Bacteria 1228
45 Ga0070694_100631845 3300005444 Bacteria 865
46 Ga0070708_100001877 3300005445 Bacteria 16113
47 Ga0070708_100007017 3300005445 Bacteria 8985
48 Ga0070708_100016165 3300005445 Bacteria 6185
49 Ga0070708_100027192 3300005445 Bacteria 4906
50 Ga0070708_100039247 3300005445 Bacteria 4142
51 Ga0070708_100065496 3300005445 Bacteria 3258
52 Ga0070708_100174600 3300005445 Bacteria 2007
53 Ga0070708_100201367 3300005445 Unclassified 1864
54 Ga0070708_100950682 3300005445 Unclassified 806
55 Ga0070663_102018718 3300005455 Bacteria 519
56 Ga0070662_100191491 3300005457 Bacteria 1618
57 Ga0070681_10306986 3300005458 Bacteria 1496
58 Ga0070681_11101559 3300005458 Bacteria 715
59 Ga0068867_100064200 3300005459 Bacteria 2730
60 Ga0068867_100362121 3300005459 Unclassified 1213
61 Ga0068867_100446438 3300005459 Bacteria 1101
62 Ga0068867_100686839 3300005459 Bacteria 902
63 Ga0070706_100006413 3300005467 Bacteria 11121
64 Ga0070706_100010897 3300005467 Bacteria 8439
65 Ga0070706_100039021 3300005467 Bacteria 4384
66 Ga0070706_100066940 3300005467 Bacteria 3323
67 Ga0070706_100263998 3300005467 Bacteria 1607
68 Ga0070706_100356667 3300005467 Unclassified 1363
69 Ga0070706_100583445 3300005467 Bacteria 1039
70 Ga0070707_100017817 3300005468 Bacteria 6676
71 Ga0070707_100021870 3300005468 Bacteria 6046
72 Ga0070707_100273069 3300005468 Unclassified 1643
73 Ga0070707_100785483 3300005468 Bacteria 916
74 Ga0070707_101031545 3300005468 Bacteria 788
75 Ga0070707_101659930 3300005468 Bacteria 606
76 Ga0070698_100008479 3300005471 Bacteria 11102
77 Ga0070698_101925145 3300005471 Bacteria 544
78 Ga0070699_100000534 3300005518 Bacteria 36008
79 Ga0070699_100015943 3300005518 Bacteria 6453
80 Ga0070699_100019082 3300005518 Bacteria 5899
81 Ga0070699_100022085 3300005518 Bacteria 5481
82 Ga0070699_100031277 3300005518 Bacteria 4594
83 Ga0070699_100168078 3300005518 Unclassified 1943
84 Ga0070699_100313396 3300005518 Bacteria 1409
85 Ga0070699_100324253 3300005518 Bacteria 1385
86 Ga0070699_100369362 3300005518 Bacteria 1294
87 Ga0070699_100656272 3300005518 Unclassified 958
88 Ga0070699_100682993 3300005518 Bacteria 938
89 Ga0070699_100711440 3300005518 Bacteria 918
90 Ga0070699_101053313 3300005518 Unclassified 746
91 Ga0070699_101547211 3300005518 Unclassified 608
92 Ga0070679_101080030 3300005530 Unclassified 747
93 Ga0070697_100002842 3300005536 Bacteria 13318
94 Ga0070697_100004778 3300005536 Bacteria 10386
95 Ga0070697_100008237 3300005536 Bacteria 8134
96 Ga0070697_100118828 3300005536 Bacteria 2209
97 Ga0070697_100461934 3300005536 Bacteria 1107
98 Ga0070697_100851712 3300005536 Bacteria 808
99 Ga0068853_100749677 3300005539 Unclassified 933
100 Ga0070672_100023788 3300005543 Bacteria 4520
101 Ga0070695_100010293 3300005545 Bacteria 5581
102 Ga0070695_100103522 3300005545 Bacteria 1921
103 Ga0070695_100248659 3300005545 Unclassified 1293
104 Ga0070695_100580938 3300005545 Unclassified 877
105 Ga0070695_101132416 3300005545 Bacteria 641
106 Ga0070695_101780552 3300005545 Bacteria 516
107 Ga0070696_100014210 3300005546 Bacteria 5342
108 Ga0070696_100040948 3300005546 Bacteria 3200
109 Ga0070696_100074403 3300005546 Bacteria 2395
110 Ga0070696_100151665 3300005546 Bacteria 1701
111 Ga0070696_100540111 3300005546 Bacteria 933
112 Ga0070704_100055161 3300005549 Bacteria 2816
113 Ga0070704_100104958 3300005549 Bacteria 2138
114 Ga0070704_100118602 3300005549 Bacteria 2028
115 Ga0070704_100445781 3300005549 Bacteria 1114
116 Ga0068857_100052123 3300005577 Bacteria 3631
117 Ga0068859_100016362 3300005617 Bacteria 7451
118 Ga0068859_100281450 3300005617 Bacteria 1756
119 Ga0068859_100567149 3300005617 Bacteria 1229
120 Ga0068859_100659590 3300005617 Bacteria 1138
121 Ga0068866_10449455 3300005718 Bacteria 842
122 Ga0068866_10486795 3300005718 Bacteria 814
123 Ga0068866_11140845 3300005718 Bacteria 560
124 Ga0068861_100079893 3300005719 Bacteria 2557
125 Ga0068870_10702770 3300005840 Bacteria 698
126 Ga0068863_100264751 3300005841 Bacteria 1663
127 Ga0068863_100357588 3300005841 Unclassified 1423
128 Ga0068860_100028693 3300005843 Bacteria 5357
129 Ga0068860_100219753 3300005843 Bacteria 1845
130 Ga0068860_100302912 3300005843 Bacteria 1566
131 Ga0068860_100521589 3300005843 Unclassified 1188
132 Ga0068860_100560761 3300005843 Unclassified 1145
133 Ga0068860_100623432 3300005843 Unclassified 1085
134 Ga0068860_101164110 3300005843 Unclassified 791
135 Ga0068862_100110530 3300005844 Bacteria 2412
136 Ga0068862_100132488 3300005844 Bacteria 2206
137 Ga0068862_100140629 3300005844 Bacteria 2142
138 Ga0068862_100305370 3300005844 Bacteria 1465
139 Ga0081455_10140023 3300005937 Bacteria 1880
140 Ga0081538_10025390 3300005981 Bacteria 4180
141 Ga0081540_1012401 3300005983 Bacteria 5619
142 Ga0081539_10000454 3300005985 Bacteria 87230
143 Ga0075432_10019925 3300006058 Bacteria 2294
144 Ga0075432_10055278 3300006058 Bacteria 1406
145 Ga0070715_10163423 3300006163 Unclassified 1102
146 Ga0070716_100842814 3300006173 Unclassified 713
147 Ga0070712_100001853 3300006175 Bacteria 12884
148 Ga0075428_100001697 3300006844 Bacteria 23501
149 Ga0075428_100002161 3300006844 Bacteria 21262
150 Ga0075428_100010873 3300006844 Bacteria 10119
151 Ga0075428_100013779 3300006844 Bacteria 9005
152 Ga0075428_100021387 3300006844 Bacteria 7161
153 Ga0075428_100040947 3300006844 Bacteria 5095
154 Ga0075428_100053203 3300006844 Bacteria 4436
155 Ga0075428_100100765 3300006844 Unclassified 3149
156 Ga0075428_100137798 3300006844 Bacteria 2653
157 Ga0075428_100151324 3300006844 Bacteria 2521
158 Ga0075428_100162234 3300006844 Bacteria 2426
159 Ga0075428_100203822 3300006844 Bacteria 2138
160 Ga0075428_100802036 3300006844 Bacteria 1001
161 Ga0075428_101252997 3300006844 Unclassified 781
162 Ga0075428_101333956 3300006844 Bacteria 754
163 Ga0075428_102004164 3300006844 Unclassified 600
164 Ga0075430_100000330 3300006846 Bacteria 33985
165 Ga0075430_100000397 3300006846 Bacteria 32197
166 Ga0075430_100046909 3300006846 Bacteria 3648
167 Ga0075430_100103818 3300006846 Bacteria 2373
168 Ga0075430_100105329 3300006846 Unclassified 2354
169 Ga0075430_100140685 3300006846 Bacteria 2010
170 Ga0075430_100245386 3300006846 Unclassified 1484
171 Ga0075430_100605964 3300006846 Bacteria 904
172 Ga0075430_101338015 3300006846 Unclassified 589
173 Ga0075431_100000322 3300006847 Bacteria 37762
174 Ga0075431_100000455 3300006847 Bacteria 33646
175 Ga0075431_100001270 3300006847 Bacteria 22987
176 Ga0075431_100004664 3300006847 Bacteria 13466
177 Ga0075431_100006452 3300006847 Bacteria 11649
178 Ga0075431_100008506 3300006847 Bacteria 10276
179 Ga0075431_100018260 3300006847 Bacteria 7136
180 Ga0075431_100026599 3300006847 Bacteria 5935
181 Ga0075431_100080919 3300006847 Bacteria 3354
182 Ga0075431_100131183 3300006847 Unclassified 2584
183 Ga0075431_100173803 3300006847 Bacteria 2213
184 Ga0075431_100419309 3300006847 Bacteria 1338
185 Ga0075431_100876645 3300006847 Bacteria 868
186 Ga0075431_100901966 3300006847 Bacteria 853
187 Ga0075431_100936963 3300006847 Bacteria 835
188 Ga0075431_101695041 3300006847 Unclassified 589
189 Ga0075433_10000061 3300006852 Bacteria 47469
190 Ga0075433_10000427 3300006852 Bacteria 27010
191 Ga0075433_10025185 3300006852 Bacteria 5029
192 Ga0075433_10047618 3300006852 Bacteria 3729
193 Ga0075433_10091212 3300006852 Bacteria 2693
194 Ga0075433_10091551 3300006852 Bacteria 2689
195 Ga0075433_10109609 3300006852 Unclassified 2449
196 Ga0075433_10132812 3300006852 Bacteria 2212
197 Ga0075433_10202920 3300006852 Bacteria 1763
198 Ga0075433_10209811 3300006852 Unclassified 1731
199 Ga0075433_10232131 3300006852 Bacteria 1638
200 Ga0075433_10565366 3300006852 Unclassified 999
201 Ga0075433_11079610 3300006852 Unclassified 698
202 Ga0075433_11643564 3300006852 Unclassified 554
203 Ga0075434_100000180 3300006871 Bacteria 41040
204 Ga0075434_100015282 3300006871 Bacteria 7358
205 Ga0075434_100038238 3300006871 Bacteria 4753
206 Ga0075434_100056269 3300006871 Bacteria 3909
207 Ga0075434_100095010 3300006871 Bacteria 2986
208 Ga0075434_100154543 3300006871 Bacteria 2314
209 Ga0075434_100221767 3300006871 Bacteria 1911
210 Ga0075434_100234062 3300006871 Bacteria 1857
211 Ga0075434_100385244 3300006871 Bacteria 1423
212 Ga0075434_100400182 3300006871 Bacteria 1394
213 Ga0075434_100695621 3300006871 Unclassified 1034
214 Ga0075434_101015157 3300006871 Unclassified 843
215 Ga0075434_101846874 3300006871 Bacteria 611
216 Ga0075434_102497908 3300006871 Unclassified 518
217 Ga0075429_100000023 3300006880 Bacteria 68064
218 Ga0075429_100006022 3300006880 Bacteria 10485
219 Ga0075429_100006260 3300006880 Bacteria 10302
220 Ga0075429_100010194 3300006880 Bacteria 8136
221 Ga0075429_100025662 3300006880 Bacteria 5117
222 Ga0075429_100357768 3300006880 Bacteria 1278
223 Ga0075429_100359630 3300006880 Unclassified 1275
224 Ga0068865_100333874 3300006881 Unclassified 1223
225 Ga0068865_100357982 3300006881 Archaea 1184
226 Ga0075436_100000699 3300006914 Bacteria 22189
227 Ga0075436_100048199 3300006914 Bacteria 2939
228 Ga0075436_100111168 3300006914 Bacteria 1913
229 Ga0075436_100317348 3300006914 Bacteria 1119
230 Ga0097620_100016362 3300006931 Bacteria 7451
231 Ga0097620_100281439 3300006931 Bacteria 1756
232 Ga0097620_100567113 3300006931 Bacteria 1229
233 Ga0097620_100659606 3300006931 Bacteria 1138
234 Ga0075435_100001420 3300007076 Bacteria 15463
235 Ga0075435_100003378 3300007076 Bacteria 10825
236 Ga0075435_100025773 3300007076 Bacteria 4580
237 Ga0075435_100029438 3300007076 Bacteria 4309
238 Ga0075435_100039727 3300007076 Bacteria 3755
239 Ga0075435_100045849 3300007076 Bacteria 3506
240 Ga0075435_100051958 3300007076 Bacteria 3302
241 Ga0075435_100098659 3300007076 Unclassified 2418
242 Ga0075435_100227847 3300007076 Unclassified 1583
243 Ga0075435_101037123 3300007076 Unclassified 716
244 Ga0075435_101778712 3300007076 Bacteria 541
245 Ga0099794_10007293 3300007265 Bacteria 4534
246 Ga0099794_10014073 3300007265 Bacteria 3497
247 Ga0099794_10067716 3300007265 Bacteria 1744
248 Ga0099794_10210727 3300007265 Bacteria 997
249 Ga0099794_10364393 3300007265 Unclassified 753
250 Ga0111539_10000463 3300009094 Bacteria 51027
251 Ga0111539_10001292 3300009094 Bacteria 33417
252 Ga0111539_10044185 3300009094 Bacteria 5338
253 Ga0111539_10129641 3300009094 Bacteria 2953
254 Ga0111539_10859439 3300009094 Bacteria 1055
255 Ga0111539_12123823 3300009094 Unclassified 652
256 Ga0114129_10000110 3300009147 Bacteria 81178
257 Ga0114129_10000936 3300009147 Bacteria 38136
258 Ga0114129_10002179 3300009147 Bacteria 26947
259 Ga0114129_10002546 3300009147 Bacteria 25316
260 Ga0114129_10003145 3300009147 Bacteria 23174
261 Ga0114129_10032488 3300009147 Bacteria 7376
262 Ga0114129_10033793 3300009147 Bacteria 7224
263 Ga0114129_10038131 3300009147 Bacteria 6781
264 Ga0114129_10067006 3300009147 Bacteria 5007
265 Ga0114129_10068811 3300009147 Bacteria 4935
266 Ga0114129_10074936 3300009147 Bacteria 4712
267 Ga0114129_10130418 3300009147 Bacteria 3453
268 Ga0114129_10164641 3300009147 Bacteria 3027
269 Ga0114129_10172338 3300009147 Bacteria 2949
270 Ga0114129_10209440 3300009147 Unclassified 2636
271 Ga0114129_10220806 3300009147 Bacteria 2557
272 Ga0114129_10221835 3300009147 Bacteria 2550
273 Ga0114129_10247486 3300009147 Bacteria 2394
274 Ga0114129_10289126 3300009147 Bacteria 2188
275 Ga0114129_10302790 3300009147 Unclassified 2130
276 Ga0114129_10887613 3300009147 Bacteria 1131
277 Ga0114129_11084599 3300009147 Unclassified 1003
278 Ga0114129_11321365 3300009147 Unclassified 893
279 Ga0114129_12005673 3300009147 Bacteria 700
280 Ga0105243_10074374 3300009148 Bacteria 2756
281 Ga0105243_10365952 3300009148 Bacteria 1329
282 Ga0105243_10801850 3300009148 Bacteria 928
283 Ga0105241_10056393 3300009174 Bacteria 3012
284 Ga0105242_10115858 3300009176 Bacteria 2292
285 Ga0105242_10294986 3300009176 Bacteria 1478
286 Ga0105248_10253330 3300009177 Bacteria 1981
287 Ga0105249_10032975 3300009553 Bacteria 4687
288 Ga0105249_10146407 3300009553 Bacteria 2270
289 Ga0105249_10343728 3300009553 Bacteria 1510
290 Ga0157378_10134359 3300013297 Bacteria 2292
291 Ga0157378_10325994 3300013297 Bacteria 1493
292 Ga0163162_10361488 3300013306 Bacteria 1585
293 Ga0163162_11026702 3300013306 Unclassified 933
294 Ga0157375_10027944 3300013308 Archaea 5279
295 Ga0157380_10088611 3300014326 Bacteria 2547
296 Ga0157380_10401075 3300014326 Bacteria 1301
297 Ga0157380_10859541 3300014326 Unclassified 930
298 Ga0163161_11313563 3300017792 Archaea 629
299 Ga0163161_11356111 3300017792 Bacteria 620
300 Ga0207653_10042554 3300025885 Bacteria 1494
301 Ga0207653_10066264 3300025885 Bacteria 1227
302 Ga0207653_10276092 3300025885 Unclassified 648
303 Ga0207682_10241394 3300025893 Archaea 840
304 Ga0207642_10757642 3300025899 Bacteria 615
305 Ga0207699_10171299 3300025906 Bacteria 1452
306 Ga0207643_10058987 3300025908 Bacteria 2189
307 Ga0207643_10070594 3300025908 Bacteria 2009
308 Ga0207684_10000279 3300025910 Bacteria 74399
309 Ga0207684_10027078 3300025910 Bacteria 4889
310 Ga0207684_10029855 3300025910 Bacteria 4642
311 Ga0207684_10031908 3300025910 Bacteria 4482
312 Ga0207684_10052214 3300025910 Bacteria 3469
313 Ga0207684_10109606 3300025910 Bacteria 2363
314 Ga0207684_10288395 3300025910 Bacteria 1415
315 Ga0207684_10918680 3300025910 Unclassified 735
316 Ga0207654_10211002 3300025911 Bacteria 1283
317 Ga0207707_10919754 3300025912 Bacteria 722
318 Ga0207693_10008017 3300025915 Bacteria 8674
319 Ga0207663_10111240 3300025916 Bacteria 1859
320 Ga0207660_10036053 3300025917 Bacteria 3437
321 Ga0207660_10249736 3300025917 Bacteria 1400
322 Ga0207660_10486612 3300025917 Bacteria 1000
323 Ga0207652_10890856 3300025921 Unclassified 786
324 Ga0207646_10001682 3300025922 Bacteria 26908
325 Ga0207646_10009939 3300025922 Bacteria 9356
326 Ga0207646_10012964 3300025922 Bacteria 7990
327 Ga0207646_10050235 3300025922 Bacteria 3732
328 Ga0207646_10085961 3300025922 Bacteria 2813
329 Ga0207646_10376407 3300025922 Bacteria 1283
330 Ga0207646_10498576 3300025922 Bacteria 1097
331 Ga0207646_10616436 3300025922 Bacteria 973
332 Ga0207646_11544995 3300025922 Bacteria 574
333 Ga0207681_10041361 3300025923 Bacteria 3072
334 Ga0207681_10764307 3300025923 Bacteria 806
335 Ga0207686_10173638 3300025934 Bacteria 1522
336 Ga0207709_10051224 3300025935 Bacteria 2530
337 Ga0207709_11283086 3300025935 Bacteria 605
338 Ga0207670_10243420 3300025936 Bacteria 1387
339 Ga0207665_10177291 3300025939 Unclassified 1542
340 Ga0207665_10817724 3300025939 Unclassified 737
341 Ga0207691_10028365 3300025940 Bacteria 5243
342 Ga0207691_10388908 3300025940 Bacteria 1190
343 Ga0207711_10942719 3300025941 Bacteria 802
344 Ga0207689_10044087 3300025942 Bacteria 3687
345 Ga0207668_10069168 3300025972 Bacteria 2513
346 Ga0207668_10715662 3300025972 Unclassified 881
347 Ga0207678_11726311 3300026067 Bacteria 549
348 Ga0207708_10021566 3300026075 Bacteria 4859
349 Ga0207708_10774759 3300026075 Bacteria 824
350 Ga0207641_10265473 3300026088 Bacteria 1609
351 Ga0207648_10056903 3300026089 Bacteria 3412
352 Ga0207648_10091112 3300026089 Bacteria 2665
353 Ga0207648_10283987 3300026089 Unclassified 1481
354 Ga0207674_10007378 3300026116 Bacteria 12807
355 Ga0207675_100193065 3300026118 Bacteria 1954
356 Ga0207675_100769871 3300026118 Bacteria 974
357 Ga0209998_10004690 3300027717 Bacteria 2893
358 Ga0209998_10025546 3300027717 Bacteria 1286
359 Ga0209974_10044153 3300027876 Bacteria 1486
360 Ga0209974_10178603 3300027876 Unclassified 777
361 Ga0207428_10000245 3300027907 Bacteria 74009
362 Ga0207428_10004270 3300027907 Bacteria 13678
363 Ga0268265_10233015 3300028380 Bacteria 1619
364 Ga0268265_10268030 3300028380 Unclassified 1522
365 Ga0268265_10471075 3300028380 Bacteria 1177
366 Ga0268265_10489654 3300028380 Bacteria 1157
367 Ga0268265_10968279 3300028380 Unclassified 839
368 Ga0268264_10069755 3300028381 Bacteria 2973
369 Ga0268264_10071299 3300028381 Bacteria 2943
370 Ga0268264_10570120 3300028381 Unclassified 1112
371 Ga0268264_10757410 3300028381 Bacteria 968
372 Ga0268264_11151673 3300028381 Unclassified 785
373 Ga0307408_100022228 3300031548 Bacteria 4307
374 Ga0307408_100041727 3300031548 Bacteria 3254
375 Ga0307408_100254879 3300031548 Unclassified 1449
376 Ga0307408_100292207 3300031548 Bacteria 1361
377 Ga0307405_10039802 3300031731 Bacteria 2844
378 Ga0307405_10289089 3300031731 Bacteria 1238
379 Ga0307413_10218524 3300031824 Bacteria 1390
380 Ga0307410_10023503 3300031852 Bacteria 3833
381 Ga0307410_10251321 3300031852 Bacteria 1375
382 Ga0307406_10458934 3300031901 Bacteria 1024
383 Ga0307407_10480515 3300031903 Bacteria 907
384 Ga0307412_10040665 3300031911 Bacteria 3009
385 Ga0307412_10323865 3300031911 Bacteria 1227
386 Ga0307412_11633088 3300031911 Unclassified 589
387 Ga0307409_101416984 3300031995 Unclassified 721
388 Ga0307409_101488719 3300031995 Unclassified 704
389 Ga0307416_100022077 3300032002 Bacteria 4585
390 Ga0307416_100145947 3300032002 Bacteria 2160
391 Ga0307416_100400976 3300032002 Unclassified 1409
392 Ga0307416_100631380 3300032002 Bacteria 1154
393 Ga0307411_10280933 3300032005 Bacteria 1325
394 Ga0307411_10375752 3300032005 Bacteria 1167
395 Ga0307411_10705838 3300032005 Bacteria 879
396 Ga0307411_11998199 3300032005 Bacteria 541
397 Ga0307415_100334346 3300032126 Bacteria 1269
398 Ga0373948_0054662 3300034817 Unclassified 865
399 Ga0373950_0030140 3300034818 Bacteria 1001
400 Ga0373928_0098891 3300035084 Bacteria 758
401 Ga0373940_0012808 3300035088 Bacteria 2015
402 Ga0373952_0220896 3300035092 Bacteria 563
403 Ga0373932_0107471 3300035112 Bacteria 915
404 Ga0373932_0132404 3300035112 Bacteria 841
405 Ga0373939_0052900 3300035114 Bacteria 1267
406 Ga0373941_0039268 3300035115 Unclassified 1454
407 Ga0373960_0055637 3300035121 Unclassified 1186
408 Ga0373942_0190621 3300035207 Unclassified 676
409 Ga0373961_0324295 3300035241 Unclassified 575
410 Ga0373931_0004994 3300035691 Bacteria 6103
411 Ga0373931_0007718 3300035691 Bacteria 5080
412 Ga0373931_0305879 3300035691 Unclassified 983
413 Ga0373931_0308255 3300035691 Bacteria 980
414 Ga0373933_0738299 3300035724 Bacteria 648
415 Ga0395899_0060029 3300037312 Bacteria 2802
416 Ga0395900_0002273 3300037418 Bacteria 21347
417 Ga0395898_0005721 3300037466 Bacteria 13392
418 Ga0395905_0442526 3300037471 Unclassified 1197
419 Ga0395905_1341130 3300037471 Archaea 619
420 Ga0395905_1678394 3300037471 Bacteria 540
421 Ga0395901_0003758 3300038443 Bacteria 15294
422 Ga0395901_0055655 3300038443 Bacteria 4114
423 Ga0395901_0753578 3300038443 Bacteria 967
424 Ga0242420_051591 3300038996 Unclassified 805
425 Ga0439441_062306 3300042001 Unclassified 787
426 Ga0439435_0027606 3300042436 Bacteria 1520
427 Ga0439444_0120372 3300042437 Bacteria 612
428 Ga0451577_0007999 3300042876 Bacteria 10322
429 Ga0451577_0081422 3300042876 Bacteria 2888
430 Ga0453683_0012692 3300044673 Bacteria 5517
431 Ga0453683_0044671 3300044673 Bacteria 2779
432 Ga0453684_0012894 3300044712 Bacteria 13693
433 Ga0453684_0912803 3300044712 Bacteria 940
434 Ga0451576_0076218 3300045051 Bacteria 3490
435 Ga0451576_0124767 3300045051 Bacteria 2682
436 Ga0451576_0220225 3300045051 Bacteria 1981
437 Ga0451576_0532873 3300045051 Unclassified 1234
438 Ga0451576_0631040 3300045051 Bacteria 1126
439 Ga0451576_1540719 3300045051 Bacteria 690
440 Ga0495651_0533363 3300046462 Bacteria 748
441 Ga0495580_0000727 3300046472 Bacteria 28206
442 Ga0495594_0537318 3300046499 Unclassified 663
443 Ga0495642_0015743 3300046528 Bacteria 2944
444 Ga0495656_0355543 3300046615 Bacteria 760
445 Ga0495659_0012313 3300046664 Bacteria 2768
446 Ga0495659_0089643 3300046664 Unclassified 1179
447 Ga0495659_0245228 3300046664 Bacteria 745
448 Ga0495599_0287228 3300046678 Bacteria 995
449 Ga0495669_0118584 3300046684 Bacteria 1239
450 Ga0495669_0136028 3300046684 Bacteria 1158
451 Ga0495669_0497152 3300046684 Bacteria 593
452 Ga0495670_0157312 3300046691 Bacteria 1193
453 Ga0495670_0445203 3300046691 Bacteria 702
454 Ga0495636_0152940 3300047318 Unclassified 1036
455 Ga0496102_0110019 3300048905 Unclassified 2568
456 Ga0496107_0390999 3300048910 Unclassified 1034
457 Ga0496107_0691928 3300048910 Bacteria 750
458 Ga0496108_0738107 3300048911 Unclassified 852
459 Ga0496110_0518239 3300048913 Unclassified 1085
460 Ga0501300_069219 3300049523 Bacteria 569
461 Ga0501031_0063449 3300049568 Bacteria 2407
462 Ga0501031_0424146 3300049568 Bacteria 860
463 Ga0501033_0357373 3300049570 Bacteria 1022
464 Ga0501033_0372227 3300049570 Bacteria 999
465 Ga0501034_1621375 3300049571 Bacteria 520
466 Ga0501036_0172493 3300049572 Bacteria 1822
467 Ga0501036_0242213 3300049572 Bacteria 1512
468 Ga0501036_0384001 3300049572 Bacteria 1172
469 Ga0501036_0976461 3300049572 Bacteria 694
470 Ga0501038_0126905 3300049574 Bacteria 2099
471 Ga0501038_0242457 3300049574 Bacteria 1431
472 Ga0501038_0284015 3300049574 Bacteria 1302
473 Ga0501039_0031155 3300049575 Bacteria 4111
474 Ga0501039_0347008 3300049575 Bacteria 1166
475 Ga0501039_0599061 3300049575 Bacteria 864
476 Ga0501040_0009211 3300049576 Bacteria 6430
477 Ga0501040_0023671 3300049576 Bacteria 4119
478 Ga0501040_0079661 3300049576 Bacteria 2268
479 Ga0501040_0100753 3300049576 Bacteria 2014
480 Ga0501040_0109367 3300049576 Bacteria 1932
481 Ga0501040_0327448 3300049576 Bacteria 1096
482 Ga0501040_0708259 3300049576 Bacteria 728
483 Ga0501040_1039131 3300049576 Bacteria 594
484 Ga0501041_0023765 3300049577 Bacteria 3675
485 Ga0501041_0049792 3300049577 Bacteria 2552
486 Ga0501041_0228242 3300049577 Bacteria 1169
487 Ga0501041_0327258 3300049577 Bacteria 967
488 Ga0501041_0348736 3300049577 Unclassified 935
489 Ga0501042_0064828 3300049578 Bacteria 2611
490 Ga0501042_0108459 3300049578 Bacteria 1999
491 Ga0501042_0174382 3300049578 Unclassified 1551
492 Ga0501042_0176184 3300049578 Bacteria 1542
493 Ga0501042_0705064 3300049578 Bacteria 734
494 Ga0501043_0140482 3300049579 Bacteria 1892
495 Ga0501046_0060546 3300049580 Bacteria 2962
496 Ga0501046_0238736 3300049580 Unclassified 1341
497 Ga0501046_0559335 3300049580 Bacteria 815
498 Ga0501048_0043554 3300049582 Bacteria 3212
499 Ga0501048_0053701 3300049582 Bacteria 2864
500 Ga0501048_0152457 3300049582 Bacteria 1635
501 Ga0501048_0252570 3300049582 Bacteria 1252
502 Ga0501048_0270229 3300049582 Bacteria 1208
503 Ga0501048_0303018 3300049582 Unclassified 1137
504 Ga0501048_0379057 3300049582 Bacteria 1010
505 Ga0501067_0005543 3300049583 Bacteria 6995
506 Ga0501067_0561733 3300049583 Bacteria 639
507 Ga0501068_0013001 3300049584 Bacteria 4730
508 Ga0501068_0248674 3300049584 Bacteria 1133
509 Ga0501068_0504168 3300049584 Bacteria 785
510 Ga0501069_0016721 3300049585 Bacteria 3942
511 Ga0501070_0897884 3300049586 Unclassified 691
512 Ga0501071_0080476 3300049587 Bacteria 2382
513 Ga0501071_0139197 3300049587 Bacteria 1807
514 Ga0501071_0292835 3300049587 Bacteria 1233
515 Ga0501071_0330105 3300049587 Bacteria 1159
516 Ga0501071_1292794 3300049587 Unclassified 563
517 Ga0501072_0009215 3300049588 Bacteria 7500
518 Ga0501072_0009417 3300049588 Bacteria 7427
519 Ga0501072_0017017 3300049588 Bacteria 5585
520 Ga0501072_0031838 3300049588 Bacteria 4129
521 Ga0501072_0085455 3300049588 Bacteria 2502
522 Ga0501072_0119404 3300049588 Bacteria 2101
523 Ga0501074_0029591 3300049590 Bacteria 3967
524 Ga0501074_0176599 3300049590 Bacteria 1524
525 Ga0501074_0309196 3300049590 Unclassified 1123
526 Ga0501074_0390724 3300049590 Bacteria 987
527 Ga0501075_0017125 3300049591 Bacteria 5231
528 Ga0501075_0039316 3300049591 Bacteria 3541
529 Ga0501075_0071430 3300049591 Bacteria 2624
530 Ga0501075_0073153 3300049591 Bacteria 2592
531 Ga0501075_0111827 3300049591 Bacteria 2077
532 Ga0501075_0117283 3300049591 Bacteria 2023
533 Ga0501075_0140392 3300049591 Bacteria 1841
534 Ga0501075_0448395 3300049591 Unclassified 984
535 Ga0501075_0450619 3300049591 Unclassified 981
536 Ga0501075_0469495 3300049591 Bacteria 960
537 Ga0501075_0557530 3300049591 Bacteria 874
538 Ga0501075_0566312 3300049591 Unclassified 867
539 Ga0501076_0004195 3300049592 Bacteria 10204
540 Ga0501076_0004791 3300049592 Bacteria 9654
541 Ga0501076_0044357 3300049592 Bacteria 3506
542 Ga0501076_0228704 3300049592 Bacteria 1520
543 Ga0501076_0247569 3300049592 Bacteria 1458
544 Ga0501076_0316402 3300049592 Bacteria 1280
545 Ga0501076_0325661 3300049592 Bacteria 1260
546 Ga0501076_0563454 3300049592 Bacteria 939
547 Ga0501076_1193117 3300049592 Unclassified 626
548 Ga0501077_0002254 3300049593 Bacteria 11630
549 Ga0501077_0010984 3300049593 Bacteria 5644
550 Ga0501077_0035456 3300049593 Bacteria 3176
551 Ga0501077_0174778 3300049593 Bacteria 1364
552 Ga0501077_0266169 3300049593 Bacteria 1090
553 Ga0501077_0279734 3300049593 Bacteria 1062
554 Ga0501077_0312198 3300049593 Bacteria 1002
555 Ga0501077_0495409 3300049593 Bacteria 783
556 Ga0501079_0003482 3300049741 Bacteria 11571
557 Ga0501079_0006853 3300049741 Bacteria 8581
558 Ga0501079_0029398 3300049741 Bacteria 4219
559 Ga0501079_0117707 3300049741 Bacteria 2065
560 Ga0501079_0189620 3300049741 Bacteria 1604
561 Ga0501079_0309266 3300049741 Bacteria 1236
562 Ga0501079_0448675 3300049741 Bacteria 1013
563 Ga0501079_0658340 3300049741 Unclassified 824
564 Ga0501079_0944873 3300049741 Unclassified 679
565 Ga0501080_0397600 3300049742 Bacteria 1240
566 Ga0501080_0525745 3300049742 Bacteria 1055
567 Ga0501080_0544081 3300049742 Bacteria 1035
568 Ga0501080_1535717 3300049742 Unclassified 565
569 Ga0501081_0008422 3300049743 Bacteria 6699
570 Ga0501081_0009802 3300049743 Bacteria 6240
571 Ga0501081_0014285 3300049743 Bacteria 5234
572 Ga0501081_0024059 3300049743 Bacteria 4088
573 Ga0501081_0028858 3300049743 Bacteria 3747
574 Ga0501081_0070819 3300049743 Bacteria 2430
575 Ga0501081_0084077 3300049743 Bacteria 2232
576 Ga0501081_0126296 3300049743 Bacteria 1825
577 Ga0501081_0442769 3300049743 Bacteria 965
578 Ga0501081_0473916 3300049743 Bacteria 931
579 Ga0501081_0541020 3300049743 Bacteria 870
580 Ga0501081_0735259 3300049743 Bacteria 741
581 Ga0501081_0903147 3300049743 Bacteria 666
582 Ga0501083_0131626 3300049744 Bacteria 1640
583 Ga0501083_0437523 3300049744 Bacteria 851
584 Ga0501282_025703 3300049778 Unclassified 660
585 Ga0501035_0073871 3300049822 Bacteria 3017
586 Ga0501045_0013331 3300049824 Bacteria 5804
587 Ga0501045_0030507 3300049824 Bacteria 3903
588 Ga0501045_0037908 3300049824 Bacteria 3506
589 Ga0501045_0090930 3300049824 Bacteria 2256
590 Ga0501045_0184111 3300049824 Bacteria 1556
591 Ga0501045_0195408 3300049824 Unclassified 1508
592 Ga0501045_0216333 3300049824 Bacteria 1427
593 Ga0501045_0524112 3300049824 Bacteria 880
594 Ga0501045_1069519 3300049824 Bacteria 591
595 Ga0501045_1212638 3300049824 Bacteria 550
596 nmdc:mga05p37_10163_c1 3300050507 Bacteria 11170
597 nmdc:mga05p37_108157_c1 3300050507 Bacteria 3421
598 nmdc:mga05p37_109421_c1 3300050507 Bacteria 3400
599 nmdc:mga05p37_126732_c1 3300050507 Bacteria 3135
600 nmdc:mga05p37_1878110_c1 3300050507 Bacteria 573
601 nmdc:mga05p37_233057_c1 3300050507 Bacteria 2217
602 nmdc:mga05p37_26803_c1 3300050507 Bacteria 7009
603 nmdc:mga05p37_284011_c1 3300050507 Bacteria 1973
604 nmdc:mga05p37_30965_c1 3300050507 Bacteria 6533
605 nmdc:mga05p37_382309_c1 3300050507 Bacteria 1649
606 nmdc:mga05p37_409118_c1 3300050507 Unclassified 1582
607 nmdc:mga05p37_412086_c1 3300050507 Unclassified 695
608 nmdc:mga05p37_412617_c1 3300050507 Bacteria 1574
609 nmdc:mga05p37_420622_c1 3300050507 Bacteria 1555
610 nmdc:mga05p37_4364_c1 3300050507 Bacteria 16507
611 nmdc:mga05p37_700006_c1 3300050507 Bacteria 1126
612 nmdc:mga05p37_731799_c1 3300050507 Unclassified 1094
613 nmdc:mga05p37_769_c1 3300050507 Bacteria 35683
614 nmdc:mga09592_1309803_c1 3300050508 Unclassified 595
615 nmdc:mga09592_1895_c1 3300050508 Bacteria 16842
616 nmdc:mga09592_221149_c1 3300050508 Bacteria 1640
617 nmdc:mga09592_276351_c1 3300050508 Bacteria 1457
618 nmdc:mga09592_300914_c1 3300050508 Unclassified 1391
619 nmdc:mga09592_354829_c1 3300050508 Bacteria 1269
620 nmdc:mga09592_3897_c1 3300050508 Bacteria 12019
621 nmdc:mga09592_39234_c1 3300050508 Bacteria 3977
622 nmdc:mga09592_41408_c1 3300050508 Bacteria 3874
623 nmdc:mga09592_4917_c1 3300050508 Bacteria 10833
624 nmdc:mga09592_71396_c1 3300050508 Bacteria 2947
625 nmdc:mga09592_908671_c1 3300050508 Unclassified 740
626 nmdc:mga0qj67_1151206_c1 3300050509 Unclassified 605
627 nmdc:mga0qj67_1315430_c1 3300050509 Bacteria 560
628 nmdc:mga0qj67_140_c1 3300050509 Bacteria 48848
629 nmdc:mga0qj67_174077_c1 3300050509 Unclassified 1748
630 nmdc:mga0qj67_215187_c1 3300050509 Bacteria 1560
631 nmdc:mga0qj67_215641_c1 3300050509 Bacteria 1558
632 nmdc:mga0qj67_3069_c1 3300050509 Bacteria 12000
633 nmdc:mga0qj67_3096_c1 3300050509 Bacteria 11962
634 nmdc:mga0qj67_67864_c1 3300050509 Bacteria 2842
635 nmdc:mga0qj67_80757_c1 3300050509 Bacteria 2606
636 nmdc:mga06r32_1249335_c1 3300050510 Unclassified 688
637 nmdc:mga06r32_1336980_c1 3300050510 Unclassified 660
638 nmdc:mga06r32_170907_c1 3300050510 Unclassified 2157
639 nmdc:mga06r32_171157_c1 3300050510 Unclassified 2156
640 nmdc:mga06r32_1729_c1 3300050510 Bacteria 19654
641 nmdc:mga06r32_193211_c1 3300050510 Bacteria 2023
642 nmdc:mga06r32_24549_c1 3300050510 Bacteria 5598
643 nmdc:mga06r32_34664_c1 3300050510 Bacteria 4761
644 nmdc:mga06r32_422994_c1 3300050510 Bacteria 1313
645 nmdc:mga06r32_520830_c1 3300050510 Bacteria 1165
646 nmdc:mga06r32_54900_c1 3300050510 Bacteria 3821
647 nmdc:mga06r32_63685_c1 3300050510 Bacteria 3555
648 nmdc:mga06r32_74951_c1 3300050510 Bacteria 3282
649 nmdc:mga06r32_90146_c1 3300050510 Bacteria 2995
650 nmdc:mga06r32_94369_c1 3300050510 Bacteria 2927
651 nmdc:mga08y16_10911_c1 3300050511 Bacteria 9543
652 nmdc:mga08y16_216936_c1 3300050511 Unclassified 1981
653 nmdc:mga08y16_472695_c1 3300050511 Bacteria 1276
654 nmdc:mga08y16_597_c1 3300050511 Bacteria 33660
655 nmdc:mga08y16_741025_c1 3300050511 Unclassified 979
656 nmdc:mga08y16_821526_c1 3300050511 Bacteria 921
657 nmdc:mga0n895_101662_c1 3300050512 Bacteria 2885
658 nmdc:mga0n895_13952_c1 3300050512 Bacteria 7276
659 nmdc:mga0n895_1725634_c1 3300050512 Unclassified 588
660 nmdc:mga0n895_174341_c1 3300050512 Bacteria 2182
661 nmdc:mga0n895_313528_c1 3300050512 Bacteria 1590
662 nmdc:mga0n895_318154_c1 3300050512 Unclassified 1577
663 nmdc:mga0n895_33104_c1 3300050512 Bacteria 4966
664 nmdc:mga0n895_33668_c1 3300050512 Bacteria 4925
665 nmdc:mga0n895_377397_c1 3300050512 Bacteria 1435
666 nmdc:mga0n895_41999_c1 3300050512 Bacteria 4448
667 nmdc:mga0n895_42453_c1 3300050512 Bacteria 4424
668 nmdc:mga0n895_51573_c1 3300050512 Bacteria 4036
669 nmdc:mga0n895_529368_c1 3300050512 Bacteria 1186
670 nmdc:mga0n895_59266_c1 3300050512 Bacteria 3777
671 nmdc:mga0n895_714246_c1 3300050512 Bacteria 997
672 nmdc:mga0n895_730721_c1 3300050512 Unclassified 984
673 nmdc:mga0n895_7777_c1 3300050512 Bacteria 9236
674 nmdc:mga0n895_99484_c1 3300050512 Bacteria 2916
675 nmdc:mga0rr50_1126458_c1 3300050513 Bacteria 667
676 nmdc:mga0rr50_13421_c1 3300050513 Bacteria 4308
677 nmdc:mga0rr50_1444113_c1 3300050513 Bacteria 582
678 nmdc:mga0rr50_35091_c1 3300050513 Bacteria 3599
679 nmdc:mga0rr50_402707_c1 3300050513 Unclassified 1156
680 nmdc:mga0rr50_549_c1 3300050513 Bacteria 20121
681 nmdc:mga0rr50_57683_c1 3300050513 Bacteria 2906
682 nmdc:mga0rr50_621217_c1 3300050513 Bacteria 922
683 nmdc:mga0rr50_6828_c1 3300050513 Bacteria 6994
684 nmdc:mga0rr50_73908_c1 3300050513 Bacteria 2608
685 nmdc:mga0rr50_793935_c1 3300050513 Unclassified 808
686 nmdc:mga0rr50_905811_c1 3300050513 Unclassified 752
687 nmdc:mga0rr50_90901_c1 3300050513 Bacteria 2376
688 nmdc:mga08x19_147522_c1 3300050514 Unclassified 1592
689 nmdc:mga08x19_2496_c1 3300050514 Bacteria 11200
690 nmdc:mga08x19_285394_c1 3300050514 Unclassified 1144
691 nmdc:mga08x19_788244_c1 3300050514 Bacteria 675
692 nmdc:mga08x19_799186_c1 3300050514 Unclassified 670
693 nmdc:mga0a205_1170_c1 3300050515 Bacteria 21857
694 nmdc:mga0a205_120732_c1 3300050515 Unclassified 2520
695 nmdc:mga0a205_1991_c1 3300050515 Bacteria 17807
696 nmdc:mga0a205_200726_c1 3300050515 Unclassified 1885
697 nmdc:mga0a205_222243_c1 3300050515 Bacteria 1774
698 nmdc:mga0a205_289_c1 3300050515 Bacteria 37019
699 nmdc:mga0a205_313057_c1 3300050515 Unclassified 1442
700 nmdc:mga0a205_36892_c1 3300050515 Bacteria 4699
701 nmdc:mga0a205_3849_c1 3300050515 Bacteria 13450
702 nmdc:mga0a205_38662_c1 3300050515 Bacteria 4591
703 nmdc:mga0a205_452388_c1 3300050515 Unclassified 1144
704 nmdc:mga0a205_6265_c1 3300050515 Bacteria 10740
705 nmdc:mga0a205_84490_c1 3300050515 Bacteria 3066
706 nmdc:mga0a205_99309_c1 3300050515 Bacteria 2809
707 Ga0501084_0023274 3300054114 Bacteria 5172
708 Ga0501084_0040553 3300054114 Bacteria 3895
709 Ga0501084_0181371 3300054114 Bacteria 1777
710 Ga0501084_0278638 3300054114 Bacteria 1412
711 Ga0501084_0662004 3300054114 Bacteria 881
712 Ga0501084_0751713 3300054114 Bacteria 821
713 Ga0501084_0805087 3300054114 Bacteria 791
714 Ga0501084_0986773 3300054114 Unclassified 708
715 Ga0590077_021878 3300059426 Bacteria 1363
716 Ga0501082_0005963 3300060353 Bacteria 10570
717 Ga0501082_0197826 3300060353 Bacteria 1748
718 Ga0501082_0216400 3300060353 Bacteria 1667
719 Ga0501082_0280139 3300060353 Bacteria 1451
720 Ga0501082_0538165 3300060353 Bacteria 1021
721 Ga0501082_0587726 3300060353 Bacteria 974
722 Ga0501082_0619881 3300060353 Unclassified 947
723 Ga0530510_0011819 3300061734 Bacteria 6125
724 Ga0530510_0040714 3300061734 Bacteria 3353
725 Ga0530510_0049234 3300061734 Bacteria 3045
726 Ga0530510_0077559 3300061734 Bacteria 2415
727 Ga0530510_0189078 3300061734 Bacteria 1528
728 Ga0530510_0453693 3300061734 Bacteria 969
729 Ga0530510_1412237 3300061734 Bacteria 534
730 Ga0070708_100111186
731 JGI25406J46586_10096425
732 JGI25407J50210_10070849
733 Ga0065707_10419103
734 Ga0065707_10544575
735 Ga0070676_10534084
736 Ga0070690_100812645
737 Ga0070670_100542260
738 Ga0068869_101450413
739 Ga0070680_100149357
740 Ga0070680_100348148
741 Ga0070680_100364176
742 Ga0070689_100388016
743 Ga0070691_10019277
744 Ga0070692_10003278
745 Ga0070692_10238517
746 Ga0070668_100404033
747 Ga0070668_100583570
748 Ga0070669_100067397
749 Ga0070669_100257144
750 Ga0070669_100511556
751 Ga0070669_100736965
752 Ga0070669_101409793
753 Ga0070671_101125598
754 Ga0070703_10028611
755 Ga0070703_10094110
756 Ga0070703_10095217
757 Ga0070703_10118588
758 Ga0070703_10305851
759 Ga0070703_10319557
760 Ga0070709_10093036
761 Ga0070701_10004112
762 Ga0070711_100002410
763 Ga0070705_100002658
764 Ga0070705_100036980
765 Ga0070705_100124182
766 Ga0070705_100707340
767 Ga0070700_100025706
768 Ga0070700_100421881
769 Ga0070700_101556824
770 Ga0070694_100037042
771 Ga0070694_100082534
772 Ga0070694_100178592
773 Ga0070694_100301357
774 Ga0070694_100631845
775 Ga0070708_100001877
776 Ga0070708_100007017
777 Ga0070708_100016165
778 Ga0070708_100027192
779 Ga0070708_100039247
780 Ga0070708_100065496
781 Ga0070708_100174600
782 Ga0070708_100201367
783 Ga0070708_100950682
784 Ga0070663_102018718
785 Ga0070662_100191491
786 Ga0070681_10306986
787 Ga0070681_11101559
788 Ga0068867_100064200
789 Ga0068867_100362121
790 Ga0068867_100446438
791 Ga0068867_100686839
792 Ga0070706_100006413
793 Ga0070706_100010897
794 Ga0070706_100039021
795 Ga0070706_100066940
796 Ga0070706_100263998
797 Ga0070706_100356667
798 Ga0070706_100583445
799 Ga0070707_100017817
800 Ga0070707_100021870
801 Ga0070707_100273069
802 Ga0070707_100785483
803 Ga0070707_101031545
804 Ga0070707_101659930
805 Ga0070698_100008479
806 Ga0070698_101925145
807 Ga0070699_100000534
808 Ga0070699_100015943
809 Ga0070699_100019082
810 Ga0070699_100022085
811 Ga0070699_100031277
812 Ga0070699_100168078
813 Ga0070699_100313396
814 Ga0070699_100324253
815 Ga0070699_100369362
816 Ga0070699_100656272
817 Ga0070699_100682993
818 Ga0070699_100711440
819 Ga0070699_101053313
820 Ga0070699_101547211
821 Ga0070679_101080030
822 Ga0070697_100002842
823 Ga0070697_100004778
824 Ga0070697_100008237
825 Ga0070697_100118828
826 Ga0070697_100461934
827 Ga0070697_100851712
828 Ga0068853_100749677
829 Ga0070672_100023788
830 Ga0070695_100010293
831 Ga0070695_100103522
832 Ga0070695_100248659
833 Ga0070695_100580938
834 Ga0070695_101132416
835 Ga0070695_101780552
836 Ga0070696_100014210
837 Ga0070696_100040948
838 Ga0070696_100074403
839 Ga0070696_100151665
840 Ga0070696_100540111
841 Ga0070704_100055161
842 Ga0070704_100104958
843 Ga0070704_100118602
844 Ga0070704_100445781
845 Ga0068857_100052123
846 Ga0068859_100016362
847 Ga0068859_100281450
848 Ga0068859_100567149
849 Ga0068859_100659590
850 Ga0068866_10449455
851 Ga0068866_10486795
852 Ga0068866_11140845
853 Ga0068861_100079893
854 Ga0068870_10702770
855 Ga0068863_100264751
856 Ga0068863_100357588
857 Ga0068860_100028693
858 Ga0068860_100219753
859 Ga0068860_100302912
860 Ga0068860_100521589
861 Ga0068860_100560761
862 Ga0068860_100623432
863 Ga0068860_101164110
864 Ga0068862_100110530
865 Ga0068862_100132488
866 Ga0068862_100140629
867 Ga0068862_100305370
868 Ga0081455_10140023
869 Ga0081538_10025390
870 Ga0081540_1012401
871 Ga0081539_10000454
872 Ga0075432_10019925
873 Ga0075432_10055278
874 Ga0070715_10163423
875 Ga0070716_100842814
876 Ga0070712_100001853
877 Ga0075428_100001697
878 Ga0075428_100002161
879 Ga0075428_100010873
880 Ga0075428_100013779
881 Ga0075428_100021387
882 Ga0075428_100040947
883 Ga0075428_100053203
884 Ga0075428_100100765
885 Ga0075428_100137798
886 Ga0075428_100151324
887 Ga0075428_100162234
888 Ga0075428_100203822
889 Ga0075428_100802036
890 Ga0075428_101252997
891 Ga0075428_101333956
892 Ga0075428_102004164
893 Ga0075430_100000330
894 Ga0075430_100000397
895 Ga0075430_100046909
896 Ga0075430_100103818
897 Ga0075430_100105329
898 Ga0075430_100140685
899 Ga0075430_100245386
900 Ga0075430_100605964
901 Ga0075430_101338015
902 Ga0075431_100000322
903 Ga0075431_100000455
904 Ga0075431_100001270
905 Ga0075431_100004664
906 Ga0075431_100006452
907 Ga0075431_100008506
908 Ga0075431_100018260
909 Ga0075431_100026599
910 Ga0075431_100080919
911 Ga0075431_100131183
912 Ga0075431_100173803
913 Ga0075431_100419309
914 Ga0075431_100876645
915 Ga0075431_100901966
916 Ga0075431_100936963
917 Ga0075431_101695041
918 Ga0075433_10000061
919 Ga0075433_10000427
920 Ga0075433_10025185
921 Ga0075433_10047618
922 Ga0075433_10091212
923 Ga0075433_10091551
924 Ga0075433_10109609
925 Ga0075433_10132812
926 Ga0075433_10202920
927 Ga0075433_10209811
928 Ga0075433_10232131
929 Ga0075433_10565366
930 Ga0075433_11079610
931 Ga0075433_11643564
932 Ga0075434_100000180
933 Ga0075434_100015282
934 Ga0075434_100038238
935 Ga0075434_100056269
936 Ga0075434_100095010
937 Ga0075434_100154543
938 Ga0075434_100221767
939 Ga0075434_100234062
940 Ga0075434_100385244
941 Ga0075434_100400182
942 Ga0075434_100695621
943 Ga0075434_101015157
944 Ga0075434_101846874
945 Ga0075434_102497908
946 Ga0075429_100000023
947 Ga0075429_100006022
948 Ga0075429_100006260
949 Ga0075429_100010194
950 Ga0075429_100025662
951 Ga0075429_100357768
952 Ga0075429_100359630
953 Ga0068865_100333874
954 Ga0068865_100357982
955 Ga0075436_100000699
956 Ga0075436_100048199
957 Ga0075436_100111168
958 Ga0075436_100317348
959 Ga0097620_100016362
960 Ga0097620_100281439
961 Ga0097620_100567113
962 Ga0097620_100659606
963 Ga0075435_100001420
964 Ga0075435_100003378
965 Ga0075435_100025773
966 Ga0075435_100029438
967 Ga0075435_100039727
968 Ga0075435_100045849
969 Ga0075435_100051958
970 Ga0075435_100098659
971 Ga0075435_100227847
972 Ga0075435_101037123
973 Ga0075435_101778712
974 Ga0099794_10007293
975 Ga0099794_10014073
976 Ga0099794_10067716
977 Ga0099794_10210727
978 Ga0099794_10364393
979 Ga0111539_10000463
980 Ga0111539_10001292
981 Ga0111539_10044185
982 Ga0111539_10129641
983 Ga0111539_10859439
984 Ga0111539_12123823
985 Ga0114129_10000110
986 Ga0114129_10000936
987 Ga0114129_10002179
988 Ga0114129_10002546
989 Ga0114129_10003145
990 Ga0114129_10032488
991 Ga0114129_10033793
992 Ga0114129_10038131
993 Ga0114129_10067006
994 Ga0114129_10068811
995 Ga0114129_10074936
996 Ga0114129_10130418
997 Ga0114129_10164641
998 Ga0114129_10172338
999 Ga0114129_10209440
1000 Ga0114129_10220806
1001 Ga0114129_10221835
1002 Ga0114129_10247486
1003 Ga0114129_10289126
1004 Ga0114129_10302790
1005 Ga0114129_10887613
1006 Ga0114129_11084599
1007 Ga0114129_11321365
1008 Ga0114129_12005673
1009 Ga0105243_10074374
1010 Ga0105243_10365952
1011 Ga0105243_10801850
1012 Ga0105241_10056393
1013 Ga0105242_10115858
1014 Ga0105242_10294986
1015 Ga0105248_10253330
1016 Ga0105249_10032975
1017 Ga0105249_10146407
1018 Ga0105249_10343728
1019 Ga0157378_10134359
1020 Ga0157378_10325994
1021 Ga0163162_10361488
1022 Ga0163162_11026702
1023 Ga0157375_10027944
1024 Ga0157380_10088611
1025 Ga0157380_10401075
1026 Ga0157380_10859541
1027 Ga0163161_11313563
1028 Ga0163161_11356111
1029 Ga0207653_10042554
1030 Ga0207653_10066264
1031 Ga0207653_10276092
1032 Ga0207682_10241394
1033 Ga0207642_10757642
1034 Ga0207699_10171299
1035 Ga0207643_10058987
1036 Ga0207643_10070594
1037 Ga0207684_10000279
1038 Ga0207684_10027078
1039 Ga0207684_10029855
1040 Ga0207684_10031908
1041 Ga0207684_10052214
1042 Ga0207684_10109606
1043 Ga0207684_10288395
1044 Ga0207684_10918680
1045 Ga0207654_10211002
1046 Ga0207707_10919754
1047 Ga0207693_10008017
1048 Ga0207663_10111240
1049 Ga0207660_10036053
1050 Ga0207660_10249736
1051 Ga0207660_10486612
1052 Ga0207652_10890856
1053 Ga0207646_10001682
1054 Ga0207646_10009939
1055 Ga0207646_10012964
1056 Ga0207646_10050235
1057 Ga0207646_10085961
1058 Ga0207646_10376407
1059 Ga0207646_10498576
1060 Ga0207646_10616436
1061 Ga0207646_11544995
1062 Ga0207681_10041361
1063 Ga0207681_10764307
1064 Ga0207686_10173638
1065 Ga0207709_10051224
1066 Ga0207709_11283086
1067 Ga0207670_10243420
1068 Ga0207665_10177291
1069 Ga0207665_10817724
1070 Ga0207691_10028365
1071 Ga0207691_10388908
1072 Ga0207711_10942719
1073 Ga0207689_10044087
1074 Ga0207668_10069168
1075 Ga0207668_10715662
1076 Ga0207678_11726311
1077 Ga0207708_10021566
1078 Ga0207708_10774759
1079 Ga0207641_10265473
1080 Ga0207648_10056903
1081 Ga0207648_10091112
1082 Ga0207648_10283987
1083 Ga0207674_10007378
1084 Ga0207675_100193065
1085 Ga0207675_100769871
1086 Ga0209998_10004690
1087 Ga0209998_10025546
1088 Ga0209974_10044153
1089 Ga0209974_10178603
1090 Ga0207428_10000245
1091 Ga0207428_10004270
1092 Ga0268265_10233015
1093 Ga0268265_10268030
1094 Ga0268265_10471075
1095 Ga0268265_10489654
1096 Ga0268265_10968279
1097 Ga0268264_10069755
1098 Ga0268264_10071299
1099 Ga0268264_10570120
1100 Ga0268264_10757410
1101 Ga0268264_11151673
1102 Ga0307408_100022228
1103 Ga0307408_100041727
1104 Ga0307408_100254879
1105 Ga0307408_100292207
1106 Ga0307405_10039802
1107 Ga0307405_10289089
1108 Ga0307413_10218524
1109 Ga0307410_10023503
1110 Ga0307410_10251321
1111 Ga0307406_10458934
1112 Ga0307407_10480515
1113 Ga0307412_10040665
1114 Ga0307412_10323865
1115 Ga0307412_11633088
1116 Ga0307409_101416984
1117 Ga0307409_101488719
1118 Ga0307416_100022077
1119 Ga0307416_100145947
1120 Ga0307416_100400976
1121 Ga0307416_100631380
1122 Ga0307411_10280933
1123 Ga0307411_10375752
1124 Ga0307411_10705838
1125 Ga0307411_11998199
1126 Ga0307415_100334346
1127 Ga0373948_0054662
1128 Ga0373950_0030140
1129 Ga0373928_0098891
1130 Ga0373940_0012808
1131 Ga0373952_0220896
1132 Ga0373932_0107471
1133 Ga0373932_0132404
1134 Ga0373939_0052900
1135 Ga0373941_0039268
1136 Ga0373960_0055637
1137 Ga0373942_0190621
1138 Ga0373961_0324295
1139 Ga0373931_0004994
1140 Ga0373931_0007718
1141 Ga0373931_0305879
1142 Ga0373931_0308255
1143 Ga0373933_0738299
1144 Ga0395899_0060029
1145 Ga0395900_0002273
1146 Ga0395898_0005721
1147 Ga0395905_0442526
1148 Ga0395905_1341130
1149 Ga0395905_1678394
1150 Ga0395901_0003758
1151 Ga0395901_0055655
1152 Ga0395901_0753578
1153 Ga0242420_051591
1154 Ga0439441_062306
1155 Ga0439435_0027606
1156 Ga0439444_0120372
1157 Ga0451577_0007999
1158 Ga0451577_0081422
1159 Ga0453683_0012692
1160 Ga0453683_0044671
1161 Ga0453684_0012894
1162 Ga0453684_0912803
1163 Ga0451576_0076218
1164 Ga0451576_0124767
1165 Ga0451576_0220225
1166 Ga0451576_0532873
1167 Ga0451576_0631040
1168 Ga0451576_1540719
1169 Ga0495651_0533363
1170 Ga0495580_0000727
1171 Ga0495594_0537318
1172 Ga0495642_0015743
1173 Ga0495656_0355543
1174 Ga0495659_0012313
1175 Ga0495659_0089643
1176 Ga0495659_0245228
1177 Ga0495599_0287228
1178 Ga0495669_0118584
1179 Ga0495669_0136028
1180 Ga0495669_0497152
1181 Ga0495670_0157312
1182 Ga0495670_0445203
1183 Ga0495636_0152940
1184 Ga0496102_0110019
1185 Ga0496107_0390999
1186 Ga0496107_0691928
1187 Ga0496108_0738107
1188 Ga0496110_0518239
1189 Ga0501300_069219
1190 Ga0501031_0063449
1191 Ga0501031_0424146
1192 Ga0501033_0357373
1193 Ga0501033_0372227
1194 Ga0501034_1621375
1195 Ga0501036_0172493
1196 Ga0501036_0242213
1197 Ga0501036_0384001
1198 Ga0501036_0976461
1199 Ga0501038_0126905
1200 Ga0501038_0242457
1201 Ga0501038_0284015
1202 Ga0501039_0031155
1203 Ga0501039_0347008
1204 Ga0501039_0599061
1205 Ga0501040_0009211
1206 Ga0501040_0023671
1207 Ga0501040_0079661
1208 Ga0501040_0100753
1209 Ga0501040_0109367
1210 Ga0501040_0327448
1211 Ga0501040_0708259
1212 Ga0501040_1039131
1213 Ga0501041_0023765
1214 Ga0501041_0049792
1215 Ga0501041_0228242
1216 Ga0501041_0327258
1217 Ga0501041_0348736
1218 Ga0501042_0064828
1219 Ga0501042_0108459
1220 Ga0501042_0174382
1221 Ga0501042_0176184
1222 Ga0501042_0705064
1223 Ga0501043_0140482
1224 Ga0501046_0060546
1225 Ga0501046_0238736
1226 Ga0501046_0559335
1227 Ga0501048_0043554
1228 Ga0501048_0053701
1229 Ga0501048_0152457
1230 Ga0501048_0252570
1231 Ga0501048_0270229
1232 Ga0501048_0303018
1233 Ga0501048_0379057
1234 Ga0501067_0005543
1235 Ga0501067_0561733
1236 Ga0501068_0013001
1237 Ga0501068_0248674
1238 Ga0501068_0504168
1239 Ga0501069_0016721
1240 Ga0501070_0897884
1241 Ga0501071_0080476
1242 Ga0501071_0139197
1243 Ga0501071_0292835
1244 Ga0501071_0330105
1245 Ga0501071_1292794
1246 Ga0501072_0009215
1247 Ga0501072_0009417
1248 Ga0501072_0017017
1249 Ga0501072_0031838
1250 Ga0501072_0085455
1251 Ga0501072_0119404
1252 Ga0501074_0029591
1253 Ga0501074_0176599
1254 Ga0501074_0309196
1255 Ga0501074_0390724
1256 Ga0501075_0017125
1257 Ga0501075_0039316
1258 Ga0501075_0071430
1259 Ga0501075_0073153
1260 Ga0501075_0111827
1261 Ga0501075_0117283
1262 Ga0501075_0140392
1263 Ga0501075_0448395
1264 Ga0501075_0450619
1265 Ga0501075_0469495
1266 Ga0501075_0557530
1267 Ga0501075_0566312
1268 Ga0501076_0004195
1269 Ga0501076_0004791
1270 Ga0501076_0044357
1271 Ga0501076_0228704
1272 Ga0501076_0247569
1273 Ga0501076_0316402
1274 Ga0501076_0325661
1275 Ga0501076_0563454
1276 Ga0501076_1193117
1277 Ga0501077_0002254
1278 Ga0501077_0010984
1279 Ga0501077_0035456
1280 Ga0501077_0174778
1281 Ga0501077_0266169
1282 Ga0501077_0279734
1283 Ga0501077_0312198
1284 Ga0501077_0495409
1285 Ga0501079_0003482
1286 Ga0501079_0006853
1287 Ga0501079_0029398
1288 Ga0501079_0117707
1289 Ga0501079_0189620
1290 Ga0501079_0309266
1291 Ga0501079_0448675
1292 Ga0501079_0658340
1293 Ga0501079_0944873
1294 Ga0501080_0397600
1295 Ga0501080_0525745
1296 Ga0501080_0544081
1297 Ga0501080_1535717
1298 Ga0501081_0008422
1299 Ga0501081_0009802
1300 Ga0501081_0014285
1301 Ga0501081_0024059
1302 Ga0501081_0028858
1303 Ga0501081_0070819
1304 Ga0501081_0084077
1305 Ga0501081_0126296
1306 Ga0501081_0442769
1307 Ga0501081_0473916
1308 Ga0501081_0541020
1309 Ga0501081_0735259
1310 Ga0501081_0903147
1311 Ga0501083_0131626
1312 Ga0501083_0437523
1313 Ga0501282_025703
1314 Ga0501035_0073871
1315 Ga0501045_0013331
1316 Ga0501045_0030507
1317 Ga0501045_0037908
1318 Ga0501045_0090930
1319 Ga0501045_0184111
1320 Ga0501045_0195408
1321 Ga0501045_0216333
1322 Ga0501045_0524112
1323 Ga0501045_1069519
1324 Ga0501045_1212638
1325 nmdc:mga05p37_10163_c1
1326 nmdc:mga05p37_108157_c1
1327 nmdc:mga05p37_109421_c1
1328 nmdc:mga05p37_126732_c1
1329 nmdc:mga05p37_1878110_c1
1330 nmdc:mga05p37_233057_c1
1331 nmdc:mga05p37_26803_c1
1332 nmdc:mga05p37_284011_c1
1333 nmdc:mga05p37_30965_c1
1334 nmdc:mga05p37_382309_c1
1335 nmdc:mga05p37_409118_c1
1336 nmdc:mga05p37_412086_c1
1337 nmdc:mga05p37_412617_c1
1338 nmdc:mga05p37_420622_c1
1339 nmdc:mga05p37_4364_c1
1340 nmdc:mga05p37_700006_c1
1341 nmdc:mga05p37_731799_c1
1342 nmdc:mga05p37_769_c1
1343 nmdc:mga09592_1309803_c1
1344 nmdc:mga09592_1895_c1
1345 nmdc:mga09592_221149_c1
1346 nmdc:mga09592_276351_c1
1347 nmdc:mga09592_300914_c1
1348 nmdc:mga09592_354829_c1
1349 nmdc:mga09592_3897_c1
1350 nmdc:mga09592_39234_c1
1351 nmdc:mga09592_41408_c1
1352 nmdc:mga09592_4917_c1
1353 nmdc:mga09592_71396_c1
1354 nmdc:mga09592_908671_c1
1355 nmdc:mga0qj67_1151206_c1
1356 nmdc:mga0qj67_1315430_c1
1357 nmdc:mga0qj67_140_c1
1358 nmdc:mga0qj67_174077_c1
1359 nmdc:mga0qj67_215187_c1
1360 nmdc:mga0qj67_215641_c1
1361 nmdc:mga0qj67_3069_c1
1362 nmdc:mga0qj67_3096_c1
1363 nmdc:mga0qj67_67864_c1
1364 nmdc:mga0qj67_80757_c1
1365 nmdc:mga06r32_1249335_c1
1366 nmdc:mga06r32_1336980_c1
1367 nmdc:mga06r32_170907_c1
1368 nmdc:mga06r32_171157_c1
1369 nmdc:mga06r32_1729_c1
1370 nmdc:mga06r32_193211_c1
1371 nmdc:mga06r32_24549_c1
1372 nmdc:mga06r32_34664_c1
1373 nmdc:mga06r32_422994_c1
1374 nmdc:mga06r32_520830_c1
1375 nmdc:mga06r32_54900_c1
1376 nmdc:mga06r32_63685_c1
1377 nmdc:mga06r32_74951_c1
1378 nmdc:mga06r32_90146_c1
1379 nmdc:mga06r32_94369_c1
1380 nmdc:mga08y16_10911_c1
1381 nmdc:mga08y16_216936_c1
1382 nmdc:mga08y16_472695_c1
1383 nmdc:mga08y16_597_c1
1384 nmdc:mga08y16_741025_c1
1385 nmdc:mga08y16_821526_c1
1386 nmdc:mga0n895_101662_c1
1387 nmdc:mga0n895_13952_c1
1388 nmdc:mga0n895_1725634_c1
1389 nmdc:mga0n895_174341_c1
1390 nmdc:mga0n895_313528_c1
1391 nmdc:mga0n895_318154_c1
1392 nmdc:mga0n895_33104_c1
1393 nmdc:mga0n895_33668_c1
1394 nmdc:mga0n895_377397_c1
1395 nmdc:mga0n895_41999_c1
1396 nmdc:mga0n895_42453_c1
1397 nmdc:mga0n895_51573_c1
1398 nmdc:mga0n895_529368_c1
1399 nmdc:mga0n895_59266_c1
1400 nmdc:mga0n895_714246_c1
1401 nmdc:mga0n895_730721_c1
1402 nmdc:mga0n895_7777_c1
1403 nmdc:mga0n895_99484_c1
1404 nmdc:mga0rr50_1126458_c1
1405 nmdc:mga0rr50_13421_c1
1406 nmdc:mga0rr50_1444113_c1
1407 nmdc:mga0rr50_35091_c1
1408 nmdc:mga0rr50_402707_c1
1409 nmdc:mga0rr50_549_c1
1410 nmdc:mga0rr50_57683_c1
1411 nmdc:mga0rr50_621217_c1
1412 nmdc:mga0rr50_6828_c1
1413 nmdc:mga0rr50_73908_c1
1414 nmdc:mga0rr50_793935_c1
1415 nmdc:mga0rr50_905811_c1
1416 nmdc:mga0rr50_90901_c1
1417 nmdc:mga08x19_147522_c1
1418 nmdc:mga08x19_2496_c1
1419 nmdc:mga08x19_285394_c1
1420 nmdc:mga08x19_788244_c1
1421 nmdc:mga08x19_799186_c1
1422 nmdc:mga0a205_1170_c1
1423 nmdc:mga0a205_120732_c1
1424 nmdc:mga0a205_1991_c1
1425 nmdc:mga0a205_200726_c1
1426 nmdc:mga0a205_222243_c1
1427 nmdc:mga0a205_289_c1
1428 nmdc:mga0a205_313057_c1
1429 nmdc:mga0a205_36892_c1
1430 nmdc:mga0a205_3849_c1
1431 nmdc:mga0a205_38662_c1
1432 nmdc:mga0a205_452388_c1
1433 nmdc:mga0a205_6265_c1
1434 nmdc:mga0a205_84490_c1
1435 nmdc:mga0a205_99309_c1
1436 Ga0501084_0023274
1437 Ga0501084_0040553
1438 Ga0501084_0181371
1439 Ga0501084_0278638
1440 Ga0501084_0662004
1441 Ga0501084_0751713
1442 Ga0501084_0805087
1443 Ga0501084_0986773
1444 Ga0590077_021878
1445 Ga0501082_0005963
1446 Ga0501082_0197826
1447 Ga0501082_0216400
1448 Ga0501082_0280139
1449 Ga0501082_0538165
1450 Ga0501082_0587726
1451 Ga0501082_0619881
1452 Ga0530510_0011819
1453 Ga0530510_0040714
1454 Ga0530510_0049234
1455 Ga0530510_0077559
1456 Ga0530510_0189078
1457 Ga0530510_0453693
1458 Ga0530510_1412237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

12

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.918 5 111
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.9125 7 115
4wcw-assembly2.cif.gz_C ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9096 5 116
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.899 16 114
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.8964 7 115
ID Description Score Start End Superfamily
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9485 7 108 3.30.460.10
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.948 13 108 3.30.460.10
af_A0A0R0INC8_150_261_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9476 6 115 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9218 7 108 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9209 5 111 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A3D0D7H8-F1-model_v4 Ribosomal silencing factor RsfS 0.9852 6 114 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-X1KE50-F1-model_v4 Ribosome silencing factor 0.9851 6 114 GO:0017148
GO:0043023
GO:0090071
AF-A0A1F8MMZ1-F1-model_v4 Ribosomal silencing factor RsfS 0.9847 6 114 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A7V4ZBN5-F1-model_v4 Ribosomal silencing factor RsfS 0.9842 6 114 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A7I8EZ54-F1-model_v4 Ribosomal silencing factor RsfS 0.9828 7 114 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Map