F477750

General Info

Members Datasets Scaffolds Average Seq Length
727 474 546 262

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10015912|Ga0307515_100159125
Length 290
Sequence MPTTARWVRSRSASSEGRIVRTPINPFKHALREGRVQIGLWVGLADAYAIEAMAGAGFDWLLIDGEHAPNDLRTVLGQLQAVAPYPTHAIVRPVIGDVALIKQLLDVGAQTLLVPVVETSEQAATLVAATRYPPRGIRGVGSALARSSRWNQIGDYLHTADEQMCVLLQVETKKGVDNLAAIAATEGVDGVFFGPADLSASMGLLGQPGHPDVQRAILDGIAVVRAAGKAPGVLSPDPKLARLYLGAGALFVAVGVDTTLLIRACRDLAAAYKNNADKVASAASAPGGAY

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
10 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
11 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
14 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
15 2519899620 Rhizobium sp. Pop5 Isolate Nodule
16 2534681786 Brucella suis 92/29 Isolate Unclassified
17 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
18 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
19 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
20 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
21 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
22 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
23 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
24 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
25 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
26 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
27 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
28 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
29 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
30 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
31 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
32 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
33 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
34 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
35 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
36 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
37 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
38 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
39 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
40 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
41 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
42 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
43 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
44 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
45 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
46 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
47 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
48 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
49 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
50 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
51 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
52 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
53 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
54 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
55 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
56 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
57 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
58 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
59 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
60 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
61 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
62 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
63 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
64 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
65 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
66 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
67 2636415599 Klebsiella variicola DX120E Isolate Unclassified
68 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
69 2643221580 Devosia sp. Root635 Isolate Unclassified
70 2643221599 Rhizobium sp. Root708 Isolate Unclassified
71 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
72 2643221609 Acidovorax sp. Root217 Isolate Unclassified
73 2643221611 Acidovorax sp. Root219 Isolate Unclassified
74 2643221618 Ensifer sp. Root231 Isolate Unclassified
75 2643221626 Ensifer sp. Root31 Isolate Unclassified
76 2643221655 Ensifer sp. Root1252 Isolate Unclassified
77 2643221658 Variovorax sp. Root411 Isolate Unclassified
78 2643221659 Ensifer sp. Root127 Isolate Unclassified
79 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
80 2643221698 Ensifer sp. Root142 Isolate Unclassified
81 2643221712 Ensifer sp. Root258 Isolate Unclassified
82 2643221723 Ensifer sp. Root278 Isolate Unclassified
83 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
84 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
85 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
86 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
87 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
88 2718217927 Rhizobium sp. N324 Isolate Nodule
89 2718218423 Rhizobium sp. N941 Isolate Nodule
90 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
91 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
92 2721755809 Rhizobium sp. N541 Isolate Nodule
93 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
94 2738543012 Acidovorax sp. CF301 Isolate Unclassified
95 2738543024 Aminobacter sp. AP02 Isolate Unclassified
96 2751185917 Enterobacter sp. HK169 Isolate Unclassified
97 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
98 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
99 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
100 2775507074 Klebsiella sp. D5A Isolate Unclassified
101 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
102 2791355261 Rhizobium sp. J15 Isolate Nodule
103 2791355263 Rhizobium chutanense C5 Isolate Nodule
104 2791355266 Rhizobium sp. L43 Isolate Nodule
105 2791355267 Rhizobium sp. L18 Isolate Nodule
106 2802429634 Rhizobium anhuiense S10 Isolate Nodule
107 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
108 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
109 2816332133 Acidovorax radicis 2721A Isolate Unclassified
110 2821118458 Enterobacter asburiae 609 Isolate Unclassified
111 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
112 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
113 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
114 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
115 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
116 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
117 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
118 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
119 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
120 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
121 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
122 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
123 2844163670 Ensifer sp. 1H6 Isolate Unclassified
124 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
125 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
126 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
127 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
128 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
129 2855730933 Achromobacter sp. HZ28 Isolate Nodule
130 2855767633 Achromobacter sp. HZ34 Isolate Nodule
131 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
132 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
133 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
134 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
135 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
136 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
137 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
138 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
139 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
140 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
141 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
142 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
143 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
144 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
145 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
146 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
147 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
148 2936381700 Rhizobium chutanense C16 Isolate Unclassified
149 2937539931 Pantoea sp. LS15 Isolate Unclassified
150 2937967321 Serratia sp. YC16 Isolate Unclassified
151 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
152 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
153 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
154 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
155 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
156 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
157 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
158 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
159 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
160 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
161 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
162 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
163 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
164 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
165 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
166 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
167 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
168 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
169 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
170 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
171 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
172 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
173 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
174 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
175 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
176 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
177 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
178 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
179 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
180 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
181 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
182 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
183 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
184 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
185 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
186 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
187 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
188 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
189 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
190 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
191 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
192 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
193 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
194 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
195 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
196 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
197 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
198 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
199 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
200 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
201 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
202 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
203 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
204 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
205 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
206 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
207 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
208 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
209 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
210 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
211 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
212 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
213 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
214 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
215 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
216 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
217 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
218 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
219 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
220 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
221 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
222 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
223 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
224 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
225 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
226 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
227 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
228 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
229 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
230 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
231 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
232 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
233 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
234 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
235 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
236 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
237 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
238 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
239 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
240 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
241 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
242 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
247 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
248 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
250 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
251 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
253 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
254 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
260 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
262 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
264 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
265 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
290 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
294 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
295 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
296 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
297 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
298 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
299 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
300 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
301 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
302 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
303 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
304 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
305 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
306 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
307 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
313 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
314 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
315 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
316 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
317 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
318 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
319 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
320 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
321 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
322 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
323 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
324 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
325 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
326 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
327 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
328 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
329 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
330 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
331 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
332 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
333 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
334 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
335 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
336 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
337 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
338 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
339 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
340 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
341 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
344 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
347 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
354 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
355 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
356 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
357 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
363 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
364 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
365 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
366 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
367 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
368 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
369 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
370 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
371 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
372 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
373 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
374 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
375 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
376 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
377 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
378 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
379 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
380 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
381 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
382 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
383 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
384 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
385 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
386 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
387 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
388 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
389 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
390 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
391 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
392 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
393 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
394 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
395 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
396 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
397 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
398 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
399 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
400 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
401 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
405 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
406 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
407 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
408 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
409 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
410 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
411 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
414 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
429 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
438 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
439 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
440 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
441 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
442 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
445 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
446 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
447 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
448 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
449 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
450 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
451 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
452 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
453 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
454 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
455 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
456 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
457 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
458 8004592986 Serratia sp. S119 Isolate Unclassified
459 8005258706 Rhizobium sp. R693 Isolate Nodule
460 8005275841 Rhizobium sp. N4311 Isolate Nodule
461 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
462 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
463 8005382845 Rhizobium sp. R634 Isolate Nodule
464 8005395548 Rhizobium sp. R339 Isolate Nodule
465 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
466 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
467 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
468 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
469 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
470 8018176218 Rhizobium sp. N122 Isolate Nodule
471 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
472 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
473 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
474 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.38
Metatranscriptomes 0
Isolates 24.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 10.73
Nodule 9.08
Rhizoplane 7.29
Rhizosphere 51.17
Stem 0
Stem Tuber 0
Unclassified 21.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10049299 3300001989 Bacteria 1366
2 JGI25155J39150_1000046 3300002704 Bacteria 80685
3 JGI25156J39149_1000070 3300002705 Bacteria 80840
4 JGI25156J39149_1000187 3300002705 Bacteria 44719
5 JGI25156J39149_1000471 3300002705 Bacteria 24262
6 JGI25162J39368_1000247 3300002737 Bacteria 54064
7 JGI25162J39368_1001794 3300002737 Bacteria 10117
8 JGI25154J39366_1000092 3300002738 Bacteria 80685
9 JGI25157J39369_1000087 3300002741 Bacteria 80840
10 JGI25165J46597_1000237 3300003214 Bacteria 75663
11 JGI25165J46597_1000412 3300003214 Bacteria 44966
12 JGI25165J46597_1001282 3300003214 Bacteria 14605
13 rootH2_10191272 3300003320 Bacteria 1090
14 rootL2_10131760 3300003322 Bacteria 1363
15 rootH1_10119104 3300003323 Bacteria 2519
16 JGI25160J50197_1000075 3300003354 Bacteria 102429
17 JGI25161J50226_1001805 3300003374 Bacteria 6012
18 Ga0055533_1000226 3300003756 Bacteria 37966
19 Ga0055532_1000007 3300003758 Bacteria 429810
20 Ga0055527_1000007 3300003760 Bacteria 429810
21 Ga0055535_1000005 3300003761 Bacteria 429810
22 Ga0055542_1000008 3300003762 Bacteria 429810
23 Ga0055529_1000005 3300003763 Bacteria 429810
24 Ga0055526_1002641 3300003771 Bacteria 11971
25 Ga0055536_1003181 3300003781 Bacteria 8897
26 Ga0055530_10010182 3300003791 Bacteria 3508
27 Ga0055540_1000131 3300003792 Bacteria 75615
28 Ga0055540_1005314 3300003792 Bacteria 5467
29 Ga0058692_1000523 3300003856 Bacteria 16876
30 Ga0058692_1002123 3300003856 Bacteria 6839
31 Ga0065165_1000206 3300005262 Bacteria 102467
32 Ga0065165_1000582 3300005262 Bacteria 53862
33 Ga0065704_10003528 3300005289 Bacteria 5077
34 Ga0070670_100006693 3300005331 Bacteria 9768
35 Ga0070666_10149501 3300005335 Bacteria 1629
36 Ga0070680_100285077 3300005336 Bacteria 1400
37 Ga0068868_100020334 3300005338 Bacteria 4985
38 Ga0070675_100029265 3300005354 Bacteria 4441
39 Ga0070671_100152962 3300005355 Bacteria 1948
40 Ga0070674_100010795 3300005356 Bacteria 5538
41 Ga0070667_100120995 3300005367 Bacteria 2277
42 Ga0070713_100161910 3300005436 Bacteria 1998
43 Ga0070711_100112631 3300005439 Bacteria 1999
44 Ga0070678_100000882 3300005456 Bacteria 15382
45 Ga0070662_100391366 3300005457 Bacteria 1146
46 Ga0070681_10034234 3300005458 Bacteria 5102
47 Ga0068867_100091852 3300005459 Bacteria 2305
48 Ga0068867_100303844 3300005459 Bacteria 1316
49 Ga0070679_100010359 3300005530 Bacteria 8842
50 Ga0070672_100036017 3300005543 Bacteria 3766
51 Ga0070696_100000838 3300005546 Bacteria 19828
52 Ga0070665_100000140 3300005548 Bacteria 135833
53 Ga0070665_100170665 3300005548 Bacteria 2176
54 Ga0070664_100183309 3300005564 Bacteria 1862
55 Ga0068857_100000109 3300005577 Bacteria 48663
56 Ga0068857_100175628 3300005577 Bacteria 1948
57 Ga0068856_100065639 3300005614 Bacteria 3587
58 Ga0068859_100450776 3300005617 Bacteria 1383
59 Ga0068859_101163949 3300005617 Bacteria 849
60 Ga0068851_10004168 3300005834 Bacteria 6509
61 Ga0068862_100732733 3300005844 Bacteria 960
62 Ga0075363_100108886 3300006048 Bacteria 1539
63 Ga0075362_10053857 3300006177 Bacteria 1807
64 Ga0075370_10141408 3300006353 Bacteria 1407
65 Ga0068871_100052158 3300006358 Bacteria 3312
66 Ga0097620_100450721 3300006931 Bacteria 1383
67 Ga0097620_101164072 3300006931 Bacteria 849
68 Ga0079104_1000062 3300006946 Bacteria 160162
69 Ga0079104_1002067 3300006946 Bacteria 11606
70 Ga0079104_1014185 3300006946 Bacteria 2414
71 Ga0079104_1020725 3300006946 Bacteria 1804
72 Ga0105251_10000340 3300009011 Bacteria 46427
73 Ga0105251_10001782 3300009011 Bacteria 17891
74 Ga0105251_10003198 3300009011 Bacteria 12097
75 Ga0105251_10020458 3300009011 Bacteria 3476
76 Ga0105251_10147970 3300009011 Bacteria 1061
77 Ga0105251_10183185 3300009011 Bacteria 943
78 Ga0105244_10000137 3300009036 Bacteria 75679
79 Ga0105244_10000297 3300009036 Bacteria 48618
80 Ga0105244_10001231 3300009036 Bacteria 21011
81 Ga0105244_10006556 3300009036 Bacteria 7508
82 Ga0105244_10013152 3300009036 Bacteria 4849
83 Ga0105244_10060979 3300009036 Bacteria 1899
84 Ga0105250_10000045 3300009092 Bacteria 127333
85 Ga0105240_10371559 3300009093 Bacteria 1617
86 Ga0105245_10084105 3300009098 Bacteria 2914
87 Ga0105243_10000988 3300009148 Bacteria 26450
88 Ga0105242_10815997 3300009176 Bacteria 925
89 Ga0105248_10619539 3300009177 Bacteria 1221
90 Ga0105246_10069694 3300011119 Bacteria 2471
91 Ga0157373_10001795 3300013100 Bacteria 16323
92 Ga0157373_10017986 3300013100 Bacteria 5148
93 Ga0157371_10055756 3300013102 Bacteria 2804
94 Ga0157378_10067583 3300013297 Bacteria 3203
95 Ga0157378_10312058 3300013297 Unclassified 1525
96 Ga0157375_10103579 3300013308 Bacteria 2933
97 Ga0157377_10073996 3300014745 Bacteria 1976
98 Ga0157379_10644924 3300014968 Bacteria 991
99 Ga0182007_10000594 3300015262 Bacteria 21139
100 Ga0183366_1003 3300015679 Bacteria 453474
101 Ga0183370_1003 3300015680 Bacteria 454044
102 Ga0183369_1005 3300015685 Bacteria 453680
103 Ga0183368_1006 3300015687 Bacteria 551576
104 Ga0183361_10004 3300016635 Bacteria 484183
105 Ga0163161_10047086 3300017792 Bacteria 3114
106 Ga0163161_10280310 3300017792 Bacteria 1307
107 Ga0214542_1000064 3300021321 Bacteria 127681
108 Ga0214543_1000063 3300021327 Bacteria 127694
109 Ga0213872_10060518 3300021361 Bacteria 1713
110 Ga0213871_10020319 3300021441 Bacteria 1644
111 Ga0209435_100059 3300025206 Bacteria 80744
112 Ga0209674_100020 3300025226 Bacteria 672397
113 Ga0209672_100013 3300025228 Bacteria 740693
114 Ga0209672_102901 3300025228 Bacteria 3835
115 Ga0209147_100013 3300025229 Bacteria 660057
116 Ga0209563_100318 3300025230 Bacteria 19049
117 Ga0209563_101384 3300025230 Bacteria 6524
118 Ga0207427_101321 3300025231 Bacteria 9287
119 Ga0209437_100042 3300025233 Bacteria 444095
120 Ga0209437_100062 3300025233 Bacteria 336900
121 Ga0209258_100016 3300025242 Bacteria 668622
122 Ga0209646_1000179 3300025246 Bacteria 80892
123 Ga0209026_1000212 3300025250 Bacteria 80892
124 Ga0209148_1000020 3300025254 Bacteria 740693
125 Ga0209759_1000022 3300025256 Bacteria 329136
126 Ga0209759_1000130 3300025256 Bacteria 130638
127 Ga0209759_1000246 3300025256 Bacteria 80892
128 Ga0209233_1000054 3300025261 Bacteria 439669
129 Ga0209233_1000055 3300025261 Bacteria 439422
130 Ga0209233_1000082 3300025261 Bacteria 336320
131 Ga0209565_1019341 3300025263 Bacteria 1456
132 Ga0209455_1000017 3300025272 Bacteria 740693
133 Ga0209673_1000642 3300025273 Bacteria 52672
134 Ga0209130_1000154 3300025284 Bacteria 102645
135 Ga0209676_1001353 3300025292 Bacteria 24341
136 Ga0209676_1023678 3300025292 Bacteria 2005
137 Ga0209025_1000003 3300025294 Bacteria 1366495
138 Ga0209025_1000032 3300025294 Bacteria 416141
139 Ga0209564_1000025 3300025295 Bacteria 520535
140 Ga0209758_1000121 3300025297 Bacteria 192028
141 Ga0209050_1003378 3300025298 Bacteria 11868
142 Ga0209050_1017746 3300025298 Bacteria 2813
143 Ga0209256_1000907 3300025299 Bacteria 36321
144 Ga0207426_1000286 3300025302 Bacteria 102853
145 Ga0209051_1000038 3300025303 Bacteria 320926
146 Ga0209051_1002477 3300025303 Bacteria 13187
147 Ga0209051_1010423 3300025303 Bacteria 4695
148 Ga0209257_1006839 3300025304 Bacteria 7161
149 Ga0209257_1013777 3300025304 Bacteria 3550
150 Ga0207696_1000140 3300025711 Bacteria 127393
151 Ga0207696_1026922 3300025711 Bacteria 1776
152 Ga0207655_1000026 3300025728 Bacteria 445528
153 Ga0207655_1000054 3300025728 Bacteria 281894
154 Ga0207655_1000218 3300025728 Bacteria 98543
155 Ga0207655_1000465 3300025728 Bacteria 53059
156 Ga0207655_1002093 3300025728 Bacteria 16726
157 Ga0207655_1019256 3300025728 Bacteria 3578
158 Ga0207713_1000046 3300025735 Bacteria 232796
159 Ga0207713_1000110 3300025735 Bacteria 135907
160 Ga0207713_1000136 3300025735 Bacteria 112016
161 Ga0207713_1000617 3300025735 Bacteria 34888
162 Ga0207713_1004573 3300025735 Bacteria 8951
163 Ga0207713_1006558 3300025735 Bacteria 7064
164 Ga0207713_1015525 3300025735 Bacteria 3903
165 Ga0207713_1054244 3300025735 Bacteria 1573
166 Ga0207713_1105338 3300025735 Bacteria 966
167 Ga0207680_10031534 3300025903 Bacteria 3003
168 Ga0207647_10010197 3300025904 Bacteria 6639
169 Ga0207645_10010389 3300025907 Bacteria 6391
170 Ga0207695_10172925 3300025913 Bacteria 2084
171 Ga0207663_10064156 3300025916 Bacteria 2343
172 Ga0207660_10027724 3300025917 Bacteria 3869
173 Ga0207681_10255902 3300025923 Bacteria 1369
174 Ga0207650_10064575 3300025925 Bacteria 2740
175 Ga0207700_10056489 3300025928 Bacteria 2955
176 Ga0207709_10049583 3300025935 Bacteria 2564
177 Ga0207691_10004147 3300025940 Bacteria 14080
178 Ga0207691_10028325 3300025940 Bacteria 5246
179 Ga0207711_10375286 3300025941 Bacteria 1319
180 Ga0207689_10093009 3300025942 Bacteria 2477
181 Ga0207679_10067309 3300025945 Bacteria 2687
182 Ga0207651_10025239 3300025960 Bacteria 3692
183 Ga0207702_10048219 3300026078 Bacteria 3591
184 Ga0207648_10038166 3300026089 Bacteria 4227
185 Ga0207648_10090932 3300026089 Bacteria 2667
186 Ga0207674_10001309 3300026116 Bacteria 32525
187 Ga0207674_10024806 3300026116 Bacteria 6401
188 Ga0207683_10009055 3300026121 Bacteria 8485
189 Ga0209281_1000001 3300027111 Bacteria 1933496
190 Ga0209281_1000054 3300027111 Bacteria 309505
191 Ga0209281_1000384 3300027111 Bacteria 70059
192 Ga0209281_1000489 3300027111 Bacteria 54514
193 Ga0209281_1004123 3300027111 Bacteria 4457
194 Ga0209371_1000030 3300027312 Bacteria 423605
195 Ga0209371_1000658 3300027312 Bacteria 30121
196 Ga0209371_1000991 3300027312 Bacteria 21858
197 Ga0209371_1002199 3300027312 Bacteria 11356
198 Ga0209371_1007031 3300027312 Bacteria 4015
199 Ga0268266_10000143 3300028379 Bacteria 135829
200 Ga0268265_10471703 3300028380 Bacteria 1177
201 Ga0307515_10000047 3300028794 Bacteria 291475
202 Ga0307515_10001099 3300028794 Bacteria 61933
203 Ga0307515_10011208 3300028794 Bacteria 17036
204 Ga0307515_10015912 3300028794 Bacteria 13817
205 Ga0265338_10001045 3300028800 Bacteria 46256
206 Ga0268256_1000025 3300030500 Bacteria 484317
207 Ga0268256_1001720 3300030500 Bacteria 12440
208 Ga0268256_1001933 3300030500 Bacteria 11350
209 Ga0268256_1002858 3300030500 Bacteria 8323
210 Ga0268256_1009831 3300030500 Bacteria 3136
211 Ga0265340_10035682 3300031247 Bacteria 2469
212 Ga0307513_10000998 3300031456 Bacteria 40880
213 Ga0307513_10087798 3300031456 Bacteria 3181
214 Ga0307509_10008905 3300031507 Bacteria 12655
215 Ga0307408_100010337 3300031548 Bacteria 6155
216 Ga0307508_10003337 3300031616 Bacteria 16302
217 Ga0307516_10000114 3300031730 Bacteria 93691
218 Ga0307516_10000419 3300031730 Bacteria 55599
219 Ga0307416_100622656 3300032002 Bacteria 1161
220 Ga0307414_10159919 3300032004 Bacteria 1788
221 Ga0373935_0053068 3300035692 Bacteria 2579
222 Ga0373927_0000177 3300035695 Bacteria 50406
223 Ga0373933_0075364 3300035724 Bacteria 2060
224 Ga0373937_0151921 3300036401 Bacteria 2169
225 Ga0373925_0000912 3300037068 Bacteria 26965
226 Ga0395899_0001754 3300037312 Bacteria 18009
227 Ga0395900_0021658 3300037418 Bacteria 6571
228 Ga0395900_0038952 3300037418 Bacteria 4900
229 Ga0395898_0002919 3300037466 Bacteria 19457
230 Ga0395905_0000024 3300037471 Bacteria 318806
231 Ga0395905_0002011 3300037471 Bacteria 23225
232 Ga0395905_0007778 3300037471 Bacteria 10631
233 Ga0395905_0018804 3300037471 Bacteria 6553
234 Ga0395905_0029094 3300037471 Bacteria 5207
235 Ga0395905_0101864 3300037471 Bacteria 2695
236 Ga0395905_0172136 3300037471 Bacteria 2034
237 Ga0436364_0186364 3300037853 Bacteria 8460
238 Ga0395901_0001521 3300038443 Bacteria 24065
239 Ga0395901_0014476 3300038443 Bacteria 8023
240 Ga0395901_0073792 3300038443 Bacteria 3559
241 Ga0237819_01205 3300038705 Bacteria 7222
242 Ga0400483_085316 3300039062 Bacteria 1469
243 Ga0237816_00244 3300039145 Bacteria 4536
244 Ga0436360_0173811 3300039438 Bacteria 3255
245 Ga0436361_0092104 3300039447 Bacteria 1754
246 Ga0439438_006446 3300041405 Bacteria 4134
247 Ga0451833_0369965 3300041491 Bacteria 43703
248 Ga0451835_0404639 3300041492 Bacteria 14317
249 Ga0451837_0964406 3300041494 Bacteria 15188
250 Ga0451839_0063950 3300041496 Bacteria 43670
251 Ga0451841_0182197 3300041498 Bacteria 12038
252 Ga0451845_0249129 3300041501 Bacteria 20670
253 Ga0451847_0341155 3300041503 Bacteria 20211
254 Ga0451849_0939399 3300041505 Bacteria 14214
255 Ga0451851_1180298 3300041507 Bacteria 43516
256 Ga0451843_0385556 3300041509 Bacteria 1865
257 Ga0451843_1397501 3300041509 Bacteria 14581
258 Ga0451855_0055849 3300041511 Bacteria 12766
259 Ga0451855_1631046 3300041511 Bacteria 1155
260 Ga0451853_1250503 3300041512 Bacteria 1415
261 Ga0451853_2474193 3300041512 Bacteria 23134
262 Ga0439432_048146 3300042006 Bacteria 1335
263 Ga0439452_000412 3300042010 Bacteria 25119
264 Ga0451577_0470683 3300042876 Bacteria 1141
265 Ga0466981_0000014 3300044669 Bacteria 109658
266 Ga0466963_0005557 3300044694 Bacteria 7387
267 Ga0466970_0000134 3300044765 Bacteria 33918
268 Ga0466957_0030295 3300044842 Bacteria 3230
269 Ga0451576_0114638 3300045051 Bacteria 2806
270 Ga0495617_003125 3300046452 Bacteria 6306
271 Ga0495592_0004344 3300046454 Bacteria 10374
272 Ga0495603_0002559 3300046455 Bacteria 10720
273 Ga0495590_0092750 3300046457 Bacteria 1069
274 Ga0495629_0003049 3300046459 Bacteria 12734
275 Ga0495629_0025918 3300046459 Bacteria 4165
276 Ga0495629_0118204 3300046459 Bacteria 1847
277 Ga0495638_0014953 3300046460 Bacteria 5225
278 Ga0495638_0026524 3300046460 Bacteria 3755
279 Ga0495638_0081697 3300046460 Bacteria 1961
280 Ga0495641_0008131 3300046461 Bacteria 6442
281 Ga0495641_0081729 3300046461 Bacteria 1447
282 Ga0495651_0005709 3300046462 Bacteria 9484
283 Ga0495651_0307731 3300046462 Bacteria 1061
284 Ga0495653_0000659 3300046463 Bacteria 26397
285 Ga0495653_0001901 3300046463 Bacteria 16471
286 Ga0495653_0032641 3300046463 Bacteria 4132
287 Ga0495650_0002436 3300046471 Bacteria 15066
288 Ga0495650_0005337 3300046471 Bacteria 8386
289 Ga0495580_0000021 3300046472 Bacteria 90091
290 Ga0495580_0001238 3300046472 Bacteria 22522
291 Ga0495580_0014453 3300046472 Bacteria 5987
292 Ga0495580_0020437 3300046472 Bacteria 4898
293 Ga0495582_0002256 3300046473 Bacteria 10784
294 Ga0495582_0092275 3300046473 Bacteria 1689
295 Ga0495605_0010038 3300046474 Bacteria 5303
296 Ga0495662_0084966 3300046476 Bacteria 1541
297 Ga0495662_0109843 3300046476 Bacteria 1351
298 Ga0495584_0081868 3300046491 Bacteria 1625
299 Ga0495585_0006532 3300046492 Bacteria 7218
300 Ga0495585_0021114 3300046492 Bacteria 3740
301 Ga0495596_0001307 3300046500 Bacteria 14361
302 Ga0495596_0011920 3300046500 Bacteria 3733
303 Ga0495607_0081465 3300046501 Bacteria 1777
304 Ga0495583_0000671 3300046506 Bacteria 44728
305 Ga0495583_0003979 3300046506 Bacteria 10910
306 Ga0495606_0005492 3300046507 Bacteria 12133
307 Ga0495606_0006456 3300046507 Bacteria 10804
308 Ga0495606_0035379 3300046507 Bacteria 3414
309 Ga0495606_0211131 3300046507 Bacteria 1099
310 Ga0495608_0001999 3300046511 Bacteria 14606
311 Ga0495608_0014577 3300046511 Bacteria 5454
312 Ga0495616_0011116 3300046513 Bacteria 5170
313 Ga0495618_0004019 3300046514 Bacteria 9072
314 Ga0495618_0007368 3300046514 Bacteria 6657
315 Ga0495618_0128594 3300046514 Bacteria 1621
316 Ga0495628_0000533 3300046516 Bacteria 34811
317 Ga0495628_0057977 3300046516 Bacteria 3045
318 Ga0495628_0074099 3300046516 Bacteria 2652
319 Ga0495630_0001115 3300046517 Bacteria 18481
320 Ga0495630_0004447 3300046517 Bacteria 9829
321 Ga0495630_0019106 3300046517 Bacteria 5036
322 Ga0495630_0057441 3300046517 Bacteria 2916
323 Ga0495630_0177749 3300046517 Bacteria 1622
324 Ga0495637_0013863 3300046520 Bacteria 3816
325 Ga0495644_0006675 3300046523 Bacteria 4470
326 Ga0495648_0006451 3300046524 Bacteria 9574
327 Ga0495648_0033546 3300046524 Bacteria 3350
328 Ga0495648_0039866 3300046524 Bacteria 2984
329 Ga0495648_0062657 3300046524 Bacteria 2200
330 Ga0495666_0001889 3300046526 Bacteria 10339
331 Ga0495666_0005660 3300046526 Bacteria 6294
332 Ga0495666_0009162 3300046526 Bacteria 4950
333 Ga0495652_0007568 3300046529 Bacteria 10010
334 Ga0495654_0062959 3300046530 Bacteria 1777
335 Ga0495665_0006800 3300046531 Bacteria 6168
336 Ga0495665_0006996 3300046531 Bacteria 6086
337 Ga0495665_0055384 3300046531 Bacteria 2094
338 Ga0495665_0114791 3300046531 Bacteria 1411
339 Ga0495640_0006139 3300046533 Bacteria 9522
340 Ga0495640_0029325 3300046533 Bacteria 3951
341 Ga0495586_0021480 3300046535 Bacteria 3441
342 Ga0495587_0005309 3300046536 Bacteria 8423
343 Ga0495587_0010870 3300046536 Bacteria 5777
344 Ga0495609_0141802 3300046538 Bacteria 1025
345 Ga0495597_0118656 3300046542 Bacteria 1104
346 Ga0495645_0000313 3300046543 Bacteria 34983
347 Ga0495622_0000042 3300046557 Bacteria 115943
348 Ga0495633_0000203 3300046558 Bacteria 75474
349 Ga0495633_0113812 3300046558 Bacteria 1254
350 Ga0495667_0031596 3300046559 Bacteria 3553
351 Ga0495667_0295452 3300046559 Bacteria 1027
352 Ga0495634_0004682 3300046642 Bacteria 10641
353 Ga0495634_0019389 3300046642 Bacteria 4834
354 Ga0495611_0017987 3300046648 Bacteria 3028
355 Ga0495611_0143095 3300046648 Bacteria 1116
356 Ga0495635_0000355 3300046663 Bacteria 29117
357 Ga0495635_0053464 3300046663 Bacteria 2782
358 Ga0495661_0007568 3300046665 Bacteria 7569
359 Ga0495661_0011156 3300046665 Bacteria 6100
360 Ga0495588_0092095 3300046674 Bacteria 1588
361 Ga0495599_0012618 3300046678 Bacteria 5211
362 Ga0495599_0063471 3300046678 Bacteria 2308
363 Ga0495623_0003646 3300046679 Bacteria 10180
364 Ga0495623_0007587 3300046679 Bacteria 7041
365 Ga0495623_0016109 3300046679 Bacteria 4830
366 Ga0495623_0143505 3300046679 Bacteria 1418
367 Ga0495646_0000838 3300046680 Bacteria 17360
368 Ga0495646_0015636 3300046680 Bacteria 4815
369 Ga0495646_0046995 3300046680 Bacteria 2629
370 Ga0495646_0105242 3300046680 Bacteria 1612
371 Ga0495646_0244397 3300046680 Bacteria 963
372 Ga0495647_0104390 3300046681 Bacteria 1176
373 Ga0495658_0153160 3300046683 Bacteria 1417
374 Ga0495613_0018369 3300046689 Bacteria 5215
375 Ga0495613_0080430 3300046689 Bacteria 2368
376 Ga0495613_0118115 3300046689 Bacteria 1906
377 Ga0495613_0203157 3300046689 Bacteria 1396
378 Ga0495624_0000260 3300046690 Bacteria 41797
379 Ga0495624_0007749 3300046690 Bacteria 7532
380 Ga0495624_0038379 3300046690 Bacteria 3077
381 Ga0495624_0114645 3300046690 Bacteria 1656
382 Ga0495671_0029997 3300046692 Bacteria 2788
383 Ga0495671_0030630 3300046692 Bacteria 2754
384 Ga0495671_0120472 3300046692 Bacteria 1280
385 Ga0495649_0007271 3300046694 Bacteria 6775
386 Ga0495649_0050161 3300046694 Bacteria 2265
387 Ga0495649_0090236 3300046694 Bacteria 1634
388 Ga0495600_0001800 3300046809 Bacteria 11987
389 Ga0495600_0012618 3300046809 Bacteria 5289
390 Ga0495600_0089529 3300046809 Bacteria 2007
391 Ga0495581_0000765 3300047315 Bacteria 17080
392 Ga0495581_0016521 3300047315 Bacteria 4289
393 Ga0495604_0002776 3300047317 Bacteria 14044
394 Ga0495604_0073169 3300047317 Bacteria 2587
395 Ga0495604_0153227 3300047317 Bacteria 1635
396 Ga0495604_0182447 3300047317 Bacteria 1467
397 Ga0495674_0004831 3300047319 Bacteria 12959
398 Ga0495674_0026080 3300047319 Bacteria 5348
399 Ga0495674_0039907 3300047319 Bacteria 4203
400 Ga0495674_0041642 3300047319 Bacteria 4101
401 Ga0495674_0135842 3300047319 Bacteria 2069
402 Ga0495674_0232340 3300047319 Bacteria 1521
403 Ga0495672_0061435 3300047320 Bacteria 2165
404 Ga0495676_0001337 3300047321 Bacteria 21166
405 Ga0495676_0004074 3300047321 Bacteria 13317
406 Ga0495676_0012204 3300047321 Bacteria 7749
407 Ga0495676_0067413 3300047321 Bacteria 2768
408 Ga0495676_0148227 3300047321 Bacteria 1673
409 Ga0495680_0011243 3300047322 Bacteria 7938
410 Ga0495680_0038076 3300047322 Bacteria 3847
411 Ga0495680_0059831 3300047322 Bacteria 2939
412 Ga0495680_0081298 3300047322 Bacteria 2446
413 Ga0495680_0135729 3300047322 Bacteria 1804
414 Ga0495683_0000897 3300047323 Bacteria 21008
415 Ga0495683_0005760 3300047323 Bacteria 6827
416 Ga0495683_0018145 3300047323 Bacteria 3640
417 Ga0495683_0028836 3300047323 Bacteria 2837
418 Ga0495683_0032715 3300047323 Bacteria 2648
419 Ga0495683_0163462 3300047323 Bacteria 1028
420 Ga0495687_003187 3300047443 Bacteria 12190
421 Ga0495675_0006712 3300047444 Bacteria 7053
422 Ga0495675_0154225 3300047444 Bacteria 1417
423 Ga0495677_0015788 3300047445 Bacteria 2741
424 Ga0495679_000006 3300047446 Bacteria 449956
425 Ga0495679_000579 3300047446 Bacteria 25307
426 Ga0495684_0008753 3300047471 Bacteria 7828
427 Ga0495684_0054674 3300047471 Bacteria 3045
428 Ga0495593_0006281 3300047673 Bacteria 6973
429 Ga0495593_0015428 3300047673 Bacteria 4325
430 Ga0495593_0031209 3300047673 Bacteria 2912
431 Ga0495593_0039864 3300047673 Bacteria 2530
432 Ga0495593_0114907 3300047673 Bacteria 1372
433 Ga0495602_0001820 3300048088 Bacteria 21307
434 Ga0495602_0033866 3300048088 Bacteria 4786
435 Ga0495602_0074175 3300048088 Bacteria 2892
436 Ga0495602_0078346 3300048088 Bacteria 2791
437 Ga0495602_0272158 3300048088 Bacteria 1251
438 Ga0495614_0001581 3300048089 Bacteria 9894
439 Ga0495614_0045118 3300048089 Bacteria 1890
440 Ga0495614_0073546 3300048089 Bacteria 1475
441 Ga0496101_0265584 3300048904 Bacteria 1339
442 Ga0496104_0000710 3300048907 Bacteria 28650
443 Ga0496104_0040407 3300048907 Bacteria 4371
444 Ga0496105_0127656 3300048908 Bacteria 2096
445 Ga0496114_0046200 3300048917 Bacteria 3618
446 Ga0496115_0033424 3300048918 Bacteria 4060
447 Ga0496115_0565730 3300048918 Bacteria 907
448 Ga0496116_0022339 3300048919 Bacteria 4741
449 Ga0496116_0089814 3300048919 Bacteria 1872
450 Ga0496116_0097163 3300048919 Bacteria 1771
451 Ga0496117_0034887 3300048920 Bacteria 3783
452 Ga0496117_0073591 3300048920 Bacteria 2279
453 Ga0496118_0021335 3300048921 Bacteria 5705
454 Ga0496118_0036276 3300048921 Bacteria 3988
455 Ga0496118_0064605 3300048921 Bacteria 2684
456 Ga0496118_0187224 3300048921 Bacteria 1242
457 Ga0496119_0000492 3300048922 Bacteria 53828
458 Ga0496119_0001101 3300048922 Bacteria 34050
459 Ga0496119_0012048 3300048922 Bacteria 7068
460 Ga0496119_0014483 3300048922 Bacteria 6165
461 Ga0496119_0032501 3300048922 Bacteria 3476
462 Ga0496119_0036834 3300048922 Bacteria 3186
463 Ga0496119_0043749 3300048922 Bacteria 2826
464 Ga0496119_0213443 3300048922 Bacteria 991
465 Ga0496120_0000209 3300048923 Bacteria 100320
466 Ga0496120_0001970 3300048923 Bacteria 22427
467 Ga0496120_0006438 3300048923 Bacteria 9024
468 Ga0496120_0011134 3300048923 Bacteria 6205
469 Ga0496120_0013697 3300048923 Bacteria 5445
470 Ga0496120_0028398 3300048923 Bacteria 3429
471 Ga0496120_0077819 3300048923 Bacteria 1804
472 Ga0496120_0137005 3300048923 Bacteria 1247
473 Ga0496121_0001669 3300048924 Bacteria 36612
474 Ga0496121_0033657 3300048924 Bacteria 4632
475 Ga0496121_0034606 3300048924 Bacteria 4544
476 Ga0496121_0042159 3300048924 Bacteria 3975
477 Ga0496121_0101089 3300048924 Bacteria 2224
478 Ga0496121_0107051 3300048924 Bacteria 2142
479 Ga0496121_0131977 3300048924 Bacteria 1867
480 Ga0496121_0198175 3300048924 Bacteria 1433
481 Ga0496122_0014693 3300048925 Bacteria 7548
482 Ga0496122_0025107 3300048925 Bacteria 5190
483 Ga0496122_0037291 3300048925 Bacteria 3915
484 Ga0496122_0232259 3300048925 Bacteria 1048
485 Ga0496123_0011627 3300048926 Bacteria 7598
486 Ga0496123_0033287 3300048926 Bacteria 3712
487 Ga0496123_0117690 3300048926 Bacteria 1502
488 Ga0496124_0000074 3300048927 Bacteria 218780
489 Ga0496124_0010105 3300048927 Bacteria 9617
490 Ga0496124_0017512 3300048927 Bacteria 6748
491 Ga0496124_0025798 3300048927 Bacteria 5313
492 Ga0496124_0031409 3300048927 Bacteria 4702
493 Ga0496124_0047967 3300048927 Bacteria 3651
494 Ga0496125_0004069 3300048928 Bacteria 17127
495 Ga0496125_0005811 3300048928 Bacteria 13550
496 Ga0496125_0013046 3300048928 Bacteria 8197
497 Ga0496125_0026013 3300048928 Bacteria 5344
498 Ga0496125_0055326 3300048928 Bacteria 3234
499 Ga0496125_0066793 3300048928 Bacteria 2839
500 Ga0496125_0092283 3300048928 Bacteria 2264
501 Ga0496125_0224136 3300048928 Bacteria 1208
502 Ga0496126_0000065 3300048929 Bacteria 252549
503 Ga0496126_0000102 3300048929 Bacteria 201540
504 Ga0496126_0001932 3300048929 Bacteria 29567
505 Ga0496126_0006431 3300048929 Bacteria 13095
506 Ga0496126_0076279 3300048929 Bacteria 2974
507 Ga0496126_0375420 3300048929 Bacteria 1158
508 Ga0495682_0000013 3300049460 Bacteria 259670
509 Ga0495682_0031736 3300049460 Bacteria 1952
510 Ga0495682_0058454 3300049460 Bacteria 1395
511 Ga0501032_0034961 3300049569 Bacteria 3437
512 Ga0501033_0000026 3300049570 Bacteria 169104
513 Ga0501043_0000144 3300049579 Bacteria 66178
514 Ga0501043_0037747 3300049579 Bacteria 3799
515 Ga0501046_0000110 3300049580 Bacteria 86752
516 Ga0501047_0000143 3300049581 Bacteria 87124
517 Ga0501048_0000601 3300049582 Bacteria 25551
518 Ga0501035_0000382 3300049822 Bacteria 50839
519 Ga0501044_0124949 3300049823 Bacteria 2571
520 Ga0501044_0193540 3300049823 Bacteria 1995
521 Ga0501045_0008311 3300049824 Bacteria 7227
522 nmdc:mga03683_67884_c1 3300050489 Bacteria 1518
523 nmdc:mga09592_9600_c1 3300050508 Bacteria 7860
524 nmdc:mga0qj67_82650_c1 3300050509 Bacteria 2575
525 nmdc:mga0sz30_26412_c1 3300050516 Bacteria 1061
526 Ga0495601_0113657 3300053077 Bacteria 1755
527 Ga0500651_0001993 3300053093 Bacteria 10596
528 Ga0500566_0052974 3300053094 Bacteria 2317
529 Ga0500571_020205 3300053110 Bacteria 3717
530 Ga0500618_000334 3300053125 Bacteria 33962
531 Ga0500618_002415 3300053125 Bacteria 7084
532 Ga0500658_0000934 3300053134 Bacteria 11917
533 Ga0500658_0001155 3300053134 Bacteria 10727
534 Ga0500559_0010785 3300053136 Bacteria 3917
535 Ga0500559_0020296 3300053136 Bacteria 2809
536 Ga0500568_0006553 3300053139 Bacteria 5828
537 Ga0500568_0013185 3300053139 Bacteria 3774
538 Ga0500574_019191 3300053141 Bacteria 1698
539 Ga0500590_000241 3300053148 Bacteria 16768
540 Ga0500616_0000011 3300053153 Bacteria 732880
541 Ga0500616_0000072 3300053153 Bacteria 231471
542 Ga0500616_0030730 3300053153 Bacteria 2947
543 Ga0500622_0035467 3300053156 Bacteria 2610
544 Ga0500634_0094965 3300053161 Bacteria 1505
545 Ga0500636_0002775 3300053177 Bacteria 9766
546 Ga0500636_0065721 3300053177 Bacteria 2110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0101864 Ga0395905_0101864_1988_2680 210
2 3300048928 Ga0496125_0066793 Ga0496125_0066793_22_762 222
3 3300005262 Ga0065165_1000582 Ga0065165_100058210 225
4 3300031548 Ga0307408_100010337 Ga0307408_1000103371 227
5 3300032002 Ga0307416_100622656 Ga0307416_1006226562 227
6 3300038705 Ga0237819_01205 Ga0237819_01205_435_1199 228
7 3300039145 Ga0237816_00244 Ga0237816_00244_3584_4348 228
8 iso_pu_bacteria 2879083081 2879086451 229
9 iso_pu_bacteria 2643221541 2643731384 230
10 iso_pu_bacteria 2643221606 2644042288 230
11 iso_pu_bacteria 2643221671 2644394070 230
12 3300003322 rootL2_10131760 rootL2_101317602 234
13 3300003323 rootH1_10119104 rootH1_101191041 234
14 3300005548 Ga0070665_100170665 Ga0070665_1001706652 234
15 3300005617 Ga0068859_101163949 Ga0068859_1011639491 234
16 3300005844 Ga0068862_100732733 Ga0068862_1007327332 234
17 3300006931 Ga0097620_101164072 Ga0097620_1011640721 234
18 3300028380 Ga0268265_10471703 Ga0268265_104717032 234
19 3300037471 Ga0395905_0007778 Ga0395905_0007778_6527_7291 234
20 3300039447 Ga0436361_0092104 Ga0436361_0092104_764_1528 234
21 3300049823 Ga0501044_0124949 Ga0501044_0124949_112_876 234
22 3300053136 Ga0500559_0010785 Ga0500559_0010785_2385_3149 234
23 3300053153 Ga0500616_0000011 Ga0500616_0000011_489433_490197 234
24 iso_pu_bacteria 2856287931 2856291257 234
25 iso_pu_bacteria 2857357740 2857364297 234
26 3300003320 rootH2_10191272 rootH2_101912721 235
27 3300006946 Ga0079104_1014185 Ga0079104_10141852 235
28 3300009176 Ga0105242_10815997 Ga0105242_108159971 235
29 3300009177 Ga0105248_10619539 Ga0105248_106195392 235
30 3300025941 Ga0207711_10375286 Ga0207711_103752862 235
31 3300027111 Ga0209281_1000384 Ga0209281_10003844 235
32 3300031730 Ga0307516_10000114 Ga0307516_1000011413 235
33 3300037312 Ga0395899_0001754 Ga0395899_0001754_7682_8449 235
34 3300037418 Ga0395900_0021658 Ga0395900_0021658_5358_6125 235
35 3300037418 Ga0395900_0038952 Ga0395900_0038952_2247_3014 235
36 3300037466 Ga0395898_0002919 Ga0395898_0002919_5265_6032 235
37 3300037471 Ga0395905_0002011 Ga0395905_0002011_6827_7594 235
38 3300037471 Ga0395905_0018804 Ga0395905_0018804_5211_5978 235
39 3300037471 Ga0395905_0029094 Ga0395905_0029094_1750_2517 235
40 3300037853 Ga0436364_0186364 Ga0436364_0186364_784_1560 235
41 3300038443 Ga0395901_0014476 Ga0395901_0014476_981_1748 235
42 3300038443 Ga0395901_0073792 Ga0395901_0073792_1727_2494 235
43 3300013297 Ga0157378_10312058 Ga0157378_103120581 236
44 3300037418 Ga0395900_0038952 Ga0395900_0038952_4091_4861 236
45 3300037471 Ga0395905_0029094 Ga0395905_0029094_3594_4364 236
46 iso_pu_bacteria 2501025502 2501083569 236
47 iso_pu_bacteria 2510917013 2511087601 236
48 iso_pu_bacteria 2513237082 2513552027 236
49 iso_pu_bacteria 2513237083 2513559465 236
50 iso_pu_bacteria 2515154189 2516023836 236
51 iso_pu_bacteria 2883087390 2883088192 236
52 iso_pu_bacteria 8003955200 8003956692 236
53 3300005336 Ga0070680_100285077 Ga0070680_1002850772 237
54 3300005458 Ga0070681_10034234 Ga0070681_100342344 237
55 3300005530 Ga0070679_100010359 Ga0070679_1000103594 237
56 3300021441 Ga0213871_10020319 Ga0213871_100203193 237
57 3300025917 Ga0207660_10027724 Ga0207660_100277244 237
58 3300039438 Ga0436360_0173811 Ga0436360_0173811_250_1026 237
59 3300028800 Ga0265338_10001045 Ga0265338_1000104547 238
60 3300031247 Ga0265340_10035682 Ga0265340_100356823 238
61 iso_pu_bacteria 2554235234 2555262076 238
62 iso_pu_bacteria 2636415599 2637227250 238
63 iso_pu_bacteria 2643221618 2644105334 238
64 iso_pu_bacteria 2643221626 2644147301 238
65 iso_pu_bacteria 2643221655 2644309821 238
66 iso_pu_bacteria 2643221659 2644333336 238
67 iso_pu_bacteria 2643221698 2644543479 238
68 iso_pu_bacteria 2643221712 2644614394 238
69 iso_pu_bacteria 2844163670 2844166541 238
70 iso_pu_bacteria 2904513164 2904516027 238
71 iso_pu_bacteria 2941499720 2941502588 238
72 iso_pu_bacteria 2969079654 2969084264 238
73 iso_pu_bacteria 2984559226 2984561341 238
74 iso_pu_bacteria 2984595703 2984599410 238
75 3300005459 Ga0068867_100303844 Ga0068867_1003038442 239
76 iso_pu_bacteria 2602042066 2603700520 239
77 iso_pu_bacteria 2772190666 2772437130 239
78 iso_pu_bacteria 2884086401 2884090201 239
79 iso_pu_bacteria 2888366609 2888367182 239
80 iso_pu_bacteria 2919108558 2919112742 239
81 iso_pu_bacteria 2937967321 2937970823 239
82 iso_pu_bacteria 2939607340 2939609565 239
83 iso_pu_bacteria 2971820967 2971825772 239
84 iso_pu_bacteria 8004592986 8004597917 239
85 iso_pu_bacteria 8015394850 8015396062 239
86 3300025230 Ga0209563_101384 Ga0209563_1013846 240
87 3300046507 Ga0495606_0005492 Ga0495606_0005492_1918_2706 240
88 iso_pu_bacteria 2547132416 2548648083 240
89 iso_pu_bacteria 2599185169 2599412958 240
90 iso_pu_bacteria 2600255254 2601525572 240
91 iso_pu_bacteria 2600255255 2601530818 240
92 iso_pu_bacteria 2600255280 2601617693 240
93 iso_pu_bacteria 2600255281 2601622727 240
94 iso_pu_bacteria 2600255287 2601644720 240
95 iso_pu_bacteria 2600255288 2601651000 240
96 iso_pu_bacteria 2600255289 2601656050 240
97 iso_pu_bacteria 2600255290 2601660973 240
98 iso_pu_bacteria 2600255291 2601664885 240
99 iso_pu_bacteria 2600255298 2601697246 240
100 iso_pu_bacteria 2600255299 2601702634 240
101 iso_pu_bacteria 2600255300 2601708816 240
102 iso_pu_bacteria 2600255301 2601713853 240
103 iso_pu_bacteria 2600255302 2601718899 240
104 iso_pu_bacteria 2600255303 2601722706 240
105 iso_pu_bacteria 2600255304 2601728980 240
106 iso_pu_bacteria 2600255305 2601733845 240
107 iso_pu_bacteria 2600255306 2601738820 240
108 iso_pu_bacteria 2600255307 2601743373 240
109 iso_pu_bacteria 2600255309 2601754499 240
110 iso_pu_bacteria 2600255392 2602021440 240
111 iso_pu_bacteria 2602042047 2603644669 240
112 iso_pu_bacteria 2602042052 2603662796 240
113 iso_pu_bacteria 2602042053 2603667694 240
114 iso_pu_bacteria 2602042067 2603705857 240
115 iso_pu_bacteria 2602042103 2603841370 240
116 iso_pu_bacteria 2602042104 2603846501 240
117 iso_pu_bacteria 2602042105 2603851576 240
118 iso_pu_bacteria 2602042106 2603856583 240
119 iso_pu_bacteria 2602042109 2603868444 240
120 iso_pu_bacteria 2602042110 2603874223 240
121 iso_pu_bacteria 2602042111 2603878502 240
122 iso_pu_bacteria 2603880178 2606051342 240
123 iso_pu_bacteria 2603880184 2606072374 240
124 iso_pu_bacteria 2603880202 2606149027 240
125 iso_pu_bacteria 2603880211 2606179294 240
126 iso_pu_bacteria 2667528172 2671103788 240
127 iso_pu_bacteria 2675903046 2676409779 240
128 iso_pu_bacteria 2681812866 2681996778 240
129 iso_pu_bacteria 2751185917 2753854497 240
130 iso_pu_bacteria 2775506706 2775540738 240
131 iso_pu_bacteria 2775507074 2777021648 240
132 iso_pu_bacteria 2821118458 2821121351 240
133 iso_pu_bacteria 2844425489 2844426052 240
134 iso_pu_bacteria 2923634449 2923637872 240
135 iso_pu_bacteria 2927833300 2927835675 240
136 iso_pu_bacteria 2937539931 2937540006 240
137 iso_pu_bacteria 8055097453 8055100755 240
138 iso_pu_bacteria 8057304971 8057307427 240
139 3300031730 Ga0307516_10000419 Ga0307516_1000041928 241
140 iso_pu_bacteria 2510917026 2511170516 241
141 iso_pu_bacteria 2908669403 2908673381 241
142 iso_pu_bacteria 2919171160 2919171513 241
143 iso_pu_bacteria 2928084124 2928090775 241
144 iso_pu_bacteria 3000376612 3000380066 241
145 3300005367 Ga0070667_100120995 Ga0070667_1001209952 242
146 3300005436 Ga0070713_100161910 Ga0070713_1001619102 242
147 3300005439 Ga0070711_100112631 Ga0070711_1001126312 242
148 3300005456 Ga0070678_100000882 Ga0070678_10000088210 242
149 3300005546 Ga0070696_100000838 Ga0070696_10000083819 242
150 3300005617 Ga0068859_100450776 Ga0068859_1004507761 242
151 3300006358 Ga0068871_100052158 Ga0068871_1000521583 242
152 3300006931 Ga0097620_100450721 Ga0097620_1004507211 242
153 3300006946 Ga0079104_1000062 Ga0079104_100006290 242
154 3300009011 Ga0105251_10020458 Ga0105251_100204584 242
155 3300013297 Ga0157378_10067583 Ga0157378_100675835 242
156 3300025735 Ga0207713_1000136 Ga0207713_100013669 242
157 3300025735 Ga0207713_1054244 Ga0207713_10542442 242
158 3300025735 Ga0207713_1105338 Ga0207713_11053381 242
159 3300025916 Ga0207663_10064156 Ga0207663_100641563 242
160 3300025928 Ga0207700_10056489 Ga0207700_100564892 242
161 3300025940 Ga0207691_10028325 Ga0207691_100283258 242
162 3300026089 Ga0207648_10038166 Ga0207648_100381665 242
163 3300026121 Ga0207683_10009055 Ga0207683_1000905511 242
164 3300027111 Ga0209281_1000001 Ga0209281_1000001389 242
165 3300027312 Ga0209371_1002199 Ga0209371_10021995 242
166 3300030500 Ga0268256_1001933 Ga0268256_10019335 242
167 3300046491 Ga0495584_0081868 Ga0495584_0081868_747_1541 242
168 3300046492 Ga0495585_0006532 Ga0495585_0006532_5149_5943 242
169 3300046492 Ga0495585_0021114 Ga0495585_0021114_1284_2078 242
170 3300046501 Ga0495607_0081465 Ga0495607_0081465_366_1160 242
171 3300046523 Ga0495644_0006675 Ga0495644_0006675_1092_1886 242
172 3300046542 Ga0495597_0118656 Ga0495597_0118656_169_963 242
173 3300046558 Ga0495633_0000203 Ga0495633_0000203_10526_11320 242
174 3300046648 Ga0495611_0017987 Ga0495611_0017987_1092_1886 242
175 3300046692 Ga0495671_0030630 Ga0495671_0030630_1125_1919 242
176 3300047445 Ga0495677_0015788 Ga0495677_0015788_1092_1886 242
177 3300048907 Ga0496104_0040407 Ga0496104_0040407_2172_2960 242
178 3300048908 Ga0496105_0127656 Ga0496105_0127656_1284_2072 242
179 3300048917 Ga0496114_0046200 Ga0496114_0046200_2389_3177 242
180 3300048918 Ga0496115_0033424 Ga0496115_0033424_817_1605 242
181 3300049460 Ga0495682_0000013 Ga0495682_0000013_29996_30790 242
182 iso_pu_bacteria 2599185188 2599500579 242
183 iso_pu_bacteria 2599185300 2599932262 242
184 iso_pu_bacteria 2643221580 2643911174 242
185 iso_pu_bacteria 2643221609 2644058693 242
186 iso_pu_bacteria 2643221611 2644072055 242
187 iso_pu_bacteria 2643221658 2644328133 242
188 iso_pu_bacteria 2738543012 2739245303 242
189 iso_pu_bacteria 2816332133 2816471632 242
190 iso_pu_bacteria 8055693939 8055697304 242
191 3300005289 Ga0065704_10003528 Ga0065704_100035281 243
192 3300006946 Ga0079104_1002067 Ga0079104_100206713 243
193 3300009011 Ga0105251_10000340 Ga0105251_1000034045 243
194 3300009011 Ga0105251_10001782 Ga0105251_100017824 243
195 3300009036 Ga0105244_10000137 Ga0105244_1000013753 243
196 3300009036 Ga0105244_10001231 Ga0105244_100012319 243
197 3300025728 Ga0207655_1000054 Ga0207655_1000054251 243
198 3300025728 Ga0207655_1000218 Ga0207655_100021811 243
199 3300025735 Ga0207713_1006558 Ga0207713_10065585 243
200 3300027111 Ga0209281_1000054 Ga0209281_100005442 243
201 3300039062 Ga0400483_085316 Ga0400483_085316_284_1078 243
202 3300042010 Ga0439452_000412 Ga0439452_000412_2778_3572 243
203 3300046530 Ga0495654_0062959 Ga0495654_0062959_64_858 243
204 3300048904 Ga0496101_0265584 Ga0496101_0265584_200_994 243
205 3300048922 Ga0496119_0000492 Ga0496119_0000492_44355_45149 243
206 3300048922 Ga0496119_0012048 Ga0496119_0012048_3141_3935 243
207 3300048923 Ga0496120_0000209 Ga0496120_0000209_80468_81262 243
208 3300048923 Ga0496120_0001970 Ga0496120_0001970_2574_3368 243
209 3300048927 Ga0496124_0000074 Ga0496124_0000074_193919_194713 243
210 3300050508 nmdc:mga09592_9600_c1 nmdc:mga09592_9600_c1_835_1635 243
211 3300050509 nmdc:mga0qj67_82650_c1 nmdc:mga0qj67_82650_c1_1007_1807 243
212 iso_pu_bacteria 2508501125 2509127094 243
213 iso_pu_bacteria 2508501125 2509128999 243
214 iso_pu_bacteria 2509276021 2509390900 243
215 iso_pu_bacteria 2510917030 2511197981 243
216 iso_pu_bacteria 2513237162 2514024330 243
217 iso_pu_bacteria 2515154114 2515646156 243
218 iso_pu_bacteria 2515154116 2515654726 243
219 iso_pu_bacteria 2516653077 2517040508 243
220 iso_pu_bacteria 2517287029 2517411269 243
221 iso_pu_bacteria 2519899620 2520378834 243
222 iso_pu_bacteria 2534681786 2535485956 243
223 iso_pu_bacteria 2558860100 2558862818 243
224 iso_pu_bacteria 2582581316 2585332651 243
225 iso_pu_bacteria 2582581866 2585394942 243
226 iso_pu_bacteria 2585427590 2585824980 243
227 iso_pu_bacteria 2585427633 2585993172 243
228 iso_pu_bacteria 2599185352 2600193854 243
229 iso_pu_bacteria 2615840698 2616552952 243
230 iso_pu_bacteria 2617270742 2617381276 243
231 iso_pu_bacteria 2643221599 2644005366 243
232 iso_pu_bacteria 2643221723 2644674218 243
233 iso_pu_bacteria 2667528174 2671114633 243
234 iso_pu_bacteria 2690316117 2692319266 243
235 iso_pu_bacteria 2718217927 2719389859 243
236 iso_pu_bacteria 2718218423 2721403498 243
237 iso_pu_bacteria 2721755556 2723030459 243
238 iso_pu_bacteria 2721755684 2723564821 243
239 iso_pu_bacteria 2721755809 2724035074 243
240 iso_pu_bacteria 2728369352 2730110992 243
241 iso_pu_bacteria 2738543024 2739305591 243
242 iso_pu_bacteria 2775507049 2776913379 243
243 iso_pu_bacteria 2775507266 2778174588 243
244 iso_pu_bacteria 2791355261 2793329928 243
245 iso_pu_bacteria 2791355263 2793344451 243
246 iso_pu_bacteria 2791355266 2793360049 243
247 iso_pu_bacteria 2791355267 2793367388 243
248 iso_pu_bacteria 2802429634 2806055850 243
249 iso_pu_bacteria 2802429635 2806061298 243
250 iso_pu_bacteria 2802429636 2806065761 243
251 iso_pu_bacteria 2838029111 2838032568 243
252 iso_pu_bacteria 2838042994 2838047577 243
253 iso_pu_bacteria 2841864319 2841865767 243
254 iso_pu_bacteria 2842324504 2842332322 243
255 iso_pu_bacteria 2842341865 2842345728 243
256 iso_pu_bacteria 2842348783 2842356507 243
257 iso_pu_bacteria 2842363717 2842364013 243
258 iso_pu_bacteria 2842454564 2842460842 243
259 iso_pu_bacteria 2842475841 2842479300 243
260 iso_pu_bacteria 2842482326 2842485621 243
261 iso_pu_bacteria 2842502639 2842506541 243
262 iso_pu_bacteria 2842509118 2842515063 243
263 iso_pu_bacteria 2846540461 2846545331 243
264 iso_pu_bacteria 2847417321 2847422225 243
265 iso_pu_bacteria 2848992105 2848998276 243
266 iso_pu_bacteria 2852103415 2852105778 243
267 iso_pu_bacteria 2855730933 2855733912 243
268 iso_pu_bacteria 2855767633 2855769502 243
269 iso_pu_bacteria 2857516855 2857523891 243
270 iso_pu_bacteria 2900634093 2900640473 243
271 iso_pu_bacteria 2913295892 2913299988 243
272 iso_pu_bacteria 2919408235 2919413360 243
273 iso_pu_bacteria 2936381700 2936384467 243
274 iso_pu_bacteria 2989349275 2989354477 243
275 iso_pu_bacteria 3005452660 3005457595 243
276 iso_pu_bacteria 8003570095 8003574895 243
277 iso_pu_bacteria 8005258706 8005260484 243
278 iso_pu_bacteria 8005275841 8005275982 243
279 iso_pu_bacteria 8005282627 8005286275 243
280 iso_pu_bacteria 8005301065 8005301700 243
281 iso_pu_bacteria 8005382845 8005383357 243
282 iso_pu_bacteria 8005395548 8005398951 243
283 iso_pu_bacteria 8005682033 8005683624 243
284 iso_pu_bacteria 8005695170 8005695437 243
285 iso_pu_bacteria 8018127388 8018128508 243
286 iso_pu_bacteria 8018163183 8018163389 243
287 iso_pu_bacteria 8018176218 8018180866 243
288 iso_pu_bacteria 8056375014 8056381801 243
289 3300003856 Ga0058692_1000523 Ga0058692_100052317 244
290 3300003856 Ga0058692_1002123 Ga0058692_10021231 244
291 3300005354 Ga0070675_100029265 Ga0070675_1000292652 244
292 3300005355 Ga0070671_100152962 Ga0070671_1001529622 244
293 3300005459 Ga0068867_100091852 Ga0068867_1000918521 244
294 3300005548 Ga0070665_100000140 Ga0070665_10000014072 244
295 3300005564 Ga0070664_100183309 Ga0070664_1001833092 244
296 3300005577 Ga0068857_100000109 Ga0068857_10000010939 244
297 3300005834 Ga0068851_10004168 Ga0068851_100041686 244
298 3300006946 Ga0079104_1020725 Ga0079104_10207251 244
299 3300009011 Ga0105251_10003198 Ga0105251_100031989 244
300 3300009011 Ga0105251_10147970 Ga0105251_101479701 244
301 3300009011 Ga0105251_10183185 Ga0105251_101831851 244
302 3300009036 Ga0105244_10000297 Ga0105244_100002972 244
303 3300009036 Ga0105244_10013152 Ga0105244_100131522 244
304 3300009036 Ga0105244_10060979 Ga0105244_100609792 244
305 3300009093 Ga0105240_10371559 Ga0105240_103715592 244
306 3300013100 Ga0157373_10017986 Ga0157373_100179864 244
307 3300013102 Ga0157371_10055756 Ga0157371_100557564 244
308 3300015679 Ga0183366_1003 Ga0183366_1003246 244
309 3300015680 Ga0183370_1003 Ga0183370_1003174 244
310 3300015685 Ga0183369_1005 Ga0183369_1005174 244
311 3300015687 Ga0183368_1006 Ga0183368_1006245 244
312 3300017792 Ga0163161_10280310 Ga0163161_102803102 244
313 3300025711 Ga0207696_1000140 Ga0207696_100014056 244
314 3300025711 Ga0207696_1026922 Ga0207696_10269222 244
315 3300025728 Ga0207655_1000026 Ga0207655_1000026243 244
316 3300025728 Ga0207655_1000465 Ga0207655_100046548 244
317 3300025728 Ga0207655_1019256 Ga0207655_10192562 244
318 3300025735 Ga0207713_1000046 Ga0207713_100004650 244
319 3300025735 Ga0207713_1000110 Ga0207713_100011085 244
320 3300025735 Ga0207713_1000617 Ga0207713_10006176 244
321 3300025735 Ga0207713_1004573 Ga0207713_10045733 244
322 3300025735 Ga0207713_1015525 Ga0207713_10155252 244
323 3300025913 Ga0207695_10172925 Ga0207695_101729252 244
324 3300025935 Ga0207709_10049583 Ga0207709_100495832 244
325 3300025942 Ga0207689_10093009 Ga0207689_100930092 244
326 3300025945 Ga0207679_10067309 Ga0207679_100673092 244
327 3300026089 Ga0207648_10090932 Ga0207648_100909323 244
328 3300026116 Ga0207674_10001309 Ga0207674_1000130928 244
329 3300027111 Ga0209281_1000489 Ga0209281_100048954 244
330 3300027111 Ga0209281_1004123 Ga0209281_10041232 244
331 3300027312 Ga0209371_1000030 Ga0209371_1000030198 244
332 3300027312 Ga0209371_1000658 Ga0209371_10006586 244
333 3300027312 Ga0209371_1007031 Ga0209371_10070314 244
334 3300028379 Ga0268266_10000143 Ga0268266_1000014372 244
335 3300030500 Ga0268256_1000025 Ga0268256_1000025251 244
336 3300030500 Ga0268256_1001720 Ga0268256_10017206 244
337 3300030500 Ga0268256_1009831 Ga0268256_10098312 244
338 3300037471 Ga0395905_0172136 Ga0395905_0172136_140_946 244
339 3300041405 Ga0439438_006446 Ga0439438_006446_2520_3317 244
340 3300042006 Ga0439432_048146 Ga0439432_048146_239_1036 244
341 3300042876 Ga0451577_0470683 Ga0451577_0470683_132_935 244
342 3300044669 Ga0466981_0000014 Ga0466981_0000014_27882_28679 244
343 3300046520 Ga0495637_0013863 Ga0495637_0013863_1681_2487 244
344 3300048907 Ga0496104_0000710 Ga0496104_0000710_20126_20923 244
345 3300048919 Ga0496116_0022339 Ga0496116_0022339_1263_2060 244
346 3300048919 Ga0496116_0089814 Ga0496116_0089814_218_1015 244
347 3300048919 Ga0496116_0097163 Ga0496116_0097163_77_874 244
348 3300048920 Ga0496117_0034887 Ga0496117_0034887_1800_2597 244
349 3300048921 Ga0496118_0036276 Ga0496118_0036276_2773_3570 244
350 3300048921 Ga0496118_0187224 Ga0496118_0187224_30_827 244
351 3300048922 Ga0496119_0014483 Ga0496119_0014483_881_1678 244
352 3300048922 Ga0496119_0032501 Ga0496119_0032501_1219_2016 244
353 3300048922 Ga0496119_0036834 Ga0496119_0036834_1681_2478 244
354 3300048922 Ga0496119_0043749 Ga0496119_0043749_620_1417 244
355 3300048922 Ga0496119_0213443 Ga0496119_0213443_53_850 244
356 3300048923 Ga0496120_0006438 Ga0496120_0006438_6903_7700 244
357 3300048923 Ga0496120_0011134 Ga0496120_0011134_1058_1855 244
358 3300048923 Ga0496120_0013697 Ga0496120_0013697_3252_4049 244
359 3300048923 Ga0496120_0077819 Ga0496120_0077819_297_1094 244
360 3300048924 Ga0496121_0001669 Ga0496121_0001669_32440_33237 244
361 3300048924 Ga0496121_0033657 Ga0496121_0033657_2958_3755 244
362 3300048924 Ga0496121_0034606 Ga0496121_0034606_1025_1822 244
363 3300048924 Ga0496121_0042159 Ga0496121_0042159_272_1069 244
364 3300048924 Ga0496121_0107051 Ga0496121_0107051_449_1246 244
365 3300048924 Ga0496121_0131977 Ga0496121_0131977_799_1596 244
366 3300048924 Ga0496121_0198175 Ga0496121_0198175_557_1354 244
367 3300048925 Ga0496122_0014693 Ga0496122_0014693_3849_4646 244
368 3300048925 Ga0496122_0025107 Ga0496122_0025107_3260_4057 244
369 3300048925 Ga0496122_0232259 Ga0496122_0232259_190_987 244
370 3300048926 Ga0496123_0011627 Ga0496123_0011627_4422_5219 244
371 3300048927 Ga0496124_0010105 Ga0496124_0010105_3197_3994 244
372 3300048927 Ga0496124_0017512 Ga0496124_0017512_2977_3774 244
373 3300048927 Ga0496124_0047967 Ga0496124_0047967_371_1168 244
374 3300048928 Ga0496125_0004069 Ga0496125_0004069_5961_6758 244
375 3300048928 Ga0496125_0013046 Ga0496125_0013046_5652_6449 244
376 3300048928 Ga0496125_0026013 Ga0496125_0026013_1220_2017 244
377 3300048928 Ga0496125_0092283 Ga0496125_0092283_54_851 244
378 3300048928 Ga0496125_0224136 Ga0496125_0224136_353_1150 244
379 3300048929 Ga0496126_0001932 Ga0496126_0001932_22088_22885 244
380 3300048929 Ga0496126_0006431 Ga0496126_0006431_1166_1963 244
381 3300048929 Ga0496126_0375420 Ga0496126_0375420_303_1100 244
382 3300003792 Ga0055540_1005314 Ga0055540_10053142 245
383 3300006353 Ga0075370_10141408 Ga0075370_101414082 245
384 3300009036 Ga0105244_10006556 Ga0105244_100065566 245
385 3300009092 Ga0105250_10000045 Ga0105250_1000004556 245
386 3300009148 Ga0105243_10000988 Ga0105243_1000098822 245
387 3300011119 Ga0105246_10069694 Ga0105246_100696942 245
388 3300013100 Ga0157373_10001795 Ga0157373_100017959 245
389 3300017792 Ga0163161_10047086 Ga0163161_100470865 245
390 3300021321 Ga0214542_1000064 Ga0214542_100006453 245
391 3300021327 Ga0214543_1000063 Ga0214543_100006359 245
392 3300025297 Ga0209758_1000121 Ga0209758_1000121189 245
393 3300025298 Ga0209050_1003378 Ga0209050_100337811 245
394 3300025303 Ga0209051_1010423 Ga0209051_10104233 245
395 3300025728 Ga0207655_1002093 Ga0207655_10020934 245
396 3300028794 Ga0307515_10001099 Ga0307515_100010996 245
397 3300031456 Ga0307513_10000998 Ga0307513_1000099828 245
398 3300046460 Ga0495638_0081697 Ga0495638_0081697_626_1435 245
399 3300046513 Ga0495616_0011116 Ga0495616_0011116_2111_2920 245
400 3300046674 Ga0495588_0092095 Ga0495588_0092095_765_1574 245
401 3300046683 Ga0495658_0153160 Ga0495658_0153160_449_1258 245
402 3300047321 Ga0495676_0012204 Ga0495676_0012204_891_1700 245
403 3300047673 Ga0495593_0039864 Ga0495593_0039864_800_1609 245
404 3300048918 Ga0496115_0565730 Ga0496115_0565730_42_848 245
405 3300048923 Ga0496120_0137005 Ga0496120_0137005_96_905 245
406 3300048924 Ga0496121_0101089 Ga0496121_0101089_424_1233 245
407 3300053093 Ga0500651_0001993 Ga0500651_0001993_8456_9265 245
408 3300053094 Ga0500566_0052974 Ga0500566_0052974_906_1715 245
409 3300053110 Ga0500571_020205 Ga0500571_020205_906_1715 245
410 3300053134 Ga0500658_0000934 Ga0500658_0000934_3586_4395 245
411 3300053134 Ga0500658_0001155 Ga0500658_0001155_2428_3237 245
412 3300053136 Ga0500559_0020296 Ga0500559_0020296_958_1767 245
413 3300053139 Ga0500568_0006553 Ga0500568_0006553_2502_3311 245
414 3300053141 Ga0500574_019191 Ga0500574_019191_155_964 245
415 3300053153 Ga0500616_0000072 Ga0500616_0000072_27051_27860 245
416 3300053153 Ga0500616_0030730 Ga0500616_0030730_667_1476 245
417 3300053177 Ga0500636_0065721 Ga0500636_0065721_103_912 245
418 3300005331 Ga0070670_100006693 Ga0070670_1000066935 246
419 3300005335 Ga0070666_10149501 Ga0070666_101495012 246
420 3300005338 Ga0068868_100020334 Ga0068868_1000203343 246
421 3300005356 Ga0070674_100010795 Ga0070674_1000107954 246
422 3300005457 Ga0070662_100391366 Ga0070662_1003913661 246
423 3300005543 Ga0070672_100036017 Ga0070672_1000360173 246
424 3300005577 Ga0068857_100175628 Ga0068857_1001756283 246
425 3300009098 Ga0105245_10084105 Ga0105245_100841052 246
426 3300013308 Ga0157375_10103579 Ga0157375_101035792 246
427 3300014745 Ga0157377_10073996 Ga0157377_100739962 246
428 3300014968 Ga0157379_10644924 Ga0157379_106449241 246
429 3300025294 Ga0209025_1000003 Ga0209025_10000031049 246
430 3300025903 Ga0207680_10031534 Ga0207680_100315343 246
431 3300025907 Ga0207645_10010389 Ga0207645_100103892 246
432 3300025923 Ga0207681_10255902 Ga0207681_102559022 246
433 3300025925 Ga0207650_10064575 Ga0207650_100645752 246
434 3300025940 Ga0207691_10004147 Ga0207691_100041473 246
435 3300025960 Ga0207651_10025239 Ga0207651_100252392 246
436 3300026116 Ga0207674_10024806 Ga0207674_100248065 246
437 3300035724 Ga0373933_0075364 Ga0373933_0075364_294_1097 246
438 3300036401 Ga0373937_0151921 Ga0373937_0151921_999_1802 246
439 3300038443 Ga0395901_0001521 Ga0395901_0001521_6288_7106 246
440 3300046452 Ga0495617_003125 Ga0495617_003125_1673_2473 246
441 3300046459 Ga0495629_0118204 Ga0495629_0118204_244_1047 246
442 3300046506 Ga0495583_0000671 Ga0495583_0000671_12110_12925 246
443 3300046507 Ga0495606_0006456 Ga0495606_0006456_9248_10063 246
444 3300046557 Ga0495622_0000042 Ga0495622_0000042_73705_74511 246
445 3300046559 Ga0495667_0295452 Ga0495667_0295452_46_849 246
446 3300046680 Ga0495646_0244397 Ga0495646_0244397_97_900 246
447 3300046681 Ga0495647_0104390 Ga0495647_0104390_280_1083 246
448 3300046689 Ga0495613_0203157 Ga0495613_0203157_528_1331 246
449 3300046694 Ga0495649_0007271 Ga0495649_0007271_2876_3691 246
450 3300047323 Ga0495683_0005760 Ga0495683_0005760_5405_6220 246
451 3300047471 Ga0495684_0054674 Ga0495684_0054674_941_1744 246
452 3300048920 Ga0496117_0073591 Ga0496117_0073591_1001_1816 246
453 3300048921 Ga0496118_0021335 Ga0496118_0021335_2094_2909 246
454 3300048929 Ga0496126_0000065 Ga0496126_0000065_214705_215520 246
455 3300049569 Ga0501032_0034961 Ga0501032_0034961_1402_2205 246
456 3300049579 Ga0501043_0000144 Ga0501043_0000144_60347_61150 246
457 3300049580 Ga0501046_0000110 Ga0501046_0000110_4893_5696 246
458 3300049581 Ga0501047_0000143 Ga0501047_0000143_5265_6068 246
459 3300049582 Ga0501048_0000601 Ga0501048_0000601_19970_20773 246
460 3300049823 Ga0501044_0193540 Ga0501044_0193540_1114_1917 246
461 3300049824 Ga0501045_0008311 Ga0501045_0008311_5019_5822 246
462 3300053077 Ga0495601_0113657 Ga0495601_0113657_244_1047 246
463 3300053139 Ga0500568_0013185 Ga0500568_0013185_379_1179 246
464 3300053156 Ga0500622_0035467 Ga0500622_0035467_1196_1996 246
465 3300001989 JGI24739J22299_10049299 JGI24739J22299_100492992 247
466 3300002704 JGI25155J39150_1000046 JGI25155J39150_100004632 247
467 3300002705 JGI25156J39149_1000070 JGI25156J39149_100007046 247
468 3300002705 JGI25156J39149_1000187 JGI25156J39149_100018727 247
469 3300002705 JGI25156J39149_1000471 JGI25156J39149_10004716 247
470 3300002737 JGI25162J39368_1000247 JGI25162J39368_100024712 247
471 3300002737 JGI25162J39368_1001794 JGI25162J39368_10017942 247
472 3300002738 JGI25154J39366_1000092 JGI25154J39366_100009232 247
473 3300002741 JGI25157J39369_1000087 JGI25157J39369_100008733 247
474 3300003214 JGI25165J46597_1000237 JGI25165J46597_100023764 247
475 3300003214 JGI25165J46597_1000412 JGI25165J46597_100041234 247
476 3300003214 JGI25165J46597_1001282 JGI25165J46597_100128211 247
477 3300003354 JGI25160J50197_1000075 JGI25160J50197_100007549 247
478 3300003374 JGI25161J50226_1001805 JGI25161J50226_10018052 247
479 3300003756 Ga0055533_1000226 Ga0055533_100022626 247
480 3300003758 Ga0055532_1000007 Ga0055532_1000007288 247
481 3300003760 Ga0055527_1000007 Ga0055527_1000007118 247
482 3300003761 Ga0055535_1000005 Ga0055535_1000005288 247
483 3300003762 Ga0055542_1000008 Ga0055542_1000008288 247
484 3300003763 Ga0055529_1000005 Ga0055529_1000005288 247
485 3300003771 Ga0055526_1002641 Ga0055526_10026414 247
486 3300003781 Ga0055536_1003181 Ga0055536_10031811 247
487 3300003791 Ga0055530_10010182 Ga0055530_100101824 247
488 3300003792 Ga0055540_1000131 Ga0055540_100013141 247
489 3300005262 Ga0065165_1000206 Ga0065165_100020649 247
490 3300005614 Ga0068856_100065639 Ga0068856_1000656391 247
491 3300006048 Ga0075363_100108886 Ga0075363_1001088861 247
492 3300006177 Ga0075362_10053857 Ga0075362_100538572 247
493 3300015262 Ga0182007_10000594 Ga0182007_1000059413 247
494 3300016635 Ga0183361_10004 Ga0183361_1000442 247
495 3300021361 Ga0213872_10060518 Ga0213872_100605182 247
496 3300025206 Ga0209435_100059 Ga0209435_10005946 247
497 3300025226 Ga0209674_100020 Ga0209674_100020262 247
498 3300025228 Ga0209672_100013 Ga0209672_100013376 247
499 3300025228 Ga0209672_102901 Ga0209672_1029014 247
500 3300025229 Ga0209147_100013 Ga0209147_100013252 247
501 3300025230 Ga0209563_100318 Ga0209563_10031812 247
502 3300025231 Ga0207427_101321 Ga0207427_1013218 247
503 3300025233 Ga0209437_100042 Ga0209437_100042373 247
504 3300025233 Ga0209437_100062 Ga0209437_10006242 247
505 3300025242 Ga0209258_100016 Ga0209258_100016376 247
506 3300025246 Ga0209646_1000179 Ga0209646_100017932 247
507 3300025250 Ga0209026_1000212 Ga0209026_100021232 247
508 3300025254 Ga0209148_1000020 Ga0209148_1000020376 247
509 3300025256 Ga0209759_1000022 Ga0209759_1000022196 247
510 3300025256 Ga0209759_1000130 Ga0209759_100013061 247
511 3300025256 Ga0209759_1000246 Ga0209759_100024632 247
512 3300025261 Ga0209233_1000054 Ga0209233_1000054288 247
513 3300025261 Ga0209233_1000055 Ga0209233_1000055115 247
514 3300025261 Ga0209233_1000082 Ga0209233_100008242 247
515 3300025263 Ga0209565_1019341 Ga0209565_10193412 247
516 3300025272 Ga0209455_1000017 Ga0209455_1000017376 247
517 3300025273 Ga0209673_1000642 Ga0209673_100064220 247
518 3300025284 Ga0209130_1000154 Ga0209130_100015451 247
519 3300025292 Ga0209676_1001353 Ga0209676_10013531 247
520 3300025292 Ga0209676_1023678 Ga0209676_10236782 247
521 3300025294 Ga0209025_1000032 Ga0209025_1000032337 247
522 3300025295 Ga0209564_1000025 Ga0209564_1000025442 247
523 3300025298 Ga0209050_1017746 Ga0209050_10177463 247
524 3300025299 Ga0209256_1000907 Ga0209256_100090719 247
525 3300025302 Ga0207426_1000286 Ga0207426_100028651 247
526 3300025303 Ga0209051_1000038 Ga0209051_1000038270 247
527 3300025303 Ga0209051_1002477 Ga0209051_10024778 247
528 3300025304 Ga0209257_1006839 Ga0209257_10068391 247
529 3300025304 Ga0209257_1013777 Ga0209257_10137772 247
530 3300025904 Ga0207647_10010197 Ga0207647_100101973 247
531 3300026078 Ga0207702_10048219 Ga0207702_100482191 247
532 3300027312 Ga0209371_1000991 Ga0209371_100099119 247
533 3300028794 Ga0307515_10000047 Ga0307515_10000047177 247
534 3300028794 Ga0307515_10011208 Ga0307515_1001120818 247
535 3300028794 Ga0307515_10015912 Ga0307515_100159125 247
536 3300030500 Ga0268256_1002858 Ga0268256_10028586 247
537 3300031456 Ga0307513_10087798 Ga0307513_100877983 247
538 3300031507 Ga0307509_10008905 Ga0307509_1000890513 247
539 3300031616 Ga0307508_10003337 Ga0307508_1000333717 247
540 3300032004 Ga0307414_10159919 Ga0307414_101599192 247
541 3300035692 Ga0373935_0053068 Ga0373935_0053068_396_1202 247
542 3300035695 Ga0373927_0000177 Ga0373927_0000177_46800_47606 247
543 3300037068 Ga0373925_0000912 Ga0373925_0000912_15915_16721 247
544 3300037471 Ga0395905_0000024 Ga0395905_0000024_175706_176509 247
545 3300041491 Ga0451833_0369965 Ga0451833_0369965_9963_10775 247
546 3300041492 Ga0451835_0404639 Ga0451835_0404639_9979_10791 247
547 3300041494 Ga0451837_0964406 Ga0451837_0964406_4505_5317 247
548 3300041496 Ga0451839_0063950 Ga0451839_0063950_9979_10791 247
549 3300041498 Ga0451841_0182197 Ga0451841_0182197_1248_2060 247
550 3300041501 Ga0451845_0249129 Ga0451845_0249129_9979_10791 247
551 3300041503 Ga0451847_0341155 Ga0451847_0341155_9979_10791 247
552 3300041505 Ga0451849_0939399 Ga0451849_0939399_9876_10688 247
553 3300041507 Ga0451851_1180298 Ga0451851_1180298_9882_10694 247
554 3300041509 Ga0451843_0385556 Ga0451843_0385556_51_863 247
555 3300041509 Ga0451843_1397501 Ga0451843_1397501_3779_4591 247
556 3300041511 Ga0451855_0055849 Ga0451855_0055849_9979_10791 247
557 3300041511 Ga0451855_1631046 Ga0451855_1631046_46_858 247
558 3300041512 Ga0451853_1250503 Ga0451853_1250503_493_1308 247
559 3300041512 Ga0451853_2474193 Ga0451853_2474193_11759_12571 247
560 3300044694 Ga0466963_0005557 Ga0466963_0005557_3794_4600 247
561 3300044765 Ga0466970_0000134 Ga0466970_0000134_3005_3811 247
562 3300044842 Ga0466957_0030295 Ga0466957_0030295_470_1273 247
563 3300045051 Ga0451576_0114638 Ga0451576_0114638_834_1646 247
564 3300046454 Ga0495592_0004344 Ga0495592_0004344_7339_8142 247
565 3300046455 Ga0495603_0002559 Ga0495603_0002559_8047_8850 247
566 3300046457 Ga0495590_0092750 Ga0495590_0092750_111_914 247
567 3300046459 Ga0495629_0003049 Ga0495629_0003049_3840_4643 247
568 3300046459 Ga0495629_0025918 Ga0495629_0025918_2886_3689 247
569 3300046460 Ga0495638_0014953 Ga0495638_0014953_1885_2688 247
570 3300046460 Ga0495638_0026524 Ga0495638_0026524_523_1335 247
571 3300046461 Ga0495641_0008131 Ga0495641_0008131_4045_4848 247
572 3300046461 Ga0495641_0081729 Ga0495641_0081729_341_1144 247
573 3300046462 Ga0495651_0005709 Ga0495651_0005709_6038_6847 247
574 3300046462 Ga0495651_0307731 Ga0495651_0307731_225_1037 247
575 3300046463 Ga0495653_0000659 Ga0495653_0000659_2148_2951 247
576 3300046463 Ga0495653_0001901 Ga0495653_0001901_3812_4615 247
577 3300046463 Ga0495653_0032641 Ga0495653_0032641_836_1699 247
578 3300046471 Ga0495650_0002436 Ga0495650_0002436_11270_12073 247
579 3300046471 Ga0495650_0005337 Ga0495650_0005337_3418_4221 247
580 3300046472 Ga0495580_0000021 Ga0495580_0000021_60503_61306 247
581 3300046472 Ga0495580_0001238 Ga0495580_0001238_19270_20073 247
582 3300046472 Ga0495580_0014453 Ga0495580_0014453_4167_4970 247
583 3300046472 Ga0495580_0020437 Ga0495580_0020437_2580_3389 247
584 3300046473 Ga0495582_0002256 Ga0495582_0002256_7649_8452 247
585 3300046473 Ga0495582_0092275 Ga0495582_0092275_540_1343 247
586 3300046474 Ga0495605_0010038 Ga0495605_0010038_1973_2776 247
587 3300046476 Ga0495662_0084966 Ga0495662_0084966_11_814 247
588 3300046476 Ga0495662_0109843 Ga0495662_0109843_27_833 247
589 3300046500 Ga0495596_0001307 Ga0495596_0001307_8002_8811 247
590 3300046500 Ga0495596_0011920 Ga0495596_0011920_515_1318 247
591 3300046506 Ga0495583_0003979 Ga0495583_0003979_3747_4550 247
592 3300046507 Ga0495606_0035379 Ga0495606_0035379_2378_3181 247
593 3300046507 Ga0495606_0211131 Ga0495606_0211131_280_1083 247
594 3300046511 Ga0495608_0001999 Ga0495608_0001999_5401_6210 247
595 3300046511 Ga0495608_0014577 Ga0495608_0014577_2080_2883 247
596 3300046514 Ga0495618_0004019 Ga0495618_0004019_4960_5769 247
597 3300046514 Ga0495618_0007368 Ga0495618_0007368_1232_2035 247
598 3300046514 Ga0495618_0128594 Ga0495618_0128594_108_911 247
599 3300046516 Ga0495628_0000533 Ga0495628_0000533_13800_14603 247
600 3300046516 Ga0495628_0057977 Ga0495628_0057977_440_1243 247
601 3300046516 Ga0495628_0074099 Ga0495628_0074099_275_1078 247
602 3300046517 Ga0495630_0001115 Ga0495630_0001115_5783_6586 247
603 3300046517 Ga0495630_0004447 Ga0495630_0004447_5067_5876 247
604 3300046517 Ga0495630_0019106 Ga0495630_0019106_1573_2376 247
605 3300046517 Ga0495630_0057441 Ga0495630_0057441_84_887 247
606 3300046517 Ga0495630_0177749 Ga0495630_0177749_650_1453 247
607 3300046524 Ga0495648_0006451 Ga0495648_0006451_7330_8133 247
608 3300046524 Ga0495648_0033546 Ga0495648_0033546_1150_1953 247
609 3300046524 Ga0495648_0039866 Ga0495648_0039866_1111_1923 247
610 3300046524 Ga0495648_0062657 Ga0495648_0062657_712_1521 247
611 3300046526 Ga0495666_0001889 Ga0495666_0001889_7588_8391 247
612 3300046526 Ga0495666_0005660 Ga0495666_0005660_226_1035 247
613 3300046526 Ga0495666_0009162 Ga0495666_0009162_1578_2381 247
614 3300046529 Ga0495652_0007568 Ga0495652_0007568_6758_7561 247
615 3300046531 Ga0495665_0006800 Ga0495665_0006800_3110_3913 247
616 3300046531 Ga0495665_0006996 Ga0495665_0006996_778_1587 247
617 3300046531 Ga0495665_0055384 Ga0495665_0055384_340_1143 247
618 3300046531 Ga0495665_0114791 Ga0495665_0114791_341_1144 247
619 3300046533 Ga0495640_0006139 Ga0495640_0006139_4847_5656 247
620 3300046533 Ga0495640_0029325 Ga0495640_0029325_2169_2972 247
621 3300046535 Ga0495586_0021480 Ga0495586_0021480_155_958 247
622 3300046536 Ga0495587_0005309 Ga0495587_0005309_769_1572 247
623 3300046536 Ga0495587_0010870 Ga0495587_0010870_184_993 247
624 3300046538 Ga0495609_0141802 Ga0495609_0141802_97_900 247
625 3300046543 Ga0495645_0000313 Ga0495645_0000313_23001_23804 247
626 3300046558 Ga0495633_0113812 Ga0495633_0113812_377_1189 247
627 3300046559 Ga0495667_0031596 Ga0495667_0031596_596_1399 247
628 3300046642 Ga0495634_0004682 Ga0495634_0004682_7998_8801 247
629 3300046642 Ga0495634_0019389 Ga0495634_0019389_1300_2103 247
630 3300046648 Ga0495611_0143095 Ga0495611_0143095_43_852 247
631 3300046663 Ga0495635_0000355 Ga0495635_0000355_11133_11936 247
632 3300046663 Ga0495635_0053464 Ga0495635_0053464_1361_2164 247
633 3300046665 Ga0495661_0007568 Ga0495661_0007568_5753_6562 247
634 3300046665 Ga0495661_0011156 Ga0495661_0011156_2368_3171 247
635 3300046678 Ga0495599_0012618 Ga0495599_0012618_2360_3163 247
636 3300046678 Ga0495599_0063471 Ga0495599_0063471_918_1727 247
637 3300046679 Ga0495623_0003646 Ga0495623_0003646_7115_7918 247
638 3300046679 Ga0495623_0007587 Ga0495623_0007587_4286_5089 247
639 3300046679 Ga0495623_0016109 Ga0495623_0016109_1017_1826 247
640 3300046679 Ga0495623_0143505 Ga0495623_0143505_594_1397 247
641 3300046680 Ga0495646_0000838 Ga0495646_0000838_2345_3148 247
642 3300046680 Ga0495646_0015636 Ga0495646_0015636_2622_3431 247
643 3300046680 Ga0495646_0046995 Ga0495646_0046995_125_928 247
644 3300046680 Ga0495646_0105242 Ga0495646_0105242_16_819 247
645 3300046689 Ga0495613_0018369 Ga0495613_0018369_1089_1898 247
646 3300046689 Ga0495613_0080430 Ga0495613_0080430_1411_2214 247
647 3300046689 Ga0495613_0118115 Ga0495613_0118115_865_1668 247
648 3300046690 Ga0495624_0000260 Ga0495624_0000260_23495_24298 247
649 3300046690 Ga0495624_0007749 Ga0495624_0007749_2840_3643 247
650 3300046690 Ga0495624_0038379 Ga0495624_0038379_565_1368 247
651 3300046690 Ga0495624_0114645 Ga0495624_0114645_731_1540 247
652 3300046692 Ga0495671_0029997 Ga0495671_0029997_632_1441 247
653 3300046692 Ga0495671_0120472 Ga0495671_0120472_308_1111 247
654 3300046694 Ga0495649_0050161 Ga0495649_0050161_706_1509 247
655 3300046694 Ga0495649_0090236 Ga0495649_0090236_727_1530 247
656 3300046809 Ga0495600_0001800 Ga0495600_0001800_9795_10604 247
657 3300046809 Ga0495600_0012618 Ga0495600_0012618_3675_4478 247
658 3300046809 Ga0495600_0089529 Ga0495600_0089529_118_921 247
659 3300047315 Ga0495581_0000765 Ga0495581_0000765_13928_14731 247
660 3300047315 Ga0495581_0016521 Ga0495581_0016521_3319_4128 247
661 3300047317 Ga0495604_0002776 Ga0495604_0002776_10975_11778 247
662 3300047317 Ga0495604_0073169 Ga0495604_0073169_1616_2425 247
663 3300047317 Ga0495604_0153227 Ga0495604_0153227_220_1023 247
664 3300047317 Ga0495604_0182447 Ga0495604_0182447_496_1299 247
665 3300047319 Ga0495674_0004831 Ga0495674_0004831_6807_7610 247
666 3300047319 Ga0495674_0026080 Ga0495674_0026080_341_1144 247
667 3300047319 Ga0495674_0039907 Ga0495674_0039907_196_1002 247
668 3300047319 Ga0495674_0041642 Ga0495674_0041642_2325_3128 247
669 3300047319 Ga0495674_0135842 Ga0495674_0135842_927_1730 247
670 3300047319 Ga0495674_0232340 Ga0495674_0232340_392_1195 247
671 3300047320 Ga0495672_0061435 Ga0495672_0061435_778_1581 247
672 3300047321 Ga0495676_0001337 Ga0495676_0001337_18035_18838 247
673 3300047321 Ga0495676_0004074 Ga0495676_0004074_7459_8268 247
674 3300047321 Ga0495676_0067413 Ga0495676_0067413_777_1580 247
675 3300047321 Ga0495676_0148227 Ga0495676_0148227_113_916 247
676 3300047322 Ga0495680_0011243 Ga0495680_0011243_3280_4083 247
677 3300047322 Ga0495680_0038076 Ga0495680_0038076_858_1661 247
678 3300047322 Ga0495680_0059831 Ga0495680_0059831_1260_2063 247
679 3300047322 Ga0495680_0081298 Ga0495680_0081298_1317_2120 247
680 3300047322 Ga0495680_0135729 Ga0495680_0135729_407_1270 247
681 3300047323 Ga0495683_0000897 Ga0495683_0000897_7331_8140 247
682 3300047323 Ga0495683_0018145 Ga0495683_0018145_309_1112 247
683 3300047323 Ga0495683_0028836 Ga0495683_0028836_1667_2470 247
684 3300047323 Ga0495683_0032715 Ga0495683_0032715_457_1260 247
685 3300047323 Ga0495683_0163462 Ga0495683_0163462_39_851 247
686 3300047443 Ga0495687_003187 Ga0495687_003187_909_1712 247
687 3300047444 Ga0495675_0006712 Ga0495675_0006712_2505_3314 247
688 3300047444 Ga0495675_0154225 Ga0495675_0154225_47_850 247
689 3300047446 Ga0495679_000006 Ga0495679_000006_91015_91818 247
690 3300047446 Ga0495679_000579 Ga0495679_000579_22146_22949 247
691 3300047471 Ga0495684_0008753 Ga0495684_0008753_590_1393 247
692 3300047673 Ga0495593_0006281 Ga0495593_0006281_2295_3098 247
693 3300047673 Ga0495593_0015428 Ga0495593_0015428_737_1540 247
694 3300047673 Ga0495593_0031209 Ga0495593_0031209_226_1035 247
695 3300047673 Ga0495593_0114907 Ga0495593_0114907_322_1125 247
696 3300048088 Ga0495602_0001820 Ga0495602_0001820_15539_16402 247
697 3300048088 Ga0495602_0033866 Ga0495602_0033866_2241_3044 247
698 3300048088 Ga0495602_0074175 Ga0495602_0074175_1763_2566 247
699 3300048088 Ga0495602_0078346 Ga0495602_0078346_1083_1892 247
700 3300048088 Ga0495602_0272158 Ga0495602_0272158_157_960 247
701 3300048089 Ga0495614_0001581 Ga0495614_0001581_2334_3137 247
702 3300048089 Ga0495614_0045118 Ga0495614_0045118_899_1708 247
703 3300048089 Ga0495614_0073546 Ga0495614_0073546_282_1085 247
704 3300048921 Ga0496118_0064605 Ga0496118_0064605_1757_2560 247
705 3300048922 Ga0496119_0001101 Ga0496119_0001101_30212_31024 247
706 3300048923 Ga0496120_0028398 Ga0496120_0028398_1421_2233 247
707 3300048925 Ga0496122_0037291 Ga0496122_0037291_1340_2146 247
708 3300048926 Ga0496123_0033287 Ga0496123_0033287_39_851 247
709 3300048926 Ga0496123_0117690 Ga0496123_0117690_113_919 247
710 3300048927 Ga0496124_0025798 Ga0496124_0025798_4376_5182 247
711 3300048927 Ga0496124_0031409 Ga0496124_0031409_1217_2029 247
712 3300048928 Ga0496125_0005811 Ga0496125_0005811_7938_8744 247
713 3300048928 Ga0496125_0055326 Ga0496125_0055326_204_1010 247
714 3300048929 Ga0496126_0000102 Ga0496126_0000102_128658_129461 247
715 3300048929 Ga0496126_0076279 Ga0496126_0076279_214_1026 247
716 3300049460 Ga0495682_0031736 Ga0495682_0031736_731_1540 247
717 3300049460 Ga0495682_0058454 Ga0495682_0058454_30_842 247
718 3300049570 Ga0501033_0000026 Ga0501033_0000026_76491_77360 247
719 3300049579 Ga0501043_0037747 Ga0501043_0037747_382_1188 247
720 3300049822 Ga0501035_0000382 Ga0501035_0000382_16904_17773 247
721 3300050489 nmdc:mga03683_67884_c1 nmdc:mga03683_67884_c1_433_1239 247
722 3300050516 nmdc:mga0sz30_26412_c1 nmdc:mga0sz30_26412_c1_180_992 247
723 3300053125 Ga0500618_000334 Ga0500618_000334_17877_18683 247
724 3300053125 Ga0500618_002415 Ga0500618_002415_3654_4466 247
725 3300053148 Ga0500590_000241 Ga0500590_000241_2281_3093 247
726 3300053161 Ga0500634_0094965 Ga0500634_0094965_329_1141 247
727 3300053177 Ga0500636_0002775 Ga0500636_0002775_5810_6622 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

37

264

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v8t-assembly1.cif.gz_F crystal structure of class ii pyruvate aldolase from pseudomonas aeruginosa. 0.9694 2 233
2v5j-assembly1.cif.gz_B apo class ii aldolase hpch 0.9693 5 233
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.9629 4 233
7et9-assembly1.cif.gz_A crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii 0.9616 1 233
2vws-assembly1.cif.gz_A crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 0.9605 1 233
ID Description Score Start End Superfamily
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9374 2 234 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9241 5 246 3.20.20.60
4mf4F00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9238 5 234 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9023 5 246 3.20.20.60
af_Q4DGT6_3_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.897 8 236 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A5U5NAT3-F1-model_v4 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase 0.9865 4 120 GO:0005737
GO:0016832
AF-A0A377AQH6-F1-model_v4 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase (EC 4.1.2.-, EC 4.1.2.20) 0.9852 4 115 GO:0005737
GO:0008672
AF-A0A529HSF0-F1-model_v4 2-dehydro-3-deoxyglucarate aldolase 0.9843 1 150 GO:0005737
GO:0016832
AF-A0A8B3HJE0-F1-model_v4 deleted 0.9832 3 138
AF-A0A5D8SJH4-F1-model_v4 deleted 0.9827 3 138

Feature Viewer

pLDDT pTM Quality
93.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map