F477720

General Info

Members Datasets Scaffolds Average Seq Length
727 294 708 107

Family's Representative Sequence

Representative Sequence 3300002774|JGI25150J39212_1001080|JGI25150J39212_10010807
Length 108
Sequence MARALIHMPAAARPGEVIEIRALIGHPMETGYRVGAEGKLLARDIIRKFACRYNGEAVFSAELHQAISANPYLAFFALATESGTLEFTWEGDNGFAHTEKMQLTVNAS

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2643221664 Massilia sp. Root418 Isolate Unclassified
5 2738541280 Massilia sp. GV090 Isolate Unclassified
6 2738541297 Duganella sp. GV083 Isolate Unclassified
7 2738541300 Massilia sp. GV016 Isolate Unclassified
8 2738541357 Duganella sp. GV053 Isolate Unclassified
9 2738543003 Duganella sp. GV066 Isolate Unclassified
10 2738543018 Massilia sp. GV045 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2821131069 Duganella sp. 1224 Isolate Unclassified
15 2842711865 Duganella sp. R-73148 Isolate Unclassified
16 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
17 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2857564685 Duganella sp. R-74599 Isolate Unclassified
20 2904424332 Duganella sp. 1411 Isolate Rhizosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
172 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
173 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
186 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
196 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
197 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
217 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
257 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
277 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
291 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
292 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.15
Nodule 0.41
Rhizoplane 1.38
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_77071 2162886006 Unclassified 890
2 JGI25150J39212_1001080 3300002774 Bacteria 8277
3 JGI25153J46596_10023199 3300003215 Bacteria 2267
4 Ga0055526_1000076 3300003771 Bacteria 92438
5 Ga0065165_1046968 3300005262 Bacteria 1249
6 Ga0065707_10086066 3300005295 Bacteria 5688
7 Ga0070676_10015378 3300005328 Bacteria 4221
8 Ga0070676_10155960 3300005328 Bacteria 1465
9 Ga0070670_100024911 3300005331 Bacteria 5148
10 Ga0070670_100036896 3300005331 Bacteria 4206
11 Ga0070670_100087837 3300005331 Bacteria 2672
12 Ga0070670_100097024 3300005331 Bacteria 2536
13 Ga0070670_100229059 3300005331 Bacteria 1617
14 Ga0070677_10033503 3300005333 Bacteria 1978
15 Ga0068869_100052394 3300005334 Bacteria 2963
16 Ga0070666_10018958 3300005335 Bacteria 4434
17 Ga0070666_10421761 3300005335 Bacteria 961
18 Ga0070666_10767488 3300005335 Bacteria 709
19 Ga0068868_100107587 3300005338 Bacteria 2263
20 Ga0068868_100769845 3300005338 Unclassified 866
21 Ga0068868_101443934 3300005338 Bacteria 643
22 Ga0070689_100395294 3300005340 Bacteria 1167
23 Ga0070689_101500073 3300005340 Bacteria 611
24 Ga0070687_100560180 3300005343 Bacteria 779
25 Ga0070692_11085787 3300005345 Unclassified 564
26 Ga0070668_100003787 3300005347 Bacteria 11170
27 Ga0070668_100012670 3300005347 Bacteria 6277
28 Ga0070668_100171771 3300005347 Bacteria 1765
29 Ga0070668_100460986 3300005347 Bacteria 1094
30 Ga0070669_100031537 3300005353 Bacteria 3828
31 Ga0070669_100034710 3300005353 Bacteria 3652
32 Ga0070669_100175357 3300005353 Bacteria 1674
33 Ga0070669_100284347 3300005353 Unclassified 1326
34 Ga0070669_100499577 3300005353 Bacteria 1009
35 Ga0070669_101592261 3300005353 Unclassified 569
36 Ga0070669_101599332 3300005353 Unclassified 567
37 Ga0070669_101936968 3300005353 Unclassified 515
38 Ga0070675_100137162 3300005354 Bacteria 2088
39 Ga0070675_100959005 3300005354 Unclassified 785
40 Ga0070675_101188243 3300005354 Unclassified 702
41 Ga0070671_100145402 3300005355 Bacteria 2001
42 Ga0070671_100230322 3300005355 Bacteria 1572
43 Ga0070674_100018163 3300005356 Bacteria 4441
44 Ga0070674_101616530 3300005356 Bacteria 585
45 Ga0070674_101806335 3300005356 Unclassified 554
46 Ga0070673_100023121 3300005364 Bacteria 4538
47 Ga0070673_100204719 3300005364 Bacteria 1701
48 Ga0070673_100305899 3300005364 Bacteria 1401
49 Ga0070673_100335366 3300005364 Bacteria 1339
50 Ga0070673_100764564 3300005364 Bacteria 890
51 Ga0070659_101868515 3300005366 Unclassified 538
52 Ga0070667_100002775 3300005367 Bacteria 15131
53 Ga0070667_100101928 3300005367 Bacteria 2480
54 Ga0070667_100124433 3300005367 Bacteria 2246
55 Ga0070667_101438622 3300005367 Bacteria 647
56 Ga0070667_101846351 3300005367 Bacteria 569
57 Ga0070701_10054031 3300005438 Bacteria 2093
58 Ga0070705_100060754 3300005440 Bacteria 2243
59 Ga0070700_100085521 3300005441 Bacteria 2046
60 Ga0070700_100173693 3300005441 Bacteria 1494
61 Ga0070694_100323093 3300005444 Bacteria 1188
62 Ga0070663_100114425 3300005455 Bacteria 2031
63 Ga0070663_100159675 3300005455 Bacteria 1734
64 Ga0070663_100192388 3300005455 Bacteria 1588
65 Ga0070663_101244811 3300005455 Unclassified 655
66 Ga0070663_101476042 3300005455 Unclassified 604
67 Ga0070678_100175102 3300005456 Bacteria 1751
68 Ga0070678_100852714 3300005456 Bacteria 830
69 Ga0070678_100962639 3300005456 Bacteria 783
70 Ga0070662_100098320 3300005457 Bacteria 2210
71 Ga0070662_100812839 3300005457 Bacteria 795
72 Ga0070662_101733597 3300005457 Bacteria 539
73 Ga0068867_100000657 3300005459 Bacteria 22867
74 Ga0068867_100144494 3300005459 Bacteria 1863
75 Ga0068867_100216941 3300005459 Bacteria 1539
76 Ga0068867_100289985 3300005459 Bacteria 1345
77 Ga0068867_101245697 3300005459 Unclassified 685
78 Ga0068867_101444198 3300005459 Bacteria 639
79 Ga0070685_10878388 3300005466 Bacteria 666
80 Ga0070685_10893150 3300005466 Bacteria 661
81 Ga0070699_100995516 3300005518 Bacteria 769
82 Ga0068853_100527057 3300005539 Unclassified 1117
83 Ga0068853_100794310 3300005539 Bacteria 906
84 Ga0068853_101355321 3300005539 Unclassified 688
85 Ga0070672_100035219 3300005543 Bacteria 3805
86 Ga0070672_100052298 3300005543 Bacteria 3188
87 Ga0070672_100153144 3300005543 Bacteria 1908
88 Ga0070672_100266764 3300005543 Bacteria 1445
89 Ga0070672_101868122 3300005543 Bacteria 540
90 Ga0070686_100852389 3300005544 Bacteria 738
91 Ga0070695_100840904 3300005545 Bacteria 738
92 Ga0070696_100622256 3300005546 Unclassified 872
93 Ga0070665_100152338 3300005548 Bacteria 2315
94 Ga0070665_100576460 3300005548 Bacteria 1138
95 Ga0070665_102017463 3300005548 Unclassified 582
96 Ga0068855_100147448 3300005563 Bacteria 2678
97 Ga0068855_100744169 3300005563 Bacteria 1046
98 Ga0070664_100192240 3300005564 Bacteria 1819
99 Ga0068857_101495062 3300005577 Bacteria 658
100 Ga0068854_100171382 3300005578 Bacteria 1689
101 Ga0068856_101516467 3300005614 Bacteria 684
102 Ga0070702_100258978 3300005615 Bacteria 1183
103 Ga0070702_100397058 3300005615 Bacteria 985
104 Ga0068852_100162543 3300005616 Bacteria 2086
105 Ga0068859_100005698 3300005617 Bacteria 12676
106 Ga0068859_100520088 3300005617 Unclassified 1285
107 Ga0068859_101798125 3300005617 Bacteria 677
108 Ga0068859_102050047 3300005617 Bacteria 632
109 Ga0068864_100002722 3300005618 Bacteria 14552
110 Ga0068864_100450649 3300005618 Bacteria 1230
111 Ga0068864_100492841 3300005618 Bacteria 1178
112 Ga0068864_101118958 3300005618 Bacteria 784
113 Ga0068866_10015661 3300005718 Bacteria 3372
114 Ga0068866_10314860 3300005718 Bacteria 982
115 Ga0068861_100005962 3300005719 Bacteria 8278
116 Ga0068861_100057818 3300005719 Bacteria 2963
117 Ga0068861_100138538 3300005719 Bacteria 1983
118 Ga0068861_100540397 3300005719 Bacteria 1060
119 Ga0068861_101937333 3300005719 Unclassified 587
120 Ga0068870_10019822 3300005840 Bacteria 3267
121 Ga0068863_100004498 3300005841 Bacteria 13754
122 Ga0068863_100033786 3300005841 Bacteria 4873
123 Ga0068863_100052443 3300005841 Bacteria 3866
124 Ga0068863_100347437 3300005841 Bacteria 1444
125 Ga0068863_100739470 3300005841 Bacteria 979
126 Ga0068858_100009800 3300005842 Bacteria 9118
127 Ga0068858_100043035 3300005842 Bacteria 4188
128 Ga0068858_100085178 3300005842 Bacteria 2940
129 Ga0068858_100115646 3300005842 Bacteria 2507
130 Ga0068858_100435582 3300005842 Bacteria 1262
131 Ga0068858_101291673 3300005842 Bacteria 718
132 Ga0068860_100001192 3300005843 Bacteria 28385
133 Ga0068860_100002473 3300005843 Bacteria 19393
134 Ga0068860_100562914 3300005843 Bacteria 1143
135 Ga0068862_100007385 3300005844 Bacteria 9115
136 Ga0068862_100014870 3300005844 Bacteria 6464
137 Ga0068862_100023787 3300005844 Bacteria 5136
138 Ga0068862_100040508 3300005844 Bacteria 3959
139 Ga0068862_100134814 3300005844 Bacteria 2187
140 Ga0068862_100148802 3300005844 Bacteria 2083
141 Ga0068862_100747524 3300005844 Unclassified 951
142 Ga0068862_101062498 3300005844 Bacteria 803
143 Ga0075365_10219475 3300006038 Bacteria 1334
144 Ga0075368_10049610 3300006042 Bacteria 1666
145 Ga0075363_100102184 3300006048 Bacteria 1587
146 Ga0075363_100624729 3300006048 Bacteria 647
147 Ga0075364_10182924 3300006051 Bacteria 1419
148 Ga0075362_10047229 3300006177 Bacteria 1917
149 Ga0075362_10229813 3300006177 Bacteria 908
150 Ga0075367_10045125 3300006178 Bacteria 2586
151 Ga0075367_10053309 3300006178 Bacteria 2396
152 Ga0075369_10011576 3300006186 Bacteria 3473
153 Ga0075366_10049518 3300006195 Bacteria 2493
154 Ga0075366_11053026 3300006195 Unclassified 508
155 Ga0097621_100243229 3300006237 Bacteria 1574
156 Ga0097621_100457780 3300006237 Unclassified 1150
157 Ga0075370_10034420 3300006353 Bacteria 2839
158 Ga0075370_10124672 3300006353 Bacteria 1501
159 Ga0068871_100061432 3300006358 Bacteria 3068
160 Ga0068871_100254427 3300006358 Bacteria 1531
161 Ga0068871_100557768 3300006358 Bacteria 1038
162 Ga0075430_100892095 3300006846 Bacteria 732
163 Ga0075434_100345600 3300006871 Bacteria 1509
164 Ga0075434_101393458 3300006871 Unclassified 711
165 Ga0068865_100004995 3300006881 Bacteria 8020
166 Ga0068865_100246881 3300006881 Bacteria 1407
167 Ga0068865_100529798 3300006881 Bacteria 986
168 Ga0097620_100005698 3300006931 Bacteria 12676
169 Ga0097620_100520102 3300006931 Unclassified 1285
170 Ga0097620_101798001 3300006931 Bacteria 677
171 Ga0097620_102050038 3300006931 Bacteria 632
172 Ga0075435_100767022 3300007076 Unclassified 839
173 Ga0105251_10229738 3300009011 Unclassified 835
174 Ga0105244_10001199 3300009036 Bacteria 21311
175 Ga0105244_10002531 3300009036 Bacteria 13730
176 Ga0111539_11092002 3300009094 Bacteria 927
177 Ga0111539_11564555 3300009094 Bacteria 765
178 Ga0105245_10000925 3300009098 Bacteria 26651
179 Ga0105245_11389401 3300009098 Unclassified 752
180 Ga0105247_10272246 3300009101 Bacteria 1165
181 Ga0105243_10051006 3300009148 Bacteria 3270
182 Ga0105243_10165724 3300009148 Bacteria 1909
183 Ga0105242_10702708 3300009176 Unclassified 989
184 Ga0105242_12502694 3300009176 Bacteria 564
185 Ga0105248_10069828 3300009177 Bacteria 3945
186 Ga0105248_10099242 3300009177 Bacteria 3281
187 Ga0105248_10128792 3300009177 Bacteria 2855
188 Ga0105248_12182146 3300009177 Bacteria 630
189 Ga0105237_10698851 3300009545 Bacteria 1021
190 Ga0105238_10025009 3300009551 Bacteria 6087
191 Ga0105238_11357564 3300009551 Bacteria 737
192 Ga0105249_10052349 3300009553 Bacteria 3728
193 Ga0105249_10071357 3300009553 Bacteria 3208
194 Ga0105249_11536065 3300009553 Bacteria 738
195 Ga0105249_12263011 3300009553 Bacteria 616
196 Ga0105249_13015106 3300009553 Unclassified 541
197 Ga0105249_13202079 3300009553 Unclassified 526
198 Ga0105239_10342915 3300010375 Bacteria 1686
199 Ga0105246_10271245 3300011119 Bacteria 1356
200 Ga0157374_10961773 3300013296 Bacteria 873
201 Ga0157378_10066279 3300013297 Bacteria 3234
202 Ga0157378_10099570 3300013297 Bacteria 2652
203 Ga0157378_10836671 3300013297 Bacteria 948
204 Ga0157378_11986302 3300013297 Bacteria 631
205 Ga0157378_12104199 3300013297 Unclassified 615
206 Ga0163162_10007520 3300013306 Bacteria 10608
207 Ga0163162_10342530 3300013306 Bacteria 1627
208 Ga0163162_10367632 3300013306 Bacteria 1571
209 Ga0163162_10848281 3300013306 Bacteria 1029
210 Ga0163162_11241560 3300013306 Unclassified 846
211 Ga0157375_10100656 3300013308 Bacteria 2971
212 Ga0157375_10958393 3300013308 Unclassified 997
213 Ga0157375_11226822 3300013308 Bacteria 880
214 Ga0163163_10003043 3300014325 Bacteria 14199
215 Ga0163163_10163897 3300014325 Bacteria 2269
216 Ga0163163_11559494 3300014325 Unclassified 722
217 Ga0163163_12944008 3300014325 Bacteria 531
218 Ga0157380_10231923 3300014326 Bacteria 1659
219 Ga0157380_10484937 3300014326 Bacteria 1197
220 Ga0157379_10000388 3300014968 Bacteria 35598
221 Ga0157379_10067641 3300014968 Bacteria 3193
222 Ga0157379_10242792 3300014968 Bacteria 1634
223 Ga0157379_10295591 3300014968 Bacteria 1475
224 Ga0157379_12151407 3300014968 Bacteria 553
225 Ga0157376_10139506 3300014969 Bacteria 2173
226 Ga0157376_10768743 3300014969 Bacteria 974
227 Ga0157376_10818434 3300014969 Unclassified 945
228 Ga0157376_12162937 3300014969 Unclassified 595
229 Ga0163161_10013229 3300017792 Bacteria 5736
230 Ga0163161_10014363 3300017792 Bacteria 5512
231 Ga0163161_10813418 3300017792 Bacteria 786
232 Ga0213872_10000136 3300021361 Bacteria 66682
233 Ga0213872_10000981 3300021361 Bacteria 19948
234 Ga0213872_10006546 3300021361 Bacteria 5827
235 Ga0207425_1000216 3300025245 Bacteria 45716
236 Ga0209565_1000112 3300025263 Bacteria 117209
237 Ga0209565_1006531 3300025263 Bacteria 3261
238 Ga0209673_1000210 3300025273 Bacteria 117276
239 Ga0209675_1000142 3300025291 Bacteria 95327
240 Ga0209675_1079782 3300025291 Bacteria 608
241 Ga0209025_1004048 3300025294 Bacteria 13113
242 Ga0209564_1000042 3300025295 Bacteria 392805
243 Ga0209564_1000245 3300025295 Bacteria 117378
244 Ga0209564_1014928 3300025295 Bacteria 3196
245 Ga0209758_1000707 3300025297 Bacteria 49499
246 Ga0209256_1000252 3300025299 Bacteria 94936
247 Ga0209256_1000268 3300025299 Bacteria 91897
248 Ga0207697_10094543 3300025315 Bacteria 1269
249 Ga0207655_1004090 3300025728 Bacteria 10499
250 Ga0207655_1004269 3300025728 Bacteria 10218
251 Ga0207682_10203608 3300025893 Unclassified 911
252 Ga0207682_10213398 3300025893 Bacteria 891
253 Ga0207642_10010259 3300025899 Bacteria 3294
254 Ga0207642_10345896 3300025899 Bacteria 876
255 Ga0207680_10132592 3300025903 Bacteria 1644
256 Ga0207680_10167997 3300025903 Bacteria 1475
257 Ga0207645_10020821 3300025907 Bacteria 4285
258 Ga0207645_10024870 3300025907 Bacteria 3880
259 Ga0207645_10172944 3300025907 Bacteria 1416
260 Ga0207643_10025325 3300025908 Bacteria 3279
261 Ga0207662_10226136 3300025918 Bacteria 1220
262 Ga0207681_10024334 3300025923 Bacteria 3885
263 Ga0207681_10025636 3300025923 Bacteria 3795
264 Ga0207681_10059894 3300025923 Bacteria 2611
265 Ga0207681_10170163 3300025923 Unclassified 1651
266 Ga0207681_10231343 3300025923 Bacteria 1435
267 Ga0207681_10726003 3300025923 Bacteria 827
268 Ga0207694_10055541 3300025924 Bacteria 3074
269 Ga0207650_10006842 3300025925 Bacteria 7779
270 Ga0207650_10125848 3300025925 Bacteria 2000
271 Ga0207650_10161076 3300025925 Bacteria 1778
272 Ga0207650_10422266 3300025925 Bacteria 1107
273 Ga0207650_10855987 3300025925 Bacteria 771
274 Ga0207659_11775320 3300025926 Unclassified 524
275 Ga0207687_10006169 3300025927 Bacteria 7932
276 Ga0207687_10236138 3300025927 Bacteria 1446
277 Ga0207687_10763075 3300025927 Unclassified 823
278 Ga0207644_10195161 3300025931 Bacteria 1594
279 Ga0207706_10137119 3300025933 Bacteria 2152
280 Ga0207706_10169634 3300025933 Bacteria 1918
281 Ga0207706_11475228 3300025933 Bacteria 556
282 Ga0207686_11404384 3300025934 Bacteria 575
283 Ga0207709_10088306 3300025935 Bacteria 2018
284 Ga0207709_10603524 3300025935 Unclassified 869
285 Ga0207670_10109512 3300025936 Bacteria 1988
286 Ga0207669_10061487 3300025937 Bacteria 2308
287 Ga0207704_10001788 3300025938 Bacteria 9631
288 Ga0207704_10231468 3300025938 Bacteria 1374
289 Ga0207704_10501441 3300025938 Bacteria 978
290 Ga0207704_11050158 3300025938 Bacteria 691
291 Ga0207665_11291174 3300025939 Unclassified 582
292 Ga0207691_10002028 3300025940 Bacteria 19816
293 Ga0207691_10021772 3300025940 Bacteria 6051
294 Ga0207691_10130391 3300025940 Bacteria 2221
295 Ga0207691_10550038 3300025940 Bacteria 979
296 Ga0207691_10601997 3300025940 Bacteria 930
297 Ga0207691_11376039 3300025940 Bacteria 581
298 Ga0207711_10039387 3300025941 Bacteria 4020
299 Ga0207711_10255336 3300025941 Bacteria 1610
300 Ga0207711_10898826 3300025941 Bacteria 823
301 Ga0207689_10000171 3300025942 Bacteria 56716
302 Ga0207689_11457672 3300025942 Unclassified 573
303 Ga0207679_10472015 3300025945 Bacteria 1116
304 Ga0207667_10123985 3300025949 Bacteria 2661
305 Ga0207667_11030551 3300025949 Bacteria 809
306 Ga0207651_10031473 3300025960 Bacteria 3392
307 Ga0207651_10164817 3300025960 Bacteria 1741
308 Ga0207651_10552837 3300025960 Bacteria 1001
309 Ga0207651_11471925 3300025960 Bacteria 613
310 Ga0207712_10228276 3300025961 Bacteria 1493
311 Ga0207712_10236622 3300025961 Unclassified 1469
312 Ga0207712_11271694 3300025961 Bacteria 657
313 Ga0207712_11847071 3300025961 Unclassified 541
314 Ga0207668_10075650 3300025972 Bacteria 2421
315 Ga0207668_10090280 3300025972 Bacteria 2248
316 Ga0207668_10163908 3300025972 Bacteria 1735
317 Ga0207668_10505471 3300025972 Bacteria 1040
318 Ga0207668_10986737 3300025972 Bacteria 752
319 Ga0207668_11775821 3300025972 Bacteria 557
320 Ga0207640_10159799 3300025981 Bacteria 1666
321 Ga0207640_10219177 3300025981 Bacteria 1455
322 Ga0207658_10088696 3300025986 Bacteria 2392
323 Ga0207658_10385965 3300025986 Bacteria 1228
324 Ga0207658_10628124 3300025986 Bacteria 967
325 Ga0207658_11856636 3300025986 Unclassified 549
326 Ga0207677_10028774 3300026023 Bacteria 3521
327 Ga0207677_10487069 3300026023 Bacteria 1064
328 Ga0207677_11183052 3300026023 Bacteria 699
329 Ga0207677_11365543 3300026023 Unclassified 652
330 Ga0207703_10001810 3300026035 Bacteria 19065
331 Ga0207703_10061321 3300026035 Bacteria 3079
332 Ga0207703_10133555 3300026035 Bacteria 2146
333 Ga0207703_10138470 3300026035 Bacteria 2110
334 Ga0207639_10627208 3300026041 Unclassified 993
335 Ga0207639_11576356 3300026041 Unclassified 616
336 Ga0207639_11907956 3300026041 Unclassified 555
337 Ga0207678_10114235 3300026067 Unclassified 2304
338 Ga0207678_10604757 3300026067 Unclassified 961
339 Ga0207678_10806795 3300026067 Bacteria 829
340 Ga0207678_11994019 3300026067 Unclassified 505
341 Ga0207708_10223923 3300026075 Bacteria 1508
342 Ga0207708_10231051 3300026075 Unclassified 1485
343 Ga0207708_11065240 3300026075 Bacteria 704
344 Ga0207641_10015609 3300026088 Bacteria 6225
345 Ga0207641_10030891 3300026088 Bacteria 4439
346 Ga0207641_11980999 3300026088 Bacteria 584
347 Ga0207641_12052684 3300026088 Bacteria 573
348 Ga0207648_10003491 3300026089 Bacteria 16471
349 Ga0207648_10006075 3300026089 Bacteria 12039
350 Ga0207648_10070558 3300026089 Bacteria 3046
351 Ga0207648_10099708 3300026089 Bacteria 2544
352 Ga0207648_10340011 3300026089 Bacteria 1351
353 Ga0207648_11181355 3300026089 Bacteria 718
354 Ga0207676_10013070 3300026095 Bacteria 5959
355 Ga0207676_10084124 3300026095 Bacteria 2593
356 Ga0207676_11331649 3300026095 Bacteria 713
357 Ga0207676_11444058 3300026095 Bacteria 684
358 Ga0207674_10005035 3300026116 Bacteria 15778
359 Ga0207675_100000624 3300026118 Bacteria 34698
360 Ga0207675_100017734 3300026118 Bacteria 6640
361 Ga0207675_100393965 3300026118 Bacteria 1364
362 Ga0207675_100867541 3300026118 Bacteria 918
363 Ga0207675_102051154 3300026118 Bacteria 589
364 Ga0207683_10447084 3300026121 Unclassified 1191
365 Ga0207683_10852526 3300026121 Bacteria 846
366 Ga0207683_11043800 3300026121 Bacteria 758
367 Ga0207698_10307479 3300026142 Bacteria 1479
368 Ga0209282_1000066 3300027666 Bacteria 87072
369 Ga0209813_10208960 3300027866 Bacteria 726
370 Ga0268266_10665769 3300028379 Bacteria 1002
371 Ga0268265_10057755 3300028380 Bacteria 2959
372 Ga0268265_10082659 3300028380 Bacteria 2540
373 Ga0268265_10166879 3300028380 Bacteria 1877
374 Ga0268265_10908763 3300028380 Bacteria 865
375 Ga0268265_10921105 3300028380 Bacteria 859
376 Ga0268265_10941121 3300028380 Bacteria 850
377 Ga0268264_10002375 3300028381 Bacteria 16599
378 Ga0268264_10027750 3300028381 Bacteria 4628
379 Ga0268264_10081222 3300028381 Bacteria 2770
380 Ga0268264_10214243 3300028381 Bacteria 1770
381 Ga0268264_10350678 3300028381 Bacteria 1405
382 Ga0307515_10121841 3300028794 Bacteria 2947
383 Ga0316178_1013714 3300030735 Bacteria 808
384 Ga0316180_1051715 3300030736 Bacteria 1718
385 Ga0316182_1337282 3300030745 Bacteria 1733
386 Ga0307513_10050027 3300031456 Bacteria 4522
387 Ga0307408_102420301 3300031548 Bacteria 510
388 Ga0265314_10067446 3300031711 Bacteria 2410
389 Ga0307516_10712572 3300031730 Bacteria 661
390 Ga0307405_12162026 3300031731 Bacteria 500
391 Ga0307413_10805331 3300031824 Bacteria 790
392 Ga0307410_10072533 3300031852 Bacteria 2391
393 Ga0307412_12252478 3300031911 Bacteria 508
394 Ga0307409_100069616 3300031995 Bacteria 2789
395 Ga0307409_100677461 3300031995 Bacteria 1028
396 Ga0307414_10395113 3300032004 Bacteria 1199
397 Ga0307414_10992560 3300032004 Bacteria 773
398 Ga0307411_10593905 3300032005 Bacteria 951
399 Ga0307411_10785339 3300032005 Unclassified 837
400 Ga0307510_10288278 3300033180 Bacteria 1109
401 Ga0373930_0166093 3300034816 Bacteria 561
402 Ga0373943_0131656 3300035170 Bacteria 1339
403 Ga0373943_0919563 3300035170 Bacteria 523
404 Ga0373946_0179391 3300035171 Bacteria 1004
405 Ga0373955_0294869 3300035172 Bacteria 977
406 Ga0373927_0054996 3300035695 Bacteria 2574
407 Ga0373937_0047579 3300036401 Bacteria 3925
408 Ga0373937_0897059 3300036401 Unclassified 835
409 Ga0373925_0041541 3300037068 Bacteria 3409
410 Ga0373925_0859189 3300037068 Bacteria 748
411 Ga0436361_0324047 3300039447 Bacteria 25390
412 Ga0436361_0470245 3300039447 Bacteria 1406
413 Ga0436361_0954756 3300039447 Bacteria 64588
414 Ga0436361_1158315 3300039447 Bacteria 8002
415 Ga0451807_0992868 3300041486 Unclassified 936
416 Ga0451833_0742599 3300041491 Bacteria 1102
417 Ga0451839_1600323 3300041496 Bacteria 574
418 Ga0451851_0628714 3300041507 Bacteria 837
419 Ga0451853_4017175 3300041512 Unclassified 943
420 Ga0450898_103348 3300042134 Bacteria 597
421 Ga0453684_0104147 3300044712 Bacteria 3465
422 Ga0451576_1867718 3300045051 Unclassified 620
423 Ga0495617_002298 3300046452 Bacteria 7715
424 Ga0495617_002348 3300046452 Bacteria 7579
425 Ga0495617_009698 3300046452 Bacteria 3303
426 Ga0495617_032025 3300046452 Bacteria 1765
427 Ga0495627_127442 3300046453 Bacteria 717
428 Ga0495590_0000056 3300046457 Bacteria 96913
429 Ga0495590_0011115 3300046457 Bacteria 3373
430 Ga0495638_0000170 3300046460 Bacteria 101629
431 Ga0495638_0006602 3300046460 Bacteria 8430
432 Ga0495638_0018858 3300046460 Bacteria 4574
433 Ga0495638_0057139 3300046460 Bacteria 2421
434 Ga0495638_0134103 3300046460 Bacteria 1452
435 Ga0495638_0162551 3300046460 Bacteria 1287
436 Ga0495638_0380917 3300046460 Bacteria 737
437 Ga0495653_0000066 3300046463 Bacteria 91671
438 Ga0495650_0000528 3300046471 Bacteria 55706
439 Ga0495650_0000553 3300046471 Bacteria 53302
440 Ga0495650_0000571 3300046471 Bacteria 51694
441 Ga0495650_0001888 3300046471 Bacteria 18636
442 Ga0495650_0003450 3300046471 Bacteria 11527
443 Ga0495650_0026921 3300046471 Bacteria 2665
444 Ga0495650_0065614 3300046471 Bacteria 1440
445 Ga0495605_0000315 3300046474 Bacteria 50714
446 Ga0495605_0006948 3300046474 Bacteria 6463
447 Ga0495605_0097630 3300046474 Bacteria 1354
448 Ga0495605_0477060 3300046474 Unclassified 511
449 Ga0495639_0020556 3300046475 Bacteria 2885
450 Ga0495584_0000365 3300046491 Bacteria 31489
451 Ga0495584_0001822 3300046491 Bacteria 12380
452 Ga0495584_0040200 3300046491 Bacteria 2361
453 Ga0495584_0043337 3300046491 Bacteria 2271
454 Ga0495584_0069467 3300046491 Bacteria 1770
455 Ga0495585_0000070 3300046492 Bacteria 106156
456 Ga0495585_0000646 3300046492 Bacteria 32025
457 Ga0495585_0027344 3300046492 Bacteria 3255
458 Ga0495585_0036737 3300046492 Bacteria 2760
459 Ga0495585_0089094 3300046492 Bacteria 1663
460 Ga0495585_0089739 3300046492 Bacteria 1656
461 Ga0495596_0002901 3300046500 Bacteria 8917
462 Ga0495607_0000906 3300046501 Bacteria 27598
463 Ga0495607_0001697 3300046501 Bacteria 18946
464 Ga0495607_0014081 3300046501 Bacteria 5220
465 Ga0495607_0023081 3300046501 Bacteria 3897
466 Ga0495607_0031611 3300046501 Bacteria 3239
467 Ga0495607_0068419 3300046501 Bacteria 1991
468 Ga0495607_0119767 3300046501 Bacteria 1383
469 Ga0495607_0193213 3300046501 Bacteria 1012
470 Ga0495607_0414345 3300046501 Unclassified 611
471 Ga0495583_0000417 3300046506 Bacteria 64786
472 Ga0495583_0003284 3300046506 Bacteria 12546
473 Ga0495583_0037555 3300046506 Bacteria 2295
474 Ga0495583_0075043 3300046506 Bacteria 1479
475 Ga0495606_0000063 3300046507 Bacteria 184610
476 Ga0495606_0000431 3300046507 Bacteria 69714
477 Ga0495606_0001347 3300046507 Bacteria 33360
478 Ga0495606_0001680 3300046507 Bacteria 28578
479 Ga0495606_0003374 3300046507 Bacteria 16993
480 Ga0495606_0004107 3300046507 Bacteria 14789
481 Ga0495606_0151700 3300046507 Bacteria 1359
482 Ga0495606_0243431 3300046507 Bacteria 1002
483 Ga0495610_0000014 3300046512 Bacteria 444708
484 Ga0495610_0000353 3300046512 Bacteria 48216
485 Ga0495610_0000394 3300046512 Bacteria 45242
486 Ga0495610_0001670 3300046512 Bacteria 19517
487 Ga0495610_0004877 3300046512 Bacteria 9752
488 Ga0495610_0005618 3300046512 Bacteria 8852
489 Ga0495610_0009648 3300046512 Bacteria 6077
490 Ga0495610_0043076 3300046512 Bacteria 2252
491 Ga0495610_0278043 3300046512 Bacteria 653
492 Ga0495616_0001267 3300046513 Bacteria 17758
493 Ga0495616_0004391 3300046513 Bacteria 8897
494 Ga0495616_0011359 3300046513 Bacteria 5108
495 Ga0495631_0040983 3300046518 Bacteria 2050
496 Ga0495637_0000150 3300046520 Bacteria 53429
497 Ga0495637_0006039 3300046520 Bacteria 6115
498 Ga0495643_0000246 3300046522 Bacteria 80483
499 Ga0495643_0000302 3300046522 Bacteria 68932
500 Ga0495643_0484213 3300046522 Unclassified 534
501 Ga0495644_0000451 3300046523 Bacteria 18007
502 Ga0495644_0000622 3300046523 Bacteria 14853
503 Ga0495644_0185132 3300046523 Bacteria 801
504 Ga0495648_0000119 3300046524 Bacteria 95682
505 Ga0495648_0000240 3300046524 Bacteria 62286
506 Ga0495648_0000486 3300046524 Bacteria 42701
507 Ga0495648_0003471 3300046524 Bacteria 13857
508 Ga0495648_0013106 3300046524 Bacteria 6146
509 Ga0495648_0028050 3300046524 Bacteria 3756
510 Ga0495648_0094281 3300046524 Bacteria 1667
511 Ga0495648_0101601 3300046524 Bacteria 1586
512 Ga0495648_0134477 3300046524 Bacteria 1310
513 Ga0495642_0001364 3300046528 Bacteria 10919
514 Ga0495642_0355163 3300046528 Bacteria 644
515 Ga0495654_0000014 3300046530 Bacteria 312126
516 Ga0495654_0006366 3300046530 Bacteria 6713
517 Ga0495654_0006588 3300046530 Bacteria 6576
518 Ga0495654_0149314 3300046530 Bacteria 1035
519 Ga0495654_0324382 3300046530 Bacteria 624
520 Ga0495586_0008325 3300046535 Bacteria 5521
521 Ga0495609_0000190 3300046538 Bacteria 61573
522 Ga0495609_0000803 3300046538 Bacteria 23487
523 Ga0495609_0000816 3300046538 Bacteria 23247
524 Ga0495609_0001962 3300046538 Bacteria 13050
525 Ga0495609_0003738 3300046538 Bacteria 8596
526 Ga0495609_0014881 3300046538 Bacteria 3650
527 Ga0495609_0023045 3300046538 Bacteria 2863
528 Ga0495609_0087426 3300046538 Bacteria 1357
529 Ga0495621_0262975 3300046539 Unclassified 707
530 Ga0495597_0000069 3300046542 Bacteria 89990
531 Ga0495597_0000123 3300046542 Bacteria 70236
532 Ga0495597_0002767 3300046542 Bacteria 10803
533 Ga0495597_0012964 3300046542 Bacteria 4003
534 Ga0495597_0121662 3300046542 Bacteria 1087
535 Ga0495597_0162786 3300046542 Bacteria 909
536 Ga0495622_0000109 3300046557 Bacteria 71936
537 Ga0495622_0000246 3300046557 Bacteria 42141
538 Ga0495622_0022385 3300046557 Bacteria 2945
539 Ga0495633_0000088 3300046558 Bacteria 124193
540 Ga0495633_0000131 3300046558 Bacteria 100408
541 Ga0495633_0005902 3300046558 Bacteria 7365
542 Ga0495633_0008968 3300046558 Bacteria 5570
543 Ga0495633_0012055 3300046558 Bacteria 4618
544 Ga0495633_0013013 3300046558 Bacteria 4402
545 Ga0495633_0017386 3300046558 Bacteria 3679
546 Ga0495633_0115375 3300046558 Bacteria 1244
547 Ga0495633_0351772 3300046558 Bacteria 667
548 Ga0495656_0006949 3300046615 Bacteria 3981
549 Ga0495656_0023540 3300046615 Bacteria 2424
550 Ga0495656_0248698 3300046615 Bacteria 897
551 Ga0495656_0249837 3300046615 Bacteria 896
552 Ga0495656_0800034 3300046615 Bacteria 509
553 Ga0495668_0000152 3300046616 Bacteria 104716
554 Ga0495668_0000574 3300046616 Bacteria 45013
555 Ga0495668_0000636 3300046616 Bacteria 42184
556 Ga0495668_0002746 3300046616 Bacteria 14081
557 Ga0495668_0101003 3300046616 Bacteria 1578
558 Ga0495668_0151915 3300046616 Bacteria 1268
559 Ga0495668_0180318 3300046616 Bacteria 1157
560 Ga0495668_0762287 3300046616 Bacteria 536
561 Ga0495611_0106266 3300046648 Unclassified 1305
562 Ga0495625_0000386 3300046660 Bacteria 67356
563 Ga0495625_0003039 3300046660 Bacteria 17201
564 Ga0495625_0003363 3300046660 Bacteria 16060
565 Ga0495625_0004123 3300046660 Bacteria 13868
566 Ga0495625_0010047 3300046660 Bacteria 7865
567 Ga0495625_0066294 3300046660 Bacteria 2543
568 Ga0495625_0068326 3300046660 Bacteria 2498
569 Ga0495625_0122456 3300046660 Bacteria 1768
570 Ga0495659_0000026 3300046664 Bacteria 69038
571 Ga0495659_0000364 3300046664 Bacteria 17652
572 Ga0495659_0079716 3300046664 Bacteria 1240
573 Ga0495659_0258019 3300046664 Bacteria 728
574 Ga0495661_0044139 3300046665 Bacteria 2735
575 Ga0495661_0054321 3300046665 Bacteria 2405
576 Ga0495661_0078641 3300046665 Bacteria 1907
577 Ga0495661_0105039 3300046665 Bacteria 1583
578 Ga0495661_0197919 3300046665 Bacteria 1054
579 Ga0495647_0160230 3300046681 Bacteria 969
580 Ga0495658_0103168 3300046683 Bacteria 1705
581 Ga0495658_0362192 3300046683 Bacteria 922
582 Ga0495669_0060196 3300046684 Bacteria 1716
583 Ga0495669_0353322 3300046684 Unclassified 710
584 Ga0495670_0001843 3300046691 Bacteria 10427
585 Ga0495670_0009901 3300046691 Bacteria 4686
586 Ga0495670_0176128 3300046691 Bacteria 1128
587 Ga0495670_0359306 3300046691 Bacteria 784
588 Ga0495671_0000005 3300046692 Bacteria 509397
589 Ga0495671_0000144 3300046692 Bacteria 63224
590 Ga0495671_0003189 3300046692 Bacteria 10190
591 Ga0495671_0007388 3300046692 Bacteria 6270
592 Ga0495671_0019087 3300046692 Bacteria 3628
593 Ga0495671_0066202 3300046692 Bacteria 1778
594 Ga0495671_0106609 3300046692 Bacteria 1368
595 Ga0495671_0420484 3300046692 Bacteria 639
596 Ga0495649_0000600 3300046694 Bacteria 30004
597 Ga0495649_0011122 3300046694 Bacteria 5296
598 Ga0495649_0016777 3300046694 Bacteria 4147
599 Ga0495649_0045495 3300046694 Bacteria 2393
600 Ga0495649_0137334 3300046694 Bacteria 1288
601 Ga0495649_0380645 3300046694 Bacteria 710
602 Ga0495589_0170605 3300046794 Bacteria 1034
603 Ga0495589_0193612 3300046794 Bacteria 961
604 Ga0495589_0403848 3300046794 Bacteria 627
605 Ga0495660_0000229 3300046810 Bacteria 55150
606 Ga0495660_0000962 3300046810 Bacteria 21017
607 Ga0495660_0007303 3300046810 Bacteria 6495
608 Ga0495660_0138063 3300046810 Bacteria 1216
609 Ga0495660_0381986 3300046810 Bacteria 620
610 Ga0495636_0000861 3300047318 Bacteria 11216
611 Ga0495636_0137144 3300047318 Bacteria 1091
612 Ga0495636_0140506 3300047318 Bacteria 1078
613 Ga0495636_0164583 3300047318 Bacteria 1000
614 Ga0495636_0326551 3300047318 Bacteria 721
615 Ga0495672_0000232 3300047320 Bacteria 79561
616 Ga0495672_0000260 3300047320 Bacteria 73347
617 Ga0495672_0002347 3300047320 Bacteria 17504
618 Ga0495672_0004556 3300047320 Bacteria 11276
619 Ga0495672_0085907 3300047320 Bacteria 1741
620 Ga0495676_0014702 3300047321 Bacteria 6995
621 Ga0495683_0002158 3300047323 Bacteria 12082
622 Ga0495683_0003420 3300047323 Bacteria 9263
623 Ga0495687_000629 3300047443 Bacteria 40470
624 Ga0495687_003552 3300047443 Bacteria 11207
625 Ga0495687_003553 3300047443 Bacteria 11205
626 Ga0495687_031070 3300047443 Bacteria 2453
627 Ga0495687_047192 3300047443 Bacteria 1854
628 Ga0495687_130099 3300047443 Bacteria 892
629 Ga0495677_0003543 3300047445 Bacteria 6056
630 Ga0495677_0010891 3300047445 Bacteria 3332
631 Ga0495677_0031753 3300047445 Bacteria 1922
632 Ga0495679_021392 3300047446 Bacteria 2234
633 Ga0495679_022088 3300047446 Bacteria 2184
634 Ga0495685_000147 3300047447 Bacteria 24129
635 Ga0495685_053655 3300047447 Bacteria 1364
636 Ga0495685_196368 3300047447 Bacteria 647
637 Ga0495673_0000009 3300047469 Bacteria 731993
638 Ga0495673_0000012 3300047469 Bacteria 656908
639 Ga0495673_0000146 3300047469 Bacteria 127378
640 Ga0495673_0013580 3300047469 Bacteria 4272
641 Ga0495673_0062229 3300047469 Bacteria 1595
642 Ga0495673_0114665 3300047469 Bacteria 1073
643 Ga0495681_0028587 3300047470 Bacteria 2866
644 Ga0495681_0068982 3300047470 Bacteria 1607
645 Ga0495681_0205029 3300047470 Bacteria 798
646 Ga0495686_0005943 3300047472 Bacteria 9496
647 Ga0495686_0032478 3300047472 Bacteria 3378
648 Ga0495686_0058995 3300047472 Bacteria 2391
649 Ga0495686_0187647 3300047472 Bacteria 1194
650 Ga0495686_0218525 3300047472 Bacteria 1085
651 Ga0495615_0001327 3300048090 Bacteria 3631
652 Ga0495626_0093521 3300048091 Bacteria 1319
653 Ga0496100_1399707 3300048903 Unclassified 552
654 Ga0496102_0121773 3300048905 Bacteria 2437
655 Ga0496103_0001127 3300048906 Bacteria 18573
656 Ga0496103_0804774 3300048906 Unclassified 592
657 Ga0496105_0715122 3300048908 Bacteria 768
658 Ga0496108_0683898 3300048911 Bacteria 890
659 Ga0496109_0214041 3300048912 Bacteria 1812
660 Ga0496109_0737177 3300048912 Unclassified 923
661 Ga0496111_0679350 3300048914 Bacteria 750
662 Ga0496116_0156787 3300048919 Bacteria 1255
663 Ga0496119_0139778 3300048922 Bacteria 1309
664 Ga0496120_0358412 3300048923 Bacteria 653
665 Ga0496121_0244761 3300048924 Bacteria 1247
666 Ga0496122_0069316 3300048925 Bacteria 2526
667 Ga0496123_0008272 3300048926 Bacteria 9587
668 Ga0496124_0181573 3300048927 Bacteria 1618
669 Ga0496124_0376664 3300048927 Bacteria 994
670 Ga0496124_0779505 3300048927 Bacteria 595
671 Ga0496124_0785351 3300048927 Bacteria 592
672 Ga0496126_0043656 3300048929 Bacteria 4133
673 Ga0495678_000278 3300049459 Bacteria 56511
674 Ga0495678_004335 3300049459 Bacteria 8261
675 Ga0495678_022953 3300049459 Bacteria 2720
676 Ga0495678_023903 3300049459 Bacteria 2647
677 Ga0495678_126667 3300049459 Bacteria 851
678 Ga0495682_0000515 3300049460 Bacteria 26766
679 Ga0495682_0000614 3300049460 Bacteria 23998
680 Ga0495682_0076798 3300049460 Bacteria 1201
681 Ga0495682_0120969 3300049460 Bacteria 937
682 Ga0495682_0121705 3300049460 Bacteria 934
683 Ga0501039_1234992 3300049575 Bacteria 577
684 Ga0501249_010931 3300049679 Bacteria 1902
685 Ga0501269_027979 3300049766 Bacteria 716
686 nmdc:mga03683_142137_c1 3300050489 Bacteria 1079
687 nmdc:mga03683_61078_c1 3300050489 Bacteria 1593
688 nmdc:mga03n38_79330_c1 3300050490 Bacteria 1539
689 nmdc:mga00v17_252734_c1 3300050491 Bacteria 1143
690 nmdc:mga0yw44_54778_c1 3300050492 Bacteria 2425
691 nmdc:mga0k408_200056_c1 3300050493 Bacteria 1193
692 nmdc:mga0k408_373562_c1 3300050493 Bacteria 850
693 nmdc:mga0k408_821069_c1 3300050493 Unclassified 541
694 nmdc:mga06z11_19185_c1 3300050494 Bacteria 3139
695 nmdc:mga06z11_38210_c1 3300050494 Bacteria 2382
696 nmdc:mga06z11_406194_c1 3300050494 Bacteria 820
697 nmdc:mga04h51_238386_c1 3300050495 Bacteria 726
698 nmdc:mga07m45_27508_c1 3300050496 Bacteria 3134
699 nmdc:mga0n895_961286_c1 3300050512 Bacteria 837
700 nmdc:mga0rr50_1059239_c1 3300050513 Unclassified 690
701 nmdc:mga0sz30_49140_c1 3300050516 Bacteria 1787
702 Ga0495612_0181849 3300053078 Bacteria 924
703 Ga0500591_253844 3300053115 Bacteria 540
704 Ga0500594_0026495 3300053118 Bacteria 1494
705 Ga0500618_001265 3300053125 Bacteria 11758
706 Ga0500559_0555699 3300053136 Bacteria 523
707 Ga0500586_012053 3300053145 Bacteria 2501
708 Ga0500586_137596 3300053145 Bacteria 841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10422266 Ga0207650_104222661 95
2 3300046474 Ga0495605_0000315 Ga0495605_0000315_38517_38822 99
3 iso_pu_bacteria 2643221645 2644250422 102
4 iso_pu_bacteria 2643221664 2644356056 102
5 iso_pu_bacteria 2738541280 2738742613 102
6 iso_pu_bacteria 2738541297 2738826063 102
7 iso_pu_bacteria 2738541300 2738842383 102
8 iso_pu_bacteria 2738541357 2739149860 102
9 iso_pu_bacteria 2738543003 2739191779 102
10 iso_pu_bacteria 2738543018 2739273130 102
11 iso_pu_bacteria 2738543026 2739318256 102
12 iso_pu_bacteria 2738543029 2739336497 102
13 iso_pu_bacteria 2738543030 2739342174 102
14 iso_pu_bacteria 2821131069 2821136403 102
15 iso_pu_bacteria 2842711865 2842715993 102
16 iso_pu_bacteria 2857558681 2857564138 102
17 iso_pu_bacteria 2857564685 2857570362 102
18 iso_pu_bacteria 2904424332 2904428485 102
19 iso_pu_bacteria 2508501122 2509108243 104
20 iso_pu_bacteria 2848992105 2848998539 104
21 iso_pu_bacteria 2855872281 2855875505 104
22 3300005353 Ga0070669_101592261 Ga0070669_1015922612 105
23 3300005354 Ga0070675_100959005 Ga0070675_1009590051 105
24 3300005364 Ga0070673_100335366 Ga0070673_1003353662 105
25 3300005543 Ga0070672_100266764 Ga0070672_1002667642 105
26 3300005548 Ga0070665_102017463 Ga0070665_1020174632 105
27 3300005564 Ga0070664_100192240 Ga0070664_1001922402 105
28 3300005844 Ga0068862_100747524 Ga0068862_1007475242 105
29 3300006237 Ga0097621_100457780 Ga0097621_1004577802 105
30 3300013306 Ga0163162_11241560 Ga0163162_112415602 105
31 3300025907 Ga0207645_10024870 Ga0207645_100248705 105
32 3300025923 Ga0207681_10170163 Ga0207681_101701632 105
33 3300025940 Ga0207691_10021772 Ga0207691_100217723 105
34 2162886006 SwRhRL3b_contig_77071 SwRhRL3b_0736.00002110 106
35 3300002774 JGI25150J39212_1001080 JGI25150J39212_10010807 106
36 3300003215 JGI25153J46596_10023199 JGI25153J46596_100231992 106
37 3300003771 Ga0055526_1000076 Ga0055526_100007617 106
38 3300005262 Ga0065165_1046968 Ga0065165_10469683 106
39 3300005295 Ga0065707_10086066 Ga0065707_100860665 106
40 3300005328 Ga0070676_10015378 Ga0070676_100153782 106
41 3300005328 Ga0070676_10155960 Ga0070676_101559602 106
42 3300005331 Ga0070670_100024911 Ga0070670_1000249113 106
43 3300005331 Ga0070670_100036896 Ga0070670_1000368964 106
44 3300005331 Ga0070670_100087837 Ga0070670_1000878373 106
45 3300005331 Ga0070670_100097024 Ga0070670_1000970243 106
46 3300005331 Ga0070670_100229059 Ga0070670_1002290592 106
47 3300005333 Ga0070677_10033503 Ga0070677_100335034 106
48 3300005334 Ga0068869_100052394 Ga0068869_1000523944 106
49 3300005335 Ga0070666_10018958 Ga0070666_100189586 106
50 3300005335 Ga0070666_10421761 Ga0070666_104217612 106
51 3300005335 Ga0070666_10767488 Ga0070666_107674882 106
52 3300005338 Ga0068868_100107587 Ga0068868_1001075874 106
53 3300005338 Ga0068868_100769845 Ga0068868_1007698452 106
54 3300005338 Ga0068868_101443934 Ga0068868_1014439341 106
55 3300005340 Ga0070689_100395294 Ga0070689_1003952943 106
56 3300005340 Ga0070689_101500073 Ga0070689_1015000732 106
57 3300005343 Ga0070687_100560180 Ga0070687_1005601802 106
58 3300005345 Ga0070692_11085787 Ga0070692_110857872 106
59 3300005347 Ga0070668_100003787 Ga0070668_10000378711 106
60 3300005347 Ga0070668_100012670 Ga0070668_1000126703 106
61 3300005347 Ga0070668_100171771 Ga0070668_1001717712 106
62 3300005347 Ga0070668_100460986 Ga0070668_1004609862 106
63 3300005353 Ga0070669_100031537 Ga0070669_1000315373 106
64 3300005353 Ga0070669_100034710 Ga0070669_1000347103 106
65 3300005353 Ga0070669_100175357 Ga0070669_1001753574 106
66 3300005353 Ga0070669_100284347 Ga0070669_1002843473 106
67 3300005353 Ga0070669_100499577 Ga0070669_1004995772 106
68 3300005353 Ga0070669_101599332 Ga0070669_1015993322 106
69 3300005353 Ga0070669_101936968 Ga0070669_1019369681 106
70 3300005354 Ga0070675_100137162 Ga0070675_1001371622 106
71 3300005354 Ga0070675_101188243 Ga0070675_1011882431 106
72 3300005355 Ga0070671_100145402 Ga0070671_1001454022 106
73 3300005355 Ga0070671_100230322 Ga0070671_1002303222 106
74 3300005356 Ga0070674_100018163 Ga0070674_1000181633 106
75 3300005356 Ga0070674_101616530 Ga0070674_1016165301 106
76 3300005356 Ga0070674_101806335 Ga0070674_1018063351 106
77 3300005364 Ga0070673_100023121 Ga0070673_1000231215 106
78 3300005364 Ga0070673_100204719 Ga0070673_1002047194 106
79 3300005364 Ga0070673_100305899 Ga0070673_1003058994 106
80 3300005364 Ga0070673_100764564 Ga0070673_1007645642 106
81 3300005366 Ga0070659_101868515 Ga0070659_1018685152 106
82 3300005367 Ga0070667_100002775 Ga0070667_10000277518 106
83 3300005367 Ga0070667_100101928 Ga0070667_1001019283 106
84 3300005367 Ga0070667_100124433 Ga0070667_1001244332 106
85 3300005367 Ga0070667_101438622 Ga0070667_1014386221 106
86 3300005367 Ga0070667_101846351 Ga0070667_1018463511 106
87 3300005438 Ga0070701_10054031 Ga0070701_100540313 106
88 3300005440 Ga0070705_100060754 Ga0070705_1000607544 106
89 3300005441 Ga0070700_100085521 Ga0070700_1000855214 106
90 3300005441 Ga0070700_100173693 Ga0070700_1001736933 106
91 3300005444 Ga0070694_100323093 Ga0070694_1003230932 106
92 3300005455 Ga0070663_100114425 Ga0070663_1001144254 106
93 3300005455 Ga0070663_100159675 Ga0070663_1001596753 106
94 3300005455 Ga0070663_100192388 Ga0070663_1001923883 106
95 3300005455 Ga0070663_101244811 Ga0070663_1012448112 106
96 3300005455 Ga0070663_101476042 Ga0070663_1014760421 106
97 3300005456 Ga0070678_100175102 Ga0070678_1001751022 106
98 3300005456 Ga0070678_100852714 Ga0070678_1008527142 106
99 3300005456 Ga0070678_100962639 Ga0070678_1009626392 106
100 3300005457 Ga0070662_100098320 Ga0070662_1000983202 106
101 3300005457 Ga0070662_100812839 Ga0070662_1008128392 106
102 3300005457 Ga0070662_101733597 Ga0070662_1017335971 106
103 3300005459 Ga0068867_100000657 Ga0068867_10000065712 106
104 3300005459 Ga0068867_100144494 Ga0068867_1001444943 106
105 3300005459 Ga0068867_100216941 Ga0068867_1002169412 106
106 3300005459 Ga0068867_100289985 Ga0068867_1002899852 106
107 3300005459 Ga0068867_101245697 Ga0068867_1012456972 106
108 3300005459 Ga0068867_101444198 Ga0068867_1014441982 106
109 3300005466 Ga0070685_10878388 Ga0070685_108783882 106
110 3300005466 Ga0070685_10893150 Ga0070685_108931501 106
111 3300005518 Ga0070699_100995516 Ga0070699_1009955162 106
112 3300005539 Ga0068853_100527057 Ga0068853_1005270571 106
113 3300005539 Ga0068853_100794310 Ga0068853_1007943101 106
114 3300005539 Ga0068853_101355321 Ga0068853_1013553212 106
115 3300005543 Ga0070672_100035219 Ga0070672_1000352195 106
116 3300005543 Ga0070672_100052298 Ga0070672_1000522985 106
117 3300005543 Ga0070672_100153144 Ga0070672_1001531443 106
118 3300005543 Ga0070672_101868122 Ga0070672_1018681222 106
119 3300005544 Ga0070686_100852389 Ga0070686_1008523891 106
120 3300005545 Ga0070695_100840904 Ga0070695_1008409042 106
121 3300005546 Ga0070696_100622256 Ga0070696_1006222561 106
122 3300005548 Ga0070665_100152338 Ga0070665_1001523382 106
123 3300005548 Ga0070665_100576460 Ga0070665_1005764602 106
124 3300005563 Ga0068855_100147448 Ga0068855_1001474482 106
125 3300005563 Ga0068855_100744169 Ga0068855_1007441692 106
126 3300005577 Ga0068857_101495062 Ga0068857_1014950621 106
127 3300005578 Ga0068854_100171382 Ga0068854_1001713822 106
128 3300005614 Ga0068856_101516467 Ga0068856_1015164672 106
129 3300005615 Ga0070702_100258978 Ga0070702_1002589782 106
130 3300005615 Ga0070702_100397058 Ga0070702_1003970582 106
131 3300005616 Ga0068852_100162543 Ga0068852_1001625434 106
132 3300005617 Ga0068859_100005698 Ga0068859_1000056984 106
133 3300005617 Ga0068859_100520088 Ga0068859_1005200882 106
134 3300005617 Ga0068859_101798125 Ga0068859_1017981252 106
135 3300005617 Ga0068859_102050047 Ga0068859_1020500472 106
136 3300005618 Ga0068864_100002722 Ga0068864_10000272214 106
137 3300005618 Ga0068864_100450649 Ga0068864_1004506492 106
138 3300005618 Ga0068864_100492841 Ga0068864_1004928412 106
139 3300005618 Ga0068864_101118958 Ga0068864_1011189582 106
140 3300005718 Ga0068866_10015661 Ga0068866_100156613 106
141 3300005718 Ga0068866_10314860 Ga0068866_103148602 106
142 3300005719 Ga0068861_100005962 Ga0068861_10000596212 106
143 3300005719 Ga0068861_100057818 Ga0068861_1000578183 106
144 3300005719 Ga0068861_100138538 Ga0068861_1001385382 106
145 3300005719 Ga0068861_100540397 Ga0068861_1005403972 106
146 3300005719 Ga0068861_101937333 Ga0068861_1019373332 106
147 3300005840 Ga0068870_10019822 Ga0068870_100198224 106
148 3300005841 Ga0068863_100004498 Ga0068863_1000044984 106
149 3300005841 Ga0068863_100033786 Ga0068863_1000337863 106
150 3300005841 Ga0068863_100052443 Ga0068863_1000524436 106
151 3300005841 Ga0068863_100347437 Ga0068863_1003474372 106
152 3300005841 Ga0068863_100739470 Ga0068863_1007394702 106
153 3300005842 Ga0068858_100009800 Ga0068858_10000980011 106
154 3300005842 Ga0068858_100043035 Ga0068858_1000430355 106
155 3300005842 Ga0068858_100085178 Ga0068858_1000851782 106
156 3300005842 Ga0068858_100115646 Ga0068858_1001156462 106
157 3300005842 Ga0068858_100435582 Ga0068858_1004355822 106
158 3300005842 Ga0068858_101291673 Ga0068858_1012916732 106
159 3300005843 Ga0068860_100001192 Ga0068860_10000119220 106
160 3300005843 Ga0068860_100002473 Ga0068860_10000247316 106
161 3300005843 Ga0068860_100562914 Ga0068860_1005629142 106
162 3300005844 Ga0068862_100007385 Ga0068862_1000073856 106
163 3300005844 Ga0068862_100014870 Ga0068862_1000148702 106
164 3300005844 Ga0068862_100023787 Ga0068862_1000237873 106
165 3300005844 Ga0068862_100040508 Ga0068862_1000405083 106
166 3300005844 Ga0068862_100134814 Ga0068862_1001348144 106
167 3300005844 Ga0068862_100148802 Ga0068862_1001488022 106
168 3300005844 Ga0068862_101062498 Ga0068862_1010624982 106
169 3300006038 Ga0075365_10219475 Ga0075365_102194752 106
170 3300006042 Ga0075368_10049610 Ga0075368_100496102 106
171 3300006048 Ga0075363_100102184 Ga0075363_1001021842 106
172 3300006048 Ga0075363_100624729 Ga0075363_1006247292 106
173 3300006051 Ga0075364_10182924 Ga0075364_101829244 106
174 3300006177 Ga0075362_10047229 Ga0075362_100472294 106
175 3300006177 Ga0075362_10229813 Ga0075362_102298132 106
176 3300006178 Ga0075367_10045125 Ga0075367_100451254 106
177 3300006178 Ga0075367_10053309 Ga0075367_100533093 106
178 3300006186 Ga0075369_10011576 Ga0075369_100115764 106
179 3300006195 Ga0075366_10049518 Ga0075366_100495182 106
180 3300006195 Ga0075366_11053026 Ga0075366_110530262 106
181 3300006237 Ga0097621_100243229 Ga0097621_1002432292 106
182 3300006353 Ga0075370_10034420 Ga0075370_100344204 106
183 3300006353 Ga0075370_10124672 Ga0075370_101246723 106
184 3300006358 Ga0068871_100061432 Ga0068871_1000614325 106
185 3300006358 Ga0068871_100254427 Ga0068871_1002544274 106
186 3300006358 Ga0068871_100557768 Ga0068871_1005577683 106
187 3300006846 Ga0075430_100892095 Ga0075430_1008920952 106
188 3300006871 Ga0075434_100345600 Ga0075434_1003456002 106
189 3300006871 Ga0075434_101393458 Ga0075434_1013934582 106
190 3300006881 Ga0068865_100004995 Ga0068865_1000049957 106
191 3300006881 Ga0068865_100246881 Ga0068865_1002468812 106
192 3300006881 Ga0068865_100529798 Ga0068865_1005297982 106
193 3300006931 Ga0097620_100005698 Ga0097620_1000056984 106
194 3300006931 Ga0097620_100520102 Ga0097620_1005201023 106
195 3300006931 Ga0097620_101798001 Ga0097620_1017980012 106
196 3300006931 Ga0097620_102050038 Ga0097620_1020500382 106
197 3300007076 Ga0075435_100767022 Ga0075435_1007670222 106
198 3300009011 Ga0105251_10229738 Ga0105251_102297382 106
199 3300009036 Ga0105244_10001199 Ga0105244_1000119920 106
200 3300009036 Ga0105244_10002531 Ga0105244_100025316 106
201 3300009094 Ga0111539_11092002 Ga0111539_110920022 106
202 3300009094 Ga0111539_11564555 Ga0111539_115645552 106
203 3300009098 Ga0105245_10000925 Ga0105245_100009255 106
204 3300009098 Ga0105245_11389401 Ga0105245_113894012 106
205 3300009101 Ga0105247_10272246 Ga0105247_102722463 106
206 3300009148 Ga0105243_10051006 Ga0105243_100510062 106
207 3300009148 Ga0105243_10165724 Ga0105243_101657242 106
208 3300009176 Ga0105242_10702708 Ga0105242_107027082 106
209 3300009176 Ga0105242_12502694 Ga0105242_125026941 106
210 3300009177 Ga0105248_10069828 Ga0105248_100698282 106
211 3300009177 Ga0105248_10099242 Ga0105248_100992424 106
212 3300009177 Ga0105248_10128792 Ga0105248_101287922 106
213 3300009177 Ga0105248_12182146 Ga0105248_121821462 106
214 3300009545 Ga0105237_10698851 Ga0105237_106988513 106
215 3300009551 Ga0105238_10025009 Ga0105238_100250095 106
216 3300009551 Ga0105238_11357564 Ga0105238_113575642 106
217 3300009553 Ga0105249_10052349 Ga0105249_100523493 106
218 3300009553 Ga0105249_10071357 Ga0105249_100713574 106
219 3300009553 Ga0105249_11536065 Ga0105249_115360652 106
220 3300009553 Ga0105249_12263011 Ga0105249_122630111 106
221 3300009553 Ga0105249_13015106 Ga0105249_130151062 106
222 3300009553 Ga0105249_13202079 Ga0105249_132020792 106
223 3300010375 Ga0105239_10342915 Ga0105239_103429154 106
224 3300011119 Ga0105246_10271245 Ga0105246_102712453 106
225 3300013296 Ga0157374_10961773 Ga0157374_109617732 106
226 3300013297 Ga0157378_10066279 Ga0157378_100662794 106
227 3300013297 Ga0157378_10099570 Ga0157378_100995703 106
228 3300013297 Ga0157378_10836671 Ga0157378_108366712 106
229 3300013297 Ga0157378_11986302 Ga0157378_119863022 106
230 3300013297 Ga0157378_12104199 Ga0157378_121041992 106
231 3300013306 Ga0163162_10007520 Ga0163162_100075206 106
232 3300013306 Ga0163162_10342530 Ga0163162_103425303 106
233 3300013306 Ga0163162_10367632 Ga0163162_103676323 106
234 3300013306 Ga0163162_10848281 Ga0163162_108482812 106
235 3300013308 Ga0157375_10100656 Ga0157375_101006562 106
236 3300013308 Ga0157375_10958393 Ga0157375_109583932 106
237 3300013308 Ga0157375_11226822 Ga0157375_112268222 106
238 3300014325 Ga0163163_10003043 Ga0163163_1000304312 106
239 3300014325 Ga0163163_10163897 Ga0163163_101638974 106
240 3300014325 Ga0163163_11559494 Ga0163163_115594942 106
241 3300014325 Ga0163163_12944008 Ga0163163_129440081 106
242 3300014326 Ga0157380_10231923 Ga0157380_102319232 106
243 3300014326 Ga0157380_10484937 Ga0157380_104849372 106
244 3300014968 Ga0157379_10000388 Ga0157379_1000038830 106
245 3300014968 Ga0157379_10067641 Ga0157379_100676413 106
246 3300014968 Ga0157379_10242792 Ga0157379_102427923 106
247 3300014968 Ga0157379_10295591 Ga0157379_102955912 106
248 3300014968 Ga0157379_12151407 Ga0157379_121514072 106
249 3300014969 Ga0157376_10139506 Ga0157376_101395063 106
250 3300014969 Ga0157376_10768743 Ga0157376_107687431 106
251 3300014969 Ga0157376_10818434 Ga0157376_108184342 106
252 3300014969 Ga0157376_12162937 Ga0157376_121629372 106
253 3300017792 Ga0163161_10013229 Ga0163161_100132296 106
254 3300017792 Ga0163161_10014363 Ga0163161_100143634 106
255 3300017792 Ga0163161_10813418 Ga0163161_108134182 106
256 3300021361 Ga0213872_10000136 Ga0213872_1000013613 106
257 3300021361 Ga0213872_10000981 Ga0213872_1000098113 106
258 3300021361 Ga0213872_10006546 Ga0213872_100065464 106
259 3300025245 Ga0207425_1000216 Ga0207425_100021610 106
260 3300025263 Ga0209565_1000112 Ga0209565_100011238 106
261 3300025263 Ga0209565_1006531 Ga0209565_10065312 106
262 3300025273 Ga0209673_1000210 Ga0209673_100021049 106
263 3300025291 Ga0209675_1000142 Ga0209675_100014227 106
264 3300025291 Ga0209675_1079782 Ga0209675_10797822 106
265 3300025294 Ga0209025_1004048 Ga0209025_10040489 106
266 3300025295 Ga0209564_1000042 Ga0209564_1000042313 106
267 3300025295 Ga0209564_1000245 Ga0209564_100024548 106
268 3300025295 Ga0209564_1014928 Ga0209564_10149284 106
269 3300025297 Ga0209758_1000707 Ga0209758_10007079 106
270 3300025299 Ga0209256_1000252 Ga0209256_100025227 106
271 3300025299 Ga0209256_1000268 Ga0209256_100026844 106
272 3300025315 Ga0207697_10094543 Ga0207697_100945432 106
273 3300025728 Ga0207655_1004090 Ga0207655_10040906 106
274 3300025728 Ga0207655_1004269 Ga0207655_10042692 106
275 3300025893 Ga0207682_10203608 Ga0207682_102036082 106
276 3300025893 Ga0207682_10213398 Ga0207682_102133982 106
277 3300025899 Ga0207642_10010259 Ga0207642_100102592 106
278 3300025899 Ga0207642_10345896 Ga0207642_103458962 106
279 3300025903 Ga0207680_10132592 Ga0207680_101325922 106
280 3300025903 Ga0207680_10167997 Ga0207680_101679973 106
281 3300025907 Ga0207645_10020821 Ga0207645_100208215 106
282 3300025907 Ga0207645_10172944 Ga0207645_101729442 106
283 3300025908 Ga0207643_10025325 Ga0207643_100253252 106
284 3300025918 Ga0207662_10226136 Ga0207662_102261361 106
285 3300025923 Ga0207681_10024334 Ga0207681_100243343 106
286 3300025923 Ga0207681_10025636 Ga0207681_100256364 106
287 3300025923 Ga0207681_10059894 Ga0207681_100598943 106
288 3300025923 Ga0207681_10231343 Ga0207681_102313432 106
289 3300025923 Ga0207681_10726003 Ga0207681_107260032 106
290 3300025924 Ga0207694_10055541 Ga0207694_100555414 106
291 3300025925 Ga0207650_10006842 Ga0207650_100068427 106
292 3300025925 Ga0207650_10125848 Ga0207650_101258482 106
293 3300025925 Ga0207650_10161076 Ga0207650_101610763 106
294 3300025925 Ga0207650_10855987 Ga0207650_108559872 106
295 3300025926 Ga0207659_11775320 Ga0207659_117753202 106
296 3300025927 Ga0207687_10006169 Ga0207687_100061695 106
297 3300025927 Ga0207687_10236138 Ga0207687_102361383 106
298 3300025927 Ga0207687_10763075 Ga0207687_107630752 106
299 3300025931 Ga0207644_10195161 Ga0207644_101951612 106
300 3300025933 Ga0207706_10137119 Ga0207706_101371192 106
301 3300025933 Ga0207706_10169634 Ga0207706_101696343 106
302 3300025933 Ga0207706_11475228 Ga0207706_114752281 106
303 3300025934 Ga0207686_11404384 Ga0207686_114043842 106
304 3300025935 Ga0207709_10088306 Ga0207709_100883062 106
305 3300025935 Ga0207709_10603524 Ga0207709_106035241 106
306 3300025936 Ga0207670_10109512 Ga0207670_101095123 106
307 3300025937 Ga0207669_10061487 Ga0207669_100614872 106
308 3300025938 Ga0207704_10001788 Ga0207704_100017883 106
309 3300025938 Ga0207704_10231468 Ga0207704_102314682 106
310 3300025938 Ga0207704_10501441 Ga0207704_105014412 106
311 3300025938 Ga0207704_11050158 Ga0207704_110501582 106
312 3300025939 Ga0207665_11291174 Ga0207665_112911742 106
313 3300025940 Ga0207691_10002028 Ga0207691_100020285 106
314 3300025940 Ga0207691_10130391 Ga0207691_101303913 106
315 3300025940 Ga0207691_10550038 Ga0207691_105500382 106
316 3300025940 Ga0207691_10601997 Ga0207691_106019972 106
317 3300025940 Ga0207691_11376039 Ga0207691_113760392 106
318 3300025941 Ga0207711_10039387 Ga0207711_100393872 106
319 3300025941 Ga0207711_10255336 Ga0207711_102553363 106
320 3300025941 Ga0207711_10898826 Ga0207711_108988261 106
321 3300025942 Ga0207689_10000171 Ga0207689_100001714 106
322 3300025942 Ga0207689_11457672 Ga0207689_114576721 106
323 3300025945 Ga0207679_10472015 Ga0207679_104720153 106
324 3300025949 Ga0207667_10123985 Ga0207667_101239852 106
325 3300025949 Ga0207667_11030551 Ga0207667_110305512 106
326 3300025960 Ga0207651_10031473 Ga0207651_100314732 106
327 3300025960 Ga0207651_10164817 Ga0207651_101648173 106
328 3300025960 Ga0207651_10552837 Ga0207651_105528372 106
329 3300025960 Ga0207651_11471925 Ga0207651_114719252 106
330 3300025961 Ga0207712_10228276 Ga0207712_102282763 106
331 3300025961 Ga0207712_10236622 Ga0207712_102366222 106
332 3300025961 Ga0207712_11271694 Ga0207712_112716942 106
333 3300025961 Ga0207712_11847071 Ga0207712_118470712 106
334 3300025972 Ga0207668_10075650 Ga0207668_100756504 106
335 3300025972 Ga0207668_10090280 Ga0207668_100902803 106
336 3300025972 Ga0207668_10163908 Ga0207668_101639083 106
337 3300025972 Ga0207668_10505471 Ga0207668_105054712 106
338 3300025972 Ga0207668_10986737 Ga0207668_109867372 106
339 3300025972 Ga0207668_11775821 Ga0207668_117758212 106
340 3300025981 Ga0207640_10159799 Ga0207640_101597992 106
341 3300025981 Ga0207640_10219177 Ga0207640_102191772 106
342 3300025986 Ga0207658_10088696 Ga0207658_100886963 106
343 3300025986 Ga0207658_10385965 Ga0207658_103859652 106
344 3300025986 Ga0207658_10628124 Ga0207658_106281243 106
345 3300025986 Ga0207658_11856636 Ga0207658_118566362 106
346 3300026023 Ga0207677_10028774 Ga0207677_100287743 106
347 3300026023 Ga0207677_10487069 Ga0207677_104870693 106
348 3300026023 Ga0207677_11183052 Ga0207677_111830522 106
349 3300026023 Ga0207677_11365543 Ga0207677_113655432 106
350 3300026035 Ga0207703_10001810 Ga0207703_1000181012 106
351 3300026035 Ga0207703_10061321 Ga0207703_100613214 106
352 3300026035 Ga0207703_10133555 Ga0207703_101335554 106
353 3300026035 Ga0207703_10138470 Ga0207703_101384702 106
354 3300026041 Ga0207639_10627208 Ga0207639_106272081 106
355 3300026041 Ga0207639_11576356 Ga0207639_115763562 106
356 3300026041 Ga0207639_11907956 Ga0207639_119079562 106
357 3300026067 Ga0207678_10114235 Ga0207678_101142353 106
358 3300026067 Ga0207678_10604757 Ga0207678_106047572 106
359 3300026067 Ga0207678_10806795 Ga0207678_108067952 106
360 3300026067 Ga0207678_11994019 Ga0207678_119940191 106
361 3300026075 Ga0207708_10223923 Ga0207708_102239232 106
362 3300026075 Ga0207708_10231051 Ga0207708_102310512 106
363 3300026075 Ga0207708_11065240 Ga0207708_110652402 106
364 3300026088 Ga0207641_10015609 Ga0207641_100156094 106
365 3300026088 Ga0207641_10030891 Ga0207641_100308915 106
366 3300026088 Ga0207641_11980999 Ga0207641_119809992 106
367 3300026088 Ga0207641_12052684 Ga0207641_120526842 106
368 3300026089 Ga0207648_10003491 Ga0207648_1000349112 106
369 3300026089 Ga0207648_10006075 Ga0207648_100060752 106
370 3300026089 Ga0207648_10070558 Ga0207648_100705583 106
371 3300026089 Ga0207648_10099708 Ga0207648_100997084 106
372 3300026089 Ga0207648_10340011 Ga0207648_103400111 106
373 3300026089 Ga0207648_11181355 Ga0207648_111813552 106
374 3300026095 Ga0207676_10013070 Ga0207676_100130706 106
375 3300026095 Ga0207676_10084124 Ga0207676_100841242 106
376 3300026095 Ga0207676_11331649 Ga0207676_113316492 106
377 3300026095 Ga0207676_11444058 Ga0207676_114440582 106
378 3300026116 Ga0207674_10005035 Ga0207674_100050358 106
379 3300026118 Ga0207675_100000624 Ga0207675_10000062416 106
380 3300026118 Ga0207675_100017734 Ga0207675_1000177346 106
381 3300026118 Ga0207675_100393965 Ga0207675_1003939652 106
382 3300026118 Ga0207675_100867541 Ga0207675_1008675412 106
383 3300026118 Ga0207675_102051154 Ga0207675_1020511541 106
384 3300026121 Ga0207683_10447084 Ga0207683_104470842 106
385 3300026121 Ga0207683_10852526 Ga0207683_108525262 106
386 3300026121 Ga0207683_11043800 Ga0207683_110438002 106
387 3300026142 Ga0207698_10307479 Ga0207698_103074793 106
388 3300027666 Ga0209282_1000066 Ga0209282_100006643 106
389 3300027866 Ga0209813_10208960 Ga0209813_102089602 106
390 3300028379 Ga0268266_10665769 Ga0268266_106657692 106
391 3300028380 Ga0268265_10057755 Ga0268265_100577554 106
392 3300028380 Ga0268265_10082659 Ga0268265_100826593 106
393 3300028380 Ga0268265_10166879 Ga0268265_101668794 106
394 3300028380 Ga0268265_10908763 Ga0268265_109087632 106
395 3300028380 Ga0268265_10921105 Ga0268265_109211052 106
396 3300028380 Ga0268265_10941121 Ga0268265_109411211 106
397 3300028381 Ga0268264_10002375 Ga0268264_1000237515 106
398 3300028381 Ga0268264_10027750 Ga0268264_100277502 106
399 3300028381 Ga0268264_10081222 Ga0268264_100812224 106
400 3300028381 Ga0268264_10214243 Ga0268264_102142433 106
401 3300028381 Ga0268264_10350678 Ga0268264_103506781 106
402 3300028794 Ga0307515_10121841 Ga0307515_101218414 106
403 3300030735 Ga0316178_1013714 Ga0316178_10137142 106
404 3300030736 Ga0316180_1051715 Ga0316180_10517154 106
405 3300030745 Ga0316182_1337282 Ga0316182_13372823 106
406 3300031456 Ga0307513_10050027 Ga0307513_100500273 106
407 3300031548 Ga0307408_102420301 Ga0307408_1024203011 106
408 3300031711 Ga0265314_10067446 Ga0265314_100674462 106
409 3300031730 Ga0307516_10712572 Ga0307516_107125721 106
410 3300031731 Ga0307405_12162026 Ga0307405_121620262 106
411 3300031824 Ga0307413_10805331 Ga0307413_108053312 106
412 3300031852 Ga0307410_10072533 Ga0307410_100725333 106
413 3300031911 Ga0307412_12252478 Ga0307412_122524781 106
414 3300031995 Ga0307409_100069616 Ga0307409_1000696162 106
415 3300031995 Ga0307409_100677461 Ga0307409_1006774613 106
416 3300032004 Ga0307414_10395113 Ga0307414_103951132 106
417 3300032004 Ga0307414_10992560 Ga0307414_109925601 106
418 3300032005 Ga0307411_10593905 Ga0307411_105939052 106
419 3300032005 Ga0307411_10785339 Ga0307411_107853392 106
420 3300033180 Ga0307510_10288278 Ga0307510_102882782 106
421 3300034816 Ga0373930_0166093 Ga0373930_0166093_47_367 106
422 3300035170 Ga0373943_0131656 Ga0373943_0131656_408_728 106
423 3300035170 Ga0373943_0919563 Ga0373943_0919563_158_478 106
424 3300035171 Ga0373946_0179391 Ga0373946_0179391_127_447 106
425 3300035172 Ga0373955_0294869 Ga0373955_0294869_390_710 106
426 3300035695 Ga0373927_0054996 Ga0373927_0054996_1726_2046 106
427 3300036401 Ga0373937_0047579 Ga0373937_0047579_875_1195 106
428 3300036401 Ga0373937_0897059 Ga0373937_0897059_286_606 106
429 3300037068 Ga0373925_0041541 Ga0373925_0041541_2829_3149 106
430 3300037068 Ga0373925_0859189 Ga0373925_0859189_272_592 106
431 3300039447 Ga0436361_0324047 Ga0436361_0324047_5684_6010 106
432 3300039447 Ga0436361_0470245 Ga0436361_0470245_840_1166 106
433 3300039447 Ga0436361_0954756 Ga0436361_0954756_48100_48426 106
434 3300039447 Ga0436361_1158315 Ga0436361_1158315_5666_5992 106
435 3300041486 Ga0451807_0992868 Ga0451807_0992868_449_769 106
436 3300041491 Ga0451833_0742599 Ga0451833_0742599_448_774 106
437 3300041496 Ga0451839_1600323 Ga0451839_1600323_55_375 106
438 3300041507 Ga0451851_0628714 Ga0451851_0628714_97_417 106
439 3300041512 Ga0451853_4017175 Ga0451853_4017175_223_543 106
440 3300042134 Ga0450898_103348 Ga0450898_103348_220_543 106
441 3300044712 Ga0453684_0104147 Ga0453684_0104147_820_1146 106
442 3300045051 Ga0451576_1867718 Ga0451576_1867718_10_330 106
443 3300046452 Ga0495617_002298 Ga0495617_002298_4649_4975 106
444 3300046452 Ga0495617_002348 Ga0495617_002348_3717_4043 106
445 3300046452 Ga0495617_009698 Ga0495617_009698_1949_2275 106
446 3300046452 Ga0495617_032025 Ga0495617_032025_655_981 106
447 3300046453 Ga0495627_127442 Ga0495627_127442_202_528 106
448 3300046457 Ga0495590_0000056 Ga0495590_0000056_57020_57346 106
449 3300046457 Ga0495590_0011115 Ga0495590_0011115_1750_2076 106
450 3300046460 Ga0495638_0000170 Ga0495638_0000170_65960_66286 106
451 3300046460 Ga0495638_0006602 Ga0495638_0006602_6093_6419 106
452 3300046460 Ga0495638_0018858 Ga0495638_0018858_3058_3384 106
453 3300046460 Ga0495638_0057139 Ga0495638_0057139_1444_1770 106
454 3300046460 Ga0495638_0134103 Ga0495638_0134103_40_366 106
455 3300046460 Ga0495638_0162551 Ga0495638_0162551_886_1212 106
456 3300046460 Ga0495638_0380917 Ga0495638_0380917_39_365 106
457 3300046463 Ga0495653_0000066 Ga0495653_0000066_43138_43464 106
458 3300046471 Ga0495650_0000528 Ga0495650_0000528_20672_20998 106
459 3300046471 Ga0495650_0000553 Ga0495650_0000553_45914_46240 106
460 3300046471 Ga0495650_0000571 Ga0495650_0000571_22915_23241 106
461 3300046471 Ga0495650_0001888 Ga0495650_0001888_15082_15408 106
462 3300046471 Ga0495650_0003450 Ga0495650_0003450_1192_1518 106
463 3300046471 Ga0495650_0026921 Ga0495650_0026921_1005_1331 106
464 3300046471 Ga0495650_0065614 Ga0495650_0065614_297_623 106
465 3300046474 Ga0495605_0006948 Ga0495605_0006948_3767_4093 106
466 3300046474 Ga0495605_0097630 Ga0495605_0097630_11_337 106
467 3300046474 Ga0495605_0477060 Ga0495605_0477060_44_367 106
468 3300046475 Ga0495639_0020556 Ga0495639_0020556_1247_1573 106
469 3300046491 Ga0495584_0000365 Ga0495584_0000365_27545_27871 106
470 3300046491 Ga0495584_0001822 Ga0495584_0001822_10885_11211 106
471 3300046491 Ga0495584_0040200 Ga0495584_0040200_696_1022 106
472 3300046491 Ga0495584_0043337 Ga0495584_0043337_1661_1984 106
473 3300046491 Ga0495584_0069467 Ga0495584_0069467_1021_1344 106
474 3300046492 Ga0495585_0000070 Ga0495585_0000070_41260_41583 106
475 3300046492 Ga0495585_0000646 Ga0495585_0000646_3544_3870 106
476 3300046492 Ga0495585_0027344 Ga0495585_0027344_2402_2728 106
477 3300046492 Ga0495585_0036737 Ga0495585_0036737_55_381 106
478 3300046492 Ga0495585_0089094 Ga0495585_0089094_1239_1565 106
479 3300046492 Ga0495585_0089739 Ga0495585_0089739_536_862 106
480 3300046500 Ga0495596_0002901 Ga0495596_0002901_2982_3305 106
481 3300046501 Ga0495607_0000906 Ga0495607_0000906_26845_27171 106
482 3300046501 Ga0495607_0001697 Ga0495607_0001697_6348_6674 106
483 3300046501 Ga0495607_0014081 Ga0495607_0014081_1106_1432 106
484 3300046501 Ga0495607_0023081 Ga0495607_0023081_71_397 106
485 3300046501 Ga0495607_0031611 Ga0495607_0031611_2046_2372 106
486 3300046501 Ga0495607_0068419 Ga0495607_0068419_394_720 106
487 3300046501 Ga0495607_0119767 Ga0495607_0119767_240_566 106
488 3300046501 Ga0495607_0193213 Ga0495607_0193213_74_400 106
489 3300046501 Ga0495607_0414345 Ga0495607_0414345_90_413 106
490 3300046506 Ga0495583_0000417 Ga0495583_0000417_35430_35756 106
491 3300046506 Ga0495583_0003284 Ga0495583_0003284_11213_11539 106
492 3300046506 Ga0495583_0037555 Ga0495583_0037555_822_1148 106
493 3300046506 Ga0495583_0075043 Ga0495583_0075043_267_593 106
494 3300046507 Ga0495606_0000063 Ga0495606_0000063_21082_21408 106
495 3300046507 Ga0495606_0000431 Ga0495606_0000431_32695_33018 106
496 3300046507 Ga0495606_0001347 Ga0495606_0001347_28426_28752 106
497 3300046507 Ga0495606_0001680 Ga0495606_0001680_8882_9208 106
498 3300046507 Ga0495606_0003374 Ga0495606_0003374_6444_6770 106
499 3300046507 Ga0495606_0004107 Ga0495606_0004107_5377_5703 106
500 3300046507 Ga0495606_0151700 Ga0495606_0151700_1021_1347 106
501 3300046507 Ga0495606_0243431 Ga0495606_0243431_91_417 106
502 3300046512 Ga0495610_0000014 Ga0495610_0000014_387738_388064 106
503 3300046512 Ga0495610_0000353 Ga0495610_0000353_11538_11864 106
504 3300046512 Ga0495610_0000394 Ga0495610_0000394_44606_44932 106
505 3300046512 Ga0495610_0001670 Ga0495610_0001670_10450_10776 106
506 3300046512 Ga0495610_0004877 Ga0495610_0004877_311_637 106
507 3300046512 Ga0495610_0005618 Ga0495610_0005618_7675_8001 106
508 3300046512 Ga0495610_0009648 Ga0495610_0009648_2593_2919 106
509 3300046512 Ga0495610_0043076 Ga0495610_0043076_52_378 106
510 3300046512 Ga0495610_0278043 Ga0495610_0278043_155_481 106
511 3300046513 Ga0495616_0001267 Ga0495616_0001267_1572_1898 106
512 3300046513 Ga0495616_0004391 Ga0495616_0004391_6977_7303 106
513 3300046513 Ga0495616_0011359 Ga0495616_0011359_1134_1460 106
514 3300046518 Ga0495631_0040983 Ga0495631_0040983_841_1164 106
515 3300046520 Ga0495637_0000150 Ga0495637_0000150_52131_52454 106
516 3300046520 Ga0495637_0006039 Ga0495637_0006039_401_727 106
517 3300046522 Ga0495643_0000246 Ga0495643_0000246_23519_23845 106
518 3300046522 Ga0495643_0000302 Ga0495643_0000302_35218_35544 106
519 3300046522 Ga0495643_0484213 Ga0495643_0484213_17_340 106
520 3300046523 Ga0495644_0000451 Ga0495644_0000451_6593_6919 106
521 3300046523 Ga0495644_0000622 Ga0495644_0000622_6640_6966 106
522 3300046523 Ga0495644_0185132 Ga0495644_0185132_336_659 106
523 3300046524 Ga0495648_0000119 Ga0495648_0000119_51485_51811 106
524 3300046524 Ga0495648_0000240 Ga0495648_0000240_60069_60395 106
525 3300046524 Ga0495648_0000486 Ga0495648_0000486_9403_9729 106
526 3300046524 Ga0495648_0003471 Ga0495648_0003471_9356_9682 106
527 3300046524 Ga0495648_0013106 Ga0495648_0013106_2643_2969 106
528 3300046524 Ga0495648_0028050 Ga0495648_0028050_3005_3328 106
529 3300046524 Ga0495648_0094281 Ga0495648_0094281_508_831 106
530 3300046524 Ga0495648_0101601 Ga0495648_0101601_162_488 106
531 3300046524 Ga0495648_0134477 Ga0495648_0134477_866_1192 106
532 3300046528 Ga0495642_0001364 Ga0495642_0001364_9953_10279 106
533 3300046528 Ga0495642_0355163 Ga0495642_0355163_26_352 106
534 3300046530 Ga0495654_0000014 Ga0495654_0000014_304914_305237 106
535 3300046530 Ga0495654_0006366 Ga0495654_0006366_3698_4024 106
536 3300046530 Ga0495654_0006588 Ga0495654_0006588_1099_1425 106
537 3300046530 Ga0495654_0149314 Ga0495654_0149314_151_477 106
538 3300046530 Ga0495654_0324382 Ga0495654_0324382_13_339 106
539 3300046535 Ga0495586_0008325 Ga0495586_0008325_314_634 106
540 3300046538 Ga0495609_0000190 Ga0495609_0000190_44057_44383 106
541 3300046538 Ga0495609_0000803 Ga0495609_0000803_19687_20010 106
542 3300046538 Ga0495609_0000816 Ga0495609_0000816_1903_2229 106
543 3300046538 Ga0495609_0001962 Ga0495609_0001962_6258_6584 106
544 3300046538 Ga0495609_0003738 Ga0495609_0003738_1790_2116 106
545 3300046538 Ga0495609_0014881 Ga0495609_0014881_3302_3628 106
546 3300046538 Ga0495609_0023045 Ga0495609_0023045_1774_2100 106
547 3300046538 Ga0495609_0087426 Ga0495609_0087426_257_583 106
548 3300046539 Ga0495621_0262975 Ga0495621_0262975_88_408 106
549 3300046542 Ga0495597_0000069 Ga0495597_0000069_71935_72261 106
550 3300046542 Ga0495597_0000123 Ga0495597_0000123_34888_35214 106
551 3300046542 Ga0495597_0002767 Ga0495597_0002767_5226_5552 106
552 3300046542 Ga0495597_0012964 Ga0495597_0012964_1496_1822 106
553 3300046542 Ga0495597_0121662 Ga0495597_0121662_296_619 106
554 3300046542 Ga0495597_0162786 Ga0495597_0162786_381_707 106
555 3300046557 Ga0495622_0000109 Ga0495622_0000109_38834_39160 106
556 3300046557 Ga0495622_0000246 Ga0495622_0000246_31640_31966 106
557 3300046557 Ga0495622_0022385 Ga0495622_0022385_2192_2515 106
558 3300046558 Ga0495633_0000088 Ga0495633_0000088_74907_75233 106
559 3300046558 Ga0495633_0000131 Ga0495633_0000131_20859_21185 106
560 3300046558 Ga0495633_0005902 Ga0495633_0005902_1613_1939 106
561 3300046558 Ga0495633_0008968 Ga0495633_0008968_3170_3496 106
562 3300046558 Ga0495633_0012055 Ga0495633_0012055_974_1300 106
563 3300046558 Ga0495633_0013013 Ga0495633_0013013_1568_1894 106
564 3300046558 Ga0495633_0017386 Ga0495633_0017386_1691_2017 106
565 3300046558 Ga0495633_0115375 Ga0495633_0115375_718_1044 106
566 3300046558 Ga0495633_0351772 Ga0495633_0351772_167_493 106
567 3300046615 Ga0495656_0006949 Ga0495656_0006949_1743_2069 106
568 3300046615 Ga0495656_0023540 Ga0495656_0023540_1347_1673 106
569 3300046615 Ga0495656_0248698 Ga0495656_0248698_79_405 106
570 3300046615 Ga0495656_0249837 Ga0495656_0249837_190_516 106
571 3300046615 Ga0495656_0800034 Ga0495656_0800034_80_406 106
572 3300046616 Ga0495668_0000152 Ga0495668_0000152_31838_32164 106
573 3300046616 Ga0495668_0000574 Ga0495668_0000574_36121_36447 106
574 3300046616 Ga0495668_0000636 Ga0495668_0000636_3344_3670 106
575 3300046616 Ga0495668_0002746 Ga0495668_0002746_716_1042 106
576 3300046616 Ga0495668_0101003 Ga0495668_0101003_502_828 106
577 3300046616 Ga0495668_0151915 Ga0495668_0151915_440_766 106
578 3300046616 Ga0495668_0180318 Ga0495668_0180318_97_420 106
579 3300046616 Ga0495668_0762287 Ga0495668_0762287_158_481 106
580 3300046648 Ga0495611_0106266 Ga0495611_0106266_635_958 106
581 3300046660 Ga0495625_0000386 Ga0495625_0000386_56895_57221 106
582 3300046660 Ga0495625_0003039 Ga0495625_0003039_9390_9716 106
583 3300046660 Ga0495625_0003363 Ga0495625_0003363_4866_5192 106
584 3300046660 Ga0495625_0004123 Ga0495625_0004123_7082_7408 106
585 3300046660 Ga0495625_0010047 Ga0495625_0010047_1512_1838 106
586 3300046660 Ga0495625_0066294 Ga0495625_0066294_750_1076 106
587 3300046660 Ga0495625_0068326 Ga0495625_0068326_172_498 106
588 3300046660 Ga0495625_0122456 Ga0495625_0122456_750_1076 106
589 3300046664 Ga0495659_0000026 Ga0495659_0000026_40453_40779 106
590 3300046664 Ga0495659_0000364 Ga0495659_0000364_10355_10681 106
591 3300046664 Ga0495659_0079716 Ga0495659_0079716_172_498 106
592 3300046664 Ga0495659_0258019 Ga0495659_0258019_323_649 106
593 3300046665 Ga0495661_0044139 Ga0495661_0044139_1746_2072 106
594 3300046665 Ga0495661_0054321 Ga0495661_0054321_1364_1690 106
595 3300046665 Ga0495661_0078641 Ga0495661_0078641_48_374 106
596 3300046665 Ga0495661_0105039 Ga0495661_0105039_703_1026 106
597 3300046665 Ga0495661_0197919 Ga0495661_0197919_36_362 106
598 3300046681 Ga0495647_0160230 Ga0495647_0160230_61_381 106
599 3300046683 Ga0495658_0103168 Ga0495658_0103168_1334_1654 106
600 3300046683 Ga0495658_0362192 Ga0495658_0362192_405_725 106
601 3300046684 Ga0495669_0060196 Ga0495669_0060196_723_1049 106
602 3300046684 Ga0495669_0353322 Ga0495669_0353322_322_648 106
603 3300046691 Ga0495670_0001843 Ga0495670_0001843_1289_1615 106
604 3300046691 Ga0495670_0009901 Ga0495670_0009901_721_1047 106
605 3300046691 Ga0495670_0176128 Ga0495670_0176128_365_691 106
606 3300046691 Ga0495670_0359306 Ga0495670_0359306_237_563 106
607 3300046692 Ga0495671_0000005 Ga0495671_0000005_24359_24685 106
608 3300046692 Ga0495671_0000144 Ga0495671_0000144_22360_22686 106
609 3300046692 Ga0495671_0003189 Ga0495671_0003189_2065_2391 106
610 3300046692 Ga0495671_0007388 Ga0495671_0007388_1306_1632 106
611 3300046692 Ga0495671_0019087 Ga0495671_0019087_1494_1820 106
612 3300046692 Ga0495671_0066202 Ga0495671_0066202_326_652 106
613 3300046692 Ga0495671_0106609 Ga0495671_0106609_288_614 106
614 3300046692 Ga0495671_0420484 Ga0495671_0420484_274_600 106
615 3300046694 Ga0495649_0000600 Ga0495649_0000600_27767_28093 106
616 3300046694 Ga0495649_0011122 Ga0495649_0011122_3820_4146 106
617 3300046694 Ga0495649_0016777 Ga0495649_0016777_1758_2084 106
618 3300046694 Ga0495649_0045495 Ga0495649_0045495_995_1318 106
619 3300046694 Ga0495649_0137334 Ga0495649_0137334_816_1142 106
620 3300046694 Ga0495649_0380645 Ga0495649_0380645_267_593 106
621 3300046794 Ga0495589_0170605 Ga0495589_0170605_234_560 106
622 3300046794 Ga0495589_0193612 Ga0495589_0193612_505_831 106
623 3300046794 Ga0495589_0403848 Ga0495589_0403848_76_402 106
624 3300046810 Ga0495660_0000229 Ga0495660_0000229_22831_23157 106
625 3300046810 Ga0495660_0000962 Ga0495660_0000962_12448_12774 106
626 3300046810 Ga0495660_0007303 Ga0495660_0007303_781_1107 106
627 3300046810 Ga0495660_0138063 Ga0495660_0138063_811_1137 106
628 3300046810 Ga0495660_0381986 Ga0495660_0381986_98_424 106
629 3300047318 Ga0495636_0000861 Ga0495636_0000861_6191_6517 106
630 3300047318 Ga0495636_0137144 Ga0495636_0137144_345_668 106
631 3300047318 Ga0495636_0140506 Ga0495636_0140506_121_447 106
632 3300047318 Ga0495636_0164583 Ga0495636_0164583_295_621 106
633 3300047318 Ga0495636_0326551 Ga0495636_0326551_339_665 106
634 3300047320 Ga0495672_0000232 Ga0495672_0000232_25604_25930 106
635 3300047320 Ga0495672_0000260 Ga0495672_0000260_44515_44841 106
636 3300047320 Ga0495672_0002347 Ga0495672_0002347_1228_1554 106
637 3300047320 Ga0495672_0004556 Ga0495672_0004556_10083_10409 106
638 3300047320 Ga0495672_0085907 Ga0495672_0085907_130_453 106
639 3300047321 Ga0495676_0014702 Ga0495676_0014702_3385_3708 106
640 3300047323 Ga0495683_0002158 Ga0495683_0002158_6330_6656 106
641 3300047323 Ga0495683_0003420 Ga0495683_0003420_5808_6134 106
642 3300047443 Ga0495687_000629 Ga0495687_000629_2195_2521 106
643 3300047443 Ga0495687_003552 Ga0495687_003552_3290_3616 106
644 3300047443 Ga0495687_003553 Ga0495687_003553_7590_7916 106
645 3300047443 Ga0495687_031070 Ga0495687_031070_666_992 106
646 3300047443 Ga0495687_047192 Ga0495687_047192_805_1131 106
647 3300047443 Ga0495687_130099 Ga0495687_130099_352_678 106
648 3300047445 Ga0495677_0003543 Ga0495677_0003543_1857_2183 106
649 3300047445 Ga0495677_0010891 Ga0495677_0010891_812_1135 106
650 3300047445 Ga0495677_0031753 Ga0495677_0031753_1117_1443 106
651 3300047446 Ga0495679_021392 Ga0495679_021392_673_999 106
652 3300047446 Ga0495679_022088 Ga0495679_022088_1012_1338 106
653 3300047447 Ga0495685_000147 Ga0495685_000147_6811_7137 106
654 3300047447 Ga0495685_053655 Ga0495685_053655_983_1309 106
655 3300047447 Ga0495685_196368 Ga0495685_196368_275_601 106
656 3300047469 Ga0495673_0000009 Ga0495673_0000009_715703_716029 106
657 3300047469 Ga0495673_0000012 Ga0495673_0000012_605671_605997 106
658 3300047469 Ga0495673_0000146 Ga0495673_0000146_63625_63951 106
659 3300047469 Ga0495673_0013580 Ga0495673_0013580_819_1145 106
660 3300047469 Ga0495673_0062229 Ga0495673_0062229_455_781 106
661 3300047469 Ga0495673_0114665 Ga0495673_0114665_691_1014 106
662 3300047470 Ga0495681_0028587 Ga0495681_0028587_1494_1820 106
663 3300047470 Ga0495681_0068982 Ga0495681_0068982_676_1002 106
664 3300047470 Ga0495681_0205029 Ga0495681_0205029_121_447 106
665 3300047472 Ga0495686_0005943 Ga0495686_0005943_906_1232 106
666 3300047472 Ga0495686_0032478 Ga0495686_0032478_1571_1897 106
667 3300047472 Ga0495686_0058995 Ga0495686_0058995_537_863 106
668 3300047472 Ga0495686_0187647 Ga0495686_0187647_119_445 106
669 3300047472 Ga0495686_0218525 Ga0495686_0218525_476_802 106
670 3300048090 Ga0495615_0001327 Ga0495615_0001327_2911_3237 106
671 3300048091 Ga0495626_0093521 Ga0495626_0093521_663_986 106
672 3300048903 Ga0496100_1399707 Ga0496100_1399707_109_429 106
673 3300048905 Ga0496102_0121773 Ga0496102_0121773_1071_1391 106
674 3300048906 Ga0496103_0001127 Ga0496103_0001127_10712_11038 106
675 3300048906 Ga0496103_0804774 Ga0496103_0804774_238_558 106
676 3300048908 Ga0496105_0715122 Ga0496105_0715122_198_518 106
677 3300048911 Ga0496108_0683898 Ga0496108_0683898_494_814 106
678 3300048912 Ga0496109_0214041 Ga0496109_0214041_103_423 106
679 3300048912 Ga0496109_0737177 Ga0496109_0737177_369_689 106
680 3300048914 Ga0496111_0679350 Ga0496111_0679350_164_487 106
681 3300048919 Ga0496116_0156787 Ga0496116_0156787_655_981 106
682 3300048922 Ga0496119_0139778 Ga0496119_0139778_251_577 106
683 3300048923 Ga0496120_0358412 Ga0496120_0358412_50_376 106
684 3300048924 Ga0496121_0244761 Ga0496121_0244761_175_501 106
685 3300048925 Ga0496122_0069316 Ga0496122_0069316_758_1084 106
686 3300048926 Ga0496123_0008272 Ga0496123_0008272_8529_8855 106
687 3300048927 Ga0496124_0181573 Ga0496124_0181573_1137_1463 106
688 3300048927 Ga0496124_0376664 Ga0496124_0376664_50_376 106
689 3300048927 Ga0496124_0779505 Ga0496124_0779505_12_338 106
690 3300048927 Ga0496124_0785351 Ga0496124_0785351_241_567 106
691 3300048929 Ga0496126_0043656 Ga0496126_0043656_3035_3361 106
692 3300049459 Ga0495678_000278 Ga0495678_000278_30540_30866 106
693 3300049459 Ga0495678_004335 Ga0495678_004335_1734_2060 106
694 3300049459 Ga0495678_022953 Ga0495678_022953_1734_2060 106
695 3300049459 Ga0495678_023903 Ga0495678_023903_1258_1584 106
696 3300049459 Ga0495678_126667 Ga0495678_126667_390_716 106
697 3300049460 Ga0495682_0000515 Ga0495682_0000515_8333_8659 106
698 3300049460 Ga0495682_0000614 Ga0495682_0000614_11097_11423 106
699 3300049460 Ga0495682_0076798 Ga0495682_0076798_17_343 106
700 3300049460 Ga0495682_0120969 Ga0495682_0120969_263_589 106
701 3300049460 Ga0495682_0121705 Ga0495682_0121705_152_478 106
702 3300049575 Ga0501039_1234992 Ga0501039_1234992_225_551 106
703 3300049679 Ga0501249_010931 Ga0501249_010931_961_1287 106
704 3300049766 Ga0501269_027979 Ga0501269_027979_320_646 106
705 3300050489 nmdc:mga03683_142137_c1 nmdc:mga03683_142137_c1_452_778 106
706 3300050489 nmdc:mga03683_61078_c1 nmdc:mga03683_61078_c1_1235_1555 106
707 3300050490 nmdc:mga03n38_79330_c1 nmdc:mga03n38_79330_c1_338_658 106
708 3300050491 nmdc:mga00v17_252734_c1 nmdc:mga00v17_252734_c1_80_400 106
709 3300050492 nmdc:mga0yw44_54778_c1 nmdc:mga0yw44_54778_c1_581_901 106
710 3300050493 nmdc:mga0k408_200056_c1 nmdc:mga0k408_200056_c1_434_754 106
711 3300050493 nmdc:mga0k408_373562_c1 nmdc:mga0k408_373562_c1_223_543 106
712 3300050493 nmdc:mga0k408_821069_c1 nmdc:mga0k408_821069_c1_69_389 106
713 3300050494 nmdc:mga06z11_19185_c1 nmdc:mga06z11_19185_c1_1183_1503 106
714 3300050494 nmdc:mga06z11_38210_c1 nmdc:mga06z11_38210_c1_1112_1432 106
715 3300050494 nmdc:mga06z11_406194_c1 nmdc:mga06z11_406194_c1_345_665 106
716 3300050495 nmdc:mga04h51_238386_c1 nmdc:mga04h51_238386_c1_70_390 106
717 3300050496 nmdc:mga07m45_27508_c1 nmdc:mga07m45_27508_c1_448_768 106
718 3300050512 nmdc:mga0n895_961286_c1 nmdc:mga0n895_961286_c1_363_683 106
719 3300050513 nmdc:mga0rr50_1059239_c1 nmdc:mga0rr50_1059239_c1_358_678 106
720 3300050516 nmdc:mga0sz30_49140_c1 nmdc:mga0sz30_49140_c1_608_928 106
721 3300053078 Ga0495612_0181849 Ga0495612_0181849_309_629 106
722 3300053115 Ga0500591_253844 Ga0500591_253844_85_411 106
723 3300053118 Ga0500594_0026495 Ga0500594_0026495_978_1304 106
724 3300053125 Ga0500618_001265 Ga0500618_001265_4944_5270 106
725 3300053136 Ga0500559_0555699 Ga0500559_0555699_30_356 106
726 3300053145 Ga0500586_012053 Ga0500586_012053_1350_1676 106
727 3300053145 Ga0500586_137596 Ga0500586_137596_417_743 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

6

102

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9399 2 105
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.9392 1 106
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.9312 2 106
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.9302 1 106
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.9138 2 105
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9392 1 106 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9302 1 106 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8409 1 104 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8183 4 106 2.60.40.2470
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8056 5 106 2.60.40.730
ID Description Score Start End GO Terms
AF-A0A3D3B1U7-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9522 2 106
AF-A0A7V8ISW7-F1-model_v4 deleted 0.9513 1 106
AF-A0A3S3CWY5-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9472 9 106
AF-A0A537AGA8-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9451 1 106
AF-A0A6L7KFJ9-F1-model_v4 Thiosulfate oxidation carrier complex protein SoxZ 0.9437 1 106

Feature Viewer

pLDDT pTM Quality
94.88 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map