F477651

General Info

Members Datasets Scaffolds Average Seq Length
725 463 657 153

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935608549|2935611805
Length 186
Sequence SWCFFVDQRGDIYRQGKYAATAAEQNRSWSMKMAKRLDYDRIAPAGMKALGGVYGYVMQSNLPATLVTLVYLRISQINNCAYCLDMHTRDLLKSGQKIEKIALVQAWAEGGHLFDERERAALAWAETVTRVAETGIPDQAYEAARAVFEERELVDLTIAIGLMNAYNRMAISFRNTPQAAKEEMAA

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
4 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
5 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
6 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2643221688 Rhizobium sp. Root482 Isolate Unclassified
9 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
10 2791355199
11 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
12 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
13 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
14 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
15 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
16 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
17 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
18 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
19 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
20 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
21 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
22 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
23 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
24 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
25 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
26 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
27 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
28 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
29 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
30 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
31 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
32 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
33 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
34 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
35 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
36 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
37 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
38 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
39 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
40 2929520902 Variovorax beijingensis 502 Isolate Unclassified
41 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
42 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
43 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
44 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
45 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
46 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
47 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
48 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
49 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
50 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
51 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
52 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
53 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
54 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
55 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
56 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
57 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
58 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
59 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
60 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
61 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
62 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
63 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
64 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
65 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
68 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
75 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
81 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
91 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
92 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
98 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
99 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
100 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005473 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
111 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
112 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
129 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
130 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
131 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
132 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
133 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
134 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
145 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
146 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
147 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
148 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
149 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
150 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
151 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
152 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
168 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
169 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
170 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
171 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
172 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
176 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
177 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
178 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
179 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
180 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
181 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
182 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
183 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
184 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
185 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
186 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
188 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
189 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
190 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
191 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
258 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
259 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
261 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
262 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
263 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
264 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
268 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
269 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
270 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
271 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
272 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
275 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
276 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
277 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
278 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
279 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
280 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
281 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
282 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
283 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
284 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
285 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
286 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
287 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
288 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
289 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
290 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
291 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
292 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
293 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
294 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
295 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
298 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
299 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
300 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
301 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
302 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
303 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
306 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
307 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
308 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
309 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
310 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
311 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
312 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
313 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
314 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
315 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
316 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
317 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
318 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
319 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
320 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
321 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
322 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
323 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
324 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
325 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
326 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
327 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
328 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
329 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
330 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
331 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
332 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
333 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
334 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
335 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
341 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
342 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
343 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
344 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
345 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
351 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
352 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
353 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
354 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
355 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
356 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
357 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
358 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
359 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
360 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
361 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
362 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
363 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
364 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
365 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
366 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
367 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
368 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
369 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
370 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
371 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
372 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
373 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
374 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
375 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
376 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
377 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
378 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
379 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
380 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
381 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
387 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
388 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
389 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
390 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
391 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
394 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
395 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
396 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
397 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
398 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
399 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
400 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
401 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
402 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
403 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
404 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
412 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
413 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
414 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
415 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
416 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
417 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
418 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
419 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
424 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
425 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
426 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
427 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
428 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
429 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
430 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
431 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
432 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
433 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
434 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
435 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
436 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
437 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
440 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
441 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
442 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
446 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
447 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
448 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
449 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
450 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
451 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
452 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
453 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
454 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
455 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
456 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
457 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
458 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
459 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
460 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
461 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
462 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
463 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.61
Metatranscriptomes 0.14
Isolates 9.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.83
Nodule 7.86
Rhizoplane 4.55
Rhizosphere 63.31
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10012390 3300002075 Bacteria 1863
2 JGI24742J22300_10048254 3300002244 Bacteria 768
3 JGI25157J39369_1000188 3300002741 Bacteria 52162
4 JGI25159J45721_1024677 3300002987 Bacteria 1065
5 JGI25153J46596_10001083 3300003215 Bacteria 16602
6 rootL2_10103187 3300003322 Bacteria 3485
7 JGI25160J50197_1000042 3300003354 Bacteria 149808
8 JGI25160J50197_1000866 3300003354 Bacteria 16040
9 JGI25160J50197_1006131 3300003354 Bacteria 4902
10 JGI25160J50197_1012996 3300003354 Bacteria 2858
11 JGI25161J50226_1000305 3300003374 Bacteria 27361
12 JGI25161J50226_1001004 3300003374 Bacteria 9892
13 Ga0055526_1010501 3300003771 Bacteria 4297
14 Ga0055536_1006143 3300003781 Bacteria 5679
15 Ga0055536_1007742 3300003781 Bacteria 4750
16 Ga0055536_1017623 3300003781 Bacteria 2327
17 Ga0055536_1076350 3300003781 Bacteria 646
18 Ga0055530_10002071 3300003791 Bacteria 13463
19 Ga0055540_1030767 3300003792 Bacteria 1241
20 Ga0055531_10009625 3300003794 Bacteria 4919
21 Ga0055531_10010201 3300003794 Bacteria 4698
22 Ga0055531_10017573 3300003794 Bacteria 3011
23 Ga0055531_10032714 3300003794 Bacteria 1692
24 Ga0055531_10063562 3300003794 Bacteria 887
25 Ga0055531_10097207 3300003794 Bacteria 612
26 Ga0058692_1000001 3300003856 Bacteria 834230
27 Ga0055543_1000931 3300004625 Bacteria 13557
28 Ga0055543_1004885 3300004625 Bacteria 3542
29 Ga0055543_1009945 3300004625 Bacteria 2017
30 Ga0065165_1000174 3300005262 Bacteria 113769
31 Ga0065165_1001608 3300005262 Bacteria 23076
32 Ga0065165_1001780 3300005262 Bacteria 21284
33 Ga0065165_1002379 3300005262 Bacteria 16214
34 Ga0065703_1000131 3300005272 Bacteria 12048
35 Ga0065704_10143141 3300005289 Bacteria 1498
36 Ga0070658_10230563 3300005327 Bacteria 1568
37 Ga0070676_10328699 3300005328 Bacteria 1045
38 Ga0070677_10098517 3300005333 Bacteria 1285
39 Ga0068869_100275724 3300005334 Bacteria 1351
40 Ga0068869_100479023 3300005334 Bacteria 1036
41 Ga0070680_100060330 3300005336 Bacteria 3104
42 Ga0070682_100452345 3300005337 Bacteria 984
43 Ga0070689_100177492 3300005340 Bacteria 1728
44 Ga0070668_100011183 3300005347 Bacteria 6683
45 Ga0070668_100072369 3300005347 Bacteria 2686
46 Ga0070668_100324292 3300005347 Bacteria 1297
47 Ga0070668_100740222 3300005347 Bacteria 869
48 Ga0070669_100219239 3300005353 Bacteria 1504
49 Ga0070669_100407460 3300005353 Bacteria 1114
50 Ga0070675_100055471 3300005354 Bacteria 3262
51 Ga0070675_101395803 3300005354 Bacteria 646
52 Ga0070671_100162396 3300005355 Bacteria 1888
53 Ga0070674_100606065 3300005356 Bacteria 926
54 Ga0070673_100219296 3300005364 Bacteria 1646
55 Ga0070688_100134409 3300005365 Bacteria 1673
56 Ga0070659_100314000 3300005366 Bacteria 1309
57 Ga0070659_100699948 3300005366 Bacteria 876
58 Ga0070659_100728875 3300005366 Bacteria 859
59 Ga0070667_100076083 3300005367 Bacteria 2866
60 Ga0070667_100078096 3300005367 Bacteria 2827
61 Ga0070667_101351963 3300005367 Bacteria 668
62 Ga0070667_101509436 3300005367 Bacteria 631
63 Ga0070709_10125212 3300005434 Bacteria 1747
64 Ga0070709_10650413 3300005434 Bacteria 816
65 Ga0070713_100039260 3300005436 Bacteria 3841
66 Ga0070713_101234426 3300005436 Bacteria 724
67 Ga0070710_10039060 3300005437 Bacteria 2610
68 Ga0070710_10201708 3300005437 Bacteria 1256
69 Ga0070701_10493251 3300005438 Bacteria 794
70 Ga0070701_11012170 3300005438 Bacteria 580
71 Ga0070711_100021672 3300005439 Bacteria 4157
72 Ga0070711_100114383 3300005439 Bacteria 1986
73 Ga0070700_100174724 3300005441 Bacteria 1490
74 Ga0070700_100731868 3300005441 Bacteria 790
75 Ga0070663_100010319 3300005455 Bacteria 5821
76 Ga0070663_100084590 3300005455 Bacteria 2339
77 Ga0070663_100097128 3300005455 Bacteria 2193
78 Ga0070663_100134325 3300005455 Bacteria 1882
79 Ga0070663_100160609 3300005455 Bacteria 1729
80 Ga0070678_100375546 3300005456 Bacteria 1229
81 Ga0070678_100558792 3300005456 Bacteria 1017
82 Ga0070662_100594683 3300005457 Bacteria 930
83 Ga0070681_10069696 3300005458 Bacteria 3483
84 Ga0068867_100161280 3300005459 Bacteria 1768
85 Ga0068867_100269062 3300005459 Bacteria 1392
86 Ga0070685_10104337 3300005466 Bacteria 1736
87 Ga0074250_10309 3300005473 Bacteria 2158
88 Ga0070679_100069731 3300005530 Bacteria 3507
89 Ga0070679_101368979 3300005530 Bacteria 654
90 Ga0068853_101928495 3300005539 Bacteria 573
91 Ga0070672_100058890 3300005543 Bacteria 3021
92 Ga0070672_100355511 3300005543 Bacteria 1249
93 Ga0070686_100128338 3300005544 Bacteria 1750
94 Ga0070696_100257861 3300005546 Bacteria 1321
95 Ga0070693_100144883 3300005547 Bacteria 1499
96 Ga0070665_100048897 3300005548 Bacteria 4245
97 Ga0070665_100090619 3300005548 Bacteria 3063
98 Ga0070665_100160167 3300005548 Bacteria 2252
99 Ga0070665_100818314 3300005548 Bacteria 944
100 Ga0068855_100005078 3300005563 Bacteria 16046
101 Ga0068855_100722433 3300005563 Bacteria 1064
102 Ga0070664_100280713 3300005564 Bacteria 1502
103 Ga0068857_100630161 3300005577 Bacteria 1015
104 Ga0068854_100084200 3300005578 Bacteria 2353
105 Ga0068854_100181619 3300005578 Bacteria 1644
106 Ga0068854_100312121 3300005578 Bacteria 1275
107 Ga0068856_101644676 3300005614 Bacteria 655
108 Ga0070702_100198571 3300005615 Bacteria 1326
109 Ga0070702_100268914 3300005615 Bacteria 1165
110 Ga0070702_100507423 3300005615 Bacteria 887
111 Ga0068859_100218559 3300005617 Bacteria 1993
112 Ga0068866_10119945 3300005718 Bacteria 1480
113 Ga0068861_100372557 3300005719 Bacteria 1259
114 Ga0068861_101096342 3300005719 Bacteria 765
115 Ga0068870_10224425 3300005840 Bacteria 1152
116 Ga0068858_101077175 3300005842 Bacteria 789
117 Ga0068858_101129742 3300005842 Bacteria 769
118 Ga0068860_100611825 3300005843 Bacteria 1095
119 Ga0068862_100263365 3300005844 Bacteria 1574
120 Ga0068862_100838924 3300005844 Bacteria 900
121 Ga0081455_10008875 3300005937 Bacteria 10395
122 Ga0081455_10062419 3300005937 Bacteria 3131
123 Ga0081540_1025746 3300005983 Bacteria 3377
124 Ga0081540_1069324 3300005983 Bacteria 1639
125 Ga0070717_10271232 3300006028 Bacteria 1503
126 Ga0070717_10294822 3300006028 Bacteria 1441
127 Ga0075365_10021797 3300006038 Bacteria 4003
128 Ga0075365_10026989 3300006038 Bacteria 3649
129 Ga0075365_10259007 3300006038 Bacteria 1223
130 Ga0075365_10273586 3300006038 Bacteria 1188
131 Ga0075368_10007588 3300006042 Bacteria 3828
132 Ga0075368_10076845 3300006042 Bacteria 1355
133 Ga0075363_100286802 3300006048 Bacteria 953
134 Ga0075363_100600248 3300006048 Bacteria 660
135 Ga0075364_10068084 3300006051 Bacteria 2341
136 Ga0075364_10396192 3300006051 Bacteria 942
137 Ga0070712_100232157 3300006175 Bacteria 1466
138 Ga0070712_100242366 3300006175 Bacteria 1437
139 Ga0075362_10072044 3300006177 Bacteria 1580
140 Ga0075362_10198503 3300006177 Bacteria 976
141 Ga0075367_10009129 3300006178 Bacteria 5170
142 Ga0075367_10056508 3300006178 Bacteria 2331
143 Ga0075367_10065291 3300006178 Bacteria 2179
144 Ga0075367_10397203 3300006178 Bacteria 872
145 Ga0075369_10070600 3300006186 Bacteria 1537
146 Ga0075369_10221796 3300006186 Bacteria 875
147 Ga0075369_10407673 3300006186 Bacteria 641
148 Ga0075366_10124393 3300006195 Bacteria 1555
149 Ga0075366_10280731 3300006195 Bacteria 1018
150 Ga0075370_10016633 3300006353 Bacteria 3959
151 Ga0075370_10037350 3300006353 Bacteria 2731
152 Ga0068871_101621804 3300006358 Bacteria 613
153 Ga0075428_100005277 3300006844 Bacteria 14368
154 Ga0075430_100166379 3300006846 Bacteria 1835
155 Ga0075430_100251539 3300006846 Bacteria 1464
156 Ga0097620_100218568 3300006931 Bacteria 1993
157 Ga0099825_1034652 3300006941 Bacteria 1862
158 Ga0099824_1038251 3300006942 Bacteria 1288
159 Ga0099822_1001480 3300006943 Bacteria 27484
160 Ga0099823_1008083 3300006944 Bacteria 10710
161 Ga0099795_10059300 3300007788 Bacteria 1416
162 Ga0105251_10219096 3300009011 Bacteria 857
163 Ga0105251_10377892 3300009011 Bacteria 649
164 Ga0105244_10003674 3300009036 Bacteria 10835
165 Ga0105250_10002955 3300009092 Bacteria 8276
166 Ga0105240_10048479 3300009093 Bacteria 5368
167 Ga0105240_11082850 3300009093 Bacteria 853
168 Ga0111539_10000616 3300009094 Bacteria 46125
169 Ga0111539_10038859 3300009094 Bacteria 5741
170 Ga0105245_10167231 3300009098 Bacteria 2091
171 Ga0105245_11825840 3300009098 Bacteria 661
172 Ga0114129_10294342 3300009147 Bacteria 2165
173 Ga0105243_10000266 3300009148 Bacteria 58762
174 Ga0105243_10349155 3300009148 Bacteria 1358
175 Ga0105243_10507708 3300009148 Bacteria 1144
176 Ga0105243_10509428 3300009148 Bacteria 1142
177 Ga0105241_10284981 3300009174 Bacteria 1412
178 Ga0105242_10313575 3300009176 Bacteria 1436
179 Ga0105242_10472799 3300009176 Bacteria 1186
180 Ga0105248_10044933 3300009177 Bacteria 4954
181 Ga0105248_10770113 3300009177 Bacteria 1086
182 Ga0105248_10998688 3300009177 Bacteria 945
183 Ga0105237_10401732 3300009545 Bacteria 1375
184 Ga0105237_10571391 3300009545 Bacteria 1137
185 Ga0105238_10232064 3300009551 Bacteria 1822
186 Ga0105238_10650453 3300009551 Bacteria 1064
187 Ga0105249_10384842 3300009553 Bacteria 1430
188 Ga0105033_103627 3300009986 Bacteria 1304
189 Ga0105239_10010122 3300010375 Bacteria 10567
190 Ga0105239_10114797 3300010375 Bacteria 2987
191 Ga0105239_12403338 3300010375 Bacteria 614
192 Ga0105246_10035339 3300011119 Bacteria 3340
193 Ga0157319_1018736 3300012497 Bacteria 652
194 Ga0157347_1004269 3300012502 Bacteria 1319
195 Ga0157370_10375663 3300013104 Bacteria 1309
196 Ga0157370_10375665 3300013104 Bacteria 1309
197 Ga0157370_10468680 3300013104 Bacteria 1157
198 Ga0157369_10005932 3300013105 Bacteria 14188
199 Ga0157374_10321643 3300013296 Bacteria 1533
200 Ga0157374_10544571 3300013296 Bacteria 1168
201 Ga0157378_10139282 3300013297 Bacteria 2252
202 Ga0163162_10314987 3300013306 Bacteria 1697
203 Ga0163162_10321431 3300013306 Bacteria 1680
204 Ga0163162_10536128 3300013306 Bacteria 1299
205 Ga0163162_12384606 3300013306 Bacteria 608
206 Ga0157375_10239587 3300013308 Bacteria 1974
207 Ga0157515_156067 3300013875 Bacteria 1360
208 Ga0163163_10772530 3300014325 Bacteria 1024
209 Ga0163163_11675239 3300014325 Bacteria 697
210 Ga0157380_10140437 3300014326 Bacteria 2074
211 Ga0157379_10606445 3300014968 Bacteria 1022
212 Ga0157376_11067171 3300014969 Bacteria 832
213 Ga0157376_12740164 3300014969 Bacteria 533
214 Ga0163161_10339933 3300017792 Bacteria 1191
215 Ga0206356_11226433 3300020070 Bacteria 632
216 Ga0214544_1000009 3300021320 Bacteria 285865
217 Ga0214542_1000002 3300021321 Bacteria 720798
218 Ga0214545_1000002 3300021324 Bacteria 727485
219 Ga0214543_1000013 3300021327 Bacteria 329117
220 Ga0209436_100151 3300025208 Bacteria 33281
221 Ga0207425_1029235 3300025245 Bacteria 1112
222 Ga0209026_1000070 3300025250 Bacteria 205861
223 Ga0209759_1000293 3300025256 Bacteria 69229
224 Ga0209233_1016754 3300025261 Bacteria 2012
225 Ga0209565_1014942 3300025263 Bacteria 1766
226 Ga0209673_1066743 3300025273 Bacteria 873
227 Ga0209130_1000054 3300025284 Bacteria 212299
228 Ga0209130_1000075 3300025284 Bacteria 171698
229 Ga0209130_1000304 3300025284 Bacteria 59784
230 Ga0209675_1009191 3300025291 Bacteria 3516
231 Ga0209675_1068308 3300025291 Bacteria 683
232 Ga0209676_1001001 3300025292 Bacteria 33180
233 Ga0209676_1013489 3300025292 Bacteria 3140
234 Ga0209676_1022145 3300025292 Bacteria 2113
235 Ga0209676_1042456 3300025292 Bacteria 1262
236 Ga0209025_1003491 3300025294 Bacteria 14807
237 Ga0209025_1005830 3300025294 Bacteria 9864
238 Ga0209564_1000869 3300025295 Bacteria 40151
239 Ga0209758_1016348 3300025297 Bacteria 3775
240 Ga0209758_1035436 3300025297 Bacteria 1967
241 Ga0209050_1000829 3300025298 Bacteria 42838
242 Ga0209050_1008936 3300025298 Bacteria 5229
243 Ga0209256_1000951 3300025299 Bacteria 35127
244 Ga0207426_1000127 3300025302 Bacteria 212942
245 Ga0207426_1000141 3300025302 Bacteria 194453
246 Ga0207426_1000163 3300025302 Bacteria 171698
247 Ga0207426_1001352 3300025302 Bacteria 20790
248 Ga0207426_1035887 3300025302 Bacteria 1579
249 Ga0209051_1003765 3300025303 Bacteria 9731
250 Ga0209051_1005795 3300025303 Bacteria 7110
251 Ga0209051_1050873 3300025303 Bacteria 1383
252 Ga0209257_1000846 3300025304 Bacteria 43824
253 Ga0209257_1002128 3300025304 Bacteria 20658
254 Ga0209257_1006755 3300025304 Bacteria 7231
255 Ga0209257_1013823 3300025304 Bacteria 3538
256 Ga0209257_1056450 3300025304 Bacteria 1084
257 Ga0209257_1071995 3300025304 Bacteria 908
258 Ga0207697_10035429 3300025315 Bacteria 2043
259 Ga0207696_1002904 3300025711 Bacteria 8065
260 Ga0207655_1000353 3300025728 Bacteria 66222
261 Ga0207713_1010634 3300025735 Bacteria 5074
262 Ga0207682_10075318 3300025893 Bacteria 1436
263 Ga0207692_10338185 3300025898 Bacteria 925
264 Ga0207692_10456035 3300025898 Bacteria 805
265 Ga0207642_10020311 3300025899 Bacteria 2590
266 Ga0207688_10009650 3300025901 Bacteria 5255
267 Ga0207680_10742839 3300025903 Bacteria 703
268 Ga0207699_10157918 3300025906 Bacteria 1507
269 Ga0207699_10659853 3300025906 Bacteria 764
270 Ga0207645_10224793 3300025907 Bacteria 1238
271 Ga0207705_10136113 3300025909 Bacteria 1831
272 Ga0207684_10644341 3300025910 Bacteria 903
273 Ga0207707_10992937 3300025912 Bacteria 689
274 Ga0207695_10052552 3300025913 Bacteria 4267
275 Ga0207671_10321495 3300025914 Bacteria 1224
276 Ga0207693_10016626 3300025915 Bacteria 5877
277 Ga0207693_10423993 3300025915 Bacteria 1040
278 Ga0207663_10017262 3300025916 Bacteria 4017
279 Ga0207663_10060620 3300025916 Bacteria 2398
280 Ga0207663_10104535 3300025916 Bacteria 1909
281 Ga0207660_10149059 3300025917 Bacteria 1796
282 Ga0207649_10209964 3300025920 Bacteria 1380
283 Ga0207652_10139022 3300025921 Bacteria 2171
284 Ga0207681_10199018 3300025923 Bacteria 1537
285 Ga0207694_10183403 3300025924 Bacteria 1698
286 Ga0207687_10048099 3300025927 Bacteria 2959
287 Ga0207700_10056696 3300025928 Bacteria 2950
288 Ga0207700_10691526 3300025928 Bacteria 910
289 Ga0207664_10800973 3300025929 Bacteria 847
290 Ga0207644_10236839 3300025931 Bacteria 1452
291 Ga0207690_10078188 3300025932 Bacteria 2301
292 Ga0207690_10589659 3300025932 Bacteria 906
293 Ga0207706_10070521 3300025933 Bacteria 3074
294 Ga0207706_10093854 3300025933 Bacteria 2639
295 Ga0207686_10725983 3300025934 Bacteria 791
296 Ga0207686_10766790 3300025934 Bacteria 771
297 Ga0207709_10000001 3300025935 Bacteria 2228154
298 Ga0207709_10009200 3300025935 Bacteria 5441
299 Ga0207670_10157026 3300025936 Bacteria 1694
300 Ga0207669_10095538 3300025937 Bacteria 1948
301 Ga0207665_10353162 3300025939 Bacteria 1110
302 Ga0207691_10081903 3300025940 Bacteria 2900
303 Ga0207691_10351200 3300025940 Bacteria 1262
304 Ga0207711_10014773 3300025941 Bacteria 6489
305 Ga0207689_11175991 3300025942 Bacteria 646
306 Ga0207667_10147307 3300025949 Bacteria 2423
307 Ga0207667_11615261 3300025949 Bacteria 617
308 Ga0207651_10026070 3300025960 Bacteria 3645
309 Ga0207712_10012307 3300025961 Bacteria 5468
310 Ga0207668_10061259 3300025972 Bacteria 2645
311 Ga0207668_10253973 3300025972 Bacteria 1429
312 Ga0207668_10501411 3300025972 Bacteria 1044
313 Ga0207640_10014710 3300025981 Bacteria 4510
314 Ga0207640_10188773 3300025981 Bacteria 1552
315 Ga0207658_10063431 3300025986 Bacteria 2769
316 Ga0207658_10885829 3300025986 Bacteria 812
317 Ga0207677_10536595 3300026023 Bacteria 1017
318 Ga0207703_10658188 3300026035 Bacteria 994
319 Ga0207639_11182835 3300026041 Bacteria 717
320 Ga0207639_11385021 3300026041 Bacteria 660
321 Ga0207678_10015102 3300026067 Bacteria 6793
322 Ga0207678_10037726 3300026067 Bacteria 4202
323 Ga0207678_10057840 3300026067 Bacteria 3336
324 Ga0207678_10067602 3300026067 Bacteria 3067
325 Ga0207678_10074338 3300026067 Bacteria 2912
326 Ga0207678_10343446 3300026067 Bacteria 1286
327 Ga0207708_10173851 3300026075 Bacteria 1707
328 Ga0207708_10309833 3300026075 Bacteria 1286
329 Ga0207648_10086382 3300026089 Bacteria 2737
330 Ga0207648_10116615 3300026089 Bacteria 2347
331 Ga0207674_10064324 3300026116 Bacteria 3700
332 Ga0207674_10446969 3300026116 Bacteria 1249
333 Ga0207675_100182160 3300026118 Bacteria 2012
334 Ga0207675_100783549 3300026118 Bacteria 966
335 Ga0207683_10091351 3300026121 Bacteria 2712
336 Ga0207683_10205747 3300026121 Bacteria 1790
337 Ga0207683_10417232 3300026121 Bacteria 1236
338 Ga0207698_10286246 3300026142 Bacteria 1527
339 Ga0209281_1001247 3300027111 Bacteria 16688
340 Ga0209389_1000117 3300027296 Bacteria 71506
341 Ga0209371_1000008 3300027312 Bacteria 1024606
342 Ga0209489_102405 3300027361 Bacteria 38216
343 Ga0209700_100021 3300027363 Bacteria 230859
344 Ga0209813_10031533 3300027866 Bacteria 1565
345 Ga0209813_10105763 3300027866 Bacteria 963
346 Ga0207428_10000129 3300027907 Bacteria 104467
347 Ga0207428_10292680 3300027907 Bacteria 1206
348 Ga0268266_10001892 3300028379 Bacteria 23598
349 Ga0268266_10004234 3300028379 Bacteria 13815
350 Ga0268266_10959847 3300028379 Bacteria 827
351 Ga0268265_10220021 3300028380 Bacteria 1661
352 Ga0268264_10303587 3300028381 Bacteria 1504
353 Ga0268256_1000009 3300030500 Bacteria 1022625
354 Ga0265325_10000105 3300031241 Bacteria 59642
355 Ga0307513_10100903 3300031456 Bacteria 2910
356 Ga0307513_10276049 3300031456 Bacteria 1461
357 Ga0307509_10032602 3300031507 Bacteria 5740
358 Ga0307408_100068556 3300031548 Bacteria 2612
359 Ga0307408_100171429 3300031548 Bacteria 1733
360 Ga0307408_100822667 3300031548 Bacteria 844
361 Ga0307405_10069466 3300031731 Bacteria 2258
362 Ga0307405_10204225 3300031731 Bacteria 1437
363 Ga0307413_10035168 3300031824 Bacteria 2871
364 Ga0307413_11570608 3300031824 Bacteria 583
365 Ga0307410_10114355 3300031852 Bacteria 1958
366 Ga0307410_10158694 3300031852 Bacteria 1692
367 Ga0307410_11703053 3300031852 Bacteria 559
368 Ga0307406_10018932 3300031901 Bacteria 4033
369 Ga0307406_10800219 3300031901 Bacteria 795
370 Ga0307412_10003244 3300031911 Bacteria 9042
371 Ga0307412_10015743 3300031911 Bacteria 4489
372 Ga0307412_11449999 3300031911 Bacteria 622
373 Ga0307409_100095290 3300031995 Bacteria 2452
374 Ga0307409_100657915 3300031995 Bacteria 1042
375 Ga0307409_101230461 3300031995 Bacteria 773
376 Ga0307416_100022587 3300032002 Bacteria 4544
377 Ga0307416_101121835 3300032002 Bacteria 891
378 Ga0307411_10122472 3300032005 Bacteria 1885
379 Ga0307415_100092914 3300032126 Bacteria 2189
380 Ga0307415_101092084 3300032126 Bacteria 746
381 Ga0307510_10021950 3300033180 Bacteria 7426
382 Ga0307510_10064539 3300033180 Bacteria 3718
383 Ga0307510_10110805 3300033180 Bacteria 2488
384 Ga0373938_0166361 3300034957 Bacteria 595
385 Ga0373934_0051305 3300035086 Bacteria 1635
386 Ga0373953_0009557 3300035117 Bacteria 3343
387 Ga0373954_0087805 3300035118 Bacteria 1491
388 Ga0373956_0009924 3300035119 Bacteria 3883
389 Ga0373957_0008716 3300035120 Bacteria 3299
390 Ga0373943_0792030 3300035170 Bacteria 564
391 Ga0373946_0073638 3300035171 Bacteria 1481
392 Ga0373955_0141191 3300035172 Bacteria 1412
393 Ga0373935_0104971 3300035692 Bacteria 1868
394 Ga0373927_0227925 3300035695 Bacteria 1224
395 Ga0373933_0052122 3300035724 Bacteria 2447
396 Ga0373947_0290077 3300035725 Bacteria 1089
397 Ga0373937_0106404 3300036401 Bacteria 2607
398 Ga0373925_0023713 3300037068 Bacteria 4477
399 Ga0395899_0203784 3300037312 Bacteria 1378
400 Ga0395900_0078574 3300037418 Bacteria 3390
401 Ga0395898_0192576 3300037466 Bacteria 1948
402 Ga0395898_0240966 3300037466 Bacteria 1725
403 Ga0395905_0015261 3300037471 Bacteria 7304
404 Ga0395905_0145461 3300037471 Bacteria 2230
405 Ga0395905_0211175 3300037471 Bacteria 1818
406 Ga0395905_0408981 3300037471 Bacteria 1252
407 Ga0395901_0090246 3300038443 Bacteria 3207
408 Ga0395901_0671761 3300038443 Bacteria 1037
409 Ga0395901_0688838 3300038443 Bacteria 1021
410 Ga0436363_0870267 3300039450 Bacteria 2358
411 Ga0439466_0031676 3300041411 Bacteria 1807
412 Ga0439466_0138311 3300041411 Bacteria 748
413 Ga0439465_0021404 3300041413 Bacteria 2027
414 Ga0451789_0744550 3300041443 Bacteria 1630
415 Ga0451791_1567305 3300041451 Bacteria 650
416 Ga0451802_0456888 3300041460 Bacteria 904
417 Ga0451839_1130307 3300041496 Bacteria 1548
418 Ga0451841_0068232 3300041498 Bacteria 757
419 Ga0451849_1320375 3300041505 Bacteria 1378
420 Ga0451853_0116443 3300041512 Bacteria 647
421 Ga0439431_0092733 3300041997 Bacteria 824
422 Ga0439449_0114735 3300042007 Bacteria 999
423 Ga0439462_0091124 3300042015 Bacteria 836
424 Ga0450920_037838 3300042122 Bacteria 959
425 Ga0439434_0209834 3300042435 Bacteria 658
426 Ga0466969_0009042 3300044656 Bacteria 5278
427 Ga0466969_0012357 3300044656 Bacteria 4504
428 Ga0466969_0014849 3300044656 Bacteria 4089
429 Ga0466969_0086269 3300044656 Bacteria 1492
430 Ga0466969_0500522 3300044656 Bacteria 554
431 Ga0466965_0002917 3300044683 Bacteria 7391
432 Ga0466965_0085356 3300044683 Bacteria 1600
433 Ga0466965_0204621 3300044683 Unclassified 1048
434 Ga0466966_0012747 3300044684 Bacteria 5572
435 Ga0466966_0015365 3300044684 Bacteria 5063
436 Ga0466966_0027387 3300044684 Bacteria 3717
437 Ga0466966_0027652 3300044684 Bacteria 3697
438 Ga0466966_0041116 3300044684 Bacteria 2971
439 Ga0466961_0002159 3300044693 Bacteria 12238
440 Ga0466961_0008083 3300044693 Bacteria 6704
441 Ga0466961_0040907 3300044693 Bacteria 2971
442 Ga0466961_0190679 3300044693 Bacteria 1270
443 Ga0466963_0906651 3300044694 Bacteria 621
444 Ga0466968_0016580 3300044735 Bacteria 2935
445 Ga0466968_0137551 3300044735 Bacteria 1115
446 Ga0466970_0002619 3300044765 Bacteria 8681
447 Ga0466970_0012602 3300044765 Bacteria 4325
448 Ga0466970_0059479 3300044765 Bacteria 2046
449 Ga0466957_0007034 3300044842 Bacteria 6359
450 Ga0466957_0039939 3300044842 Bacteria 2832
451 Ga0466957_0150838 3300044842 Unclassified 1503
452 Ga0466959_0005778 3300045049 Bacteria 8520
453 Ga0466959_0008526 3300045049 Bacteria 7254
454 Ga0466959_0048015 3300045049 Bacteria 3138
455 Ga0466959_0070011 3300045049 Bacteria 2541
456 Ga0466959_0100592 3300045049 Bacteria 2069
457 Ga0466959_0376904 3300045049 Bacteria 966
458 Ga0451576_0673067 3300045051 Bacteria 1087
459 Ga0466958_0005296 3300045836 Bacteria 6921
460 Ga0466958_0079373 3300045836 Unclassified 2018
461 Ga0466958_0331865 3300045836 Bacteria 978
462 Ga0466967_0066737 3300045976 Bacteria 3207
463 Ga0495617_003222 3300046452 Bacteria 6198
464 Ga0495627_008180 3300046453 Bacteria 3937
465 Ga0495592_0002225 3300046454 Bacteria 13688
466 Ga0495603_0030348 3300046455 Bacteria 3256
467 Ga0495603_0046262 3300046455 Bacteria 2593
468 Ga0495590_0080086 3300046457 Bacteria 1150
469 Ga0495638_0011589 3300046460 Bacteria 6074
470 Ga0495638_0435671 3300046460 Bacteria 672
471 Ga0495651_0013966 3300046462 Bacteria 6211
472 Ga0495650_0018771 3300046471 Bacteria 3428
473 Ga0495580_0047649 3300046472 Bacteria 3037
474 Ga0495580_0182139 3300046472 Bacteria 1450
475 Ga0495580_0399003 3300046472 Bacteria 927
476 Ga0495605_0009619 3300046474 Bacteria 5429
477 Ga0495605_0172835 3300046474 Bacteria 954
478 Ga0495584_0159084 3300046491 Bacteria 1148
479 Ga0495594_0805226 3300046499 Bacteria 529
480 Ga0495596_0404284 3300046500 Bacteria 532
481 Ga0495607_0003992 3300046501 Bacteria 11086
482 Ga0495583_0017895 3300046506 Bacteria 3748
483 Ga0495606_0128253 3300046507 Bacteria 1511
484 Ga0495608_0233270 3300046511 Bacteria 1151
485 Ga0495616_0008546 3300046513 Bacteria 6055
486 Ga0495618_0397690 3300046514 Bacteria 843
487 Ga0495628_0061133 3300046516 Bacteria 2954
488 Ga0495630_0978324 3300046517 Bacteria 643
489 Ga0495632_0013141 3300046519 Bacteria 4740
490 Ga0495632_0253038 3300046519 Bacteria 789
491 Ga0495643_0328357 3300046522 Bacteria 690
492 Ga0495644_0102722 3300046523 Bacteria 1082
493 Ga0495648_0056053 3300046524 Bacteria 2373
494 Ga0495663_0001454 3300046525 Bacteria 7467
495 Ga0495663_0003151 3300046525 Bacteria 4809
496 Ga0495663_0006965 3300046525 Bacteria 3118
497 Ga0495663_0144045 3300046525 Bacteria 810
498 Ga0495642_0129201 3300046528 Bacteria 1087
499 Ga0495652_0713977 3300046529 Bacteria 673
500 Ga0495654_0013759 3300046530 Bacteria 4323
501 Ga0495665_0326364 3300046531 Bacteria 783
502 Ga0495587_0050129 3300046536 Bacteria 2470
503 Ga0495609_0014953 3300046538 Bacteria 3641
504 Ga0495621_0107422 3300046539 Bacteria 1067
505 Ga0495597_0218746 3300046542 Bacteria 757
506 Ga0495645_0011752 3300046543 Bacteria 6166
507 Ga0495622_0156788 3300046557 Bacteria 1028
508 Ga0495633_0002319 3300046558 Bacteria 13550
509 Ga0495633_0392788 3300046558 Bacteria 627
510 Ga0495667_0071090 3300046559 Bacteria 2270
511 Ga0495656_0110402 3300046615 Bacteria 1285
512 Ga0495656_0417213 3300046615 Bacteria 704
513 Ga0495668_0163383 3300046616 Bacteria 1220
514 Ga0495668_0213174 3300046616 Bacteria 1057
515 Ga0495668_0770872 3300046616 Bacteria 532
516 Ga0495625_0020420 3300046660 Bacteria 5115
517 Ga0495625_0043325 3300046660 Bacteria 3264
518 Ga0495625_0131372 3300046660 Bacteria 1696
519 Ga0495635_0054146 3300046663 Bacteria 2764
520 Ga0495659_0052725 3300046664 Bacteria 1485
521 Ga0495661_0002545 3300046665 Bacteria 13993
522 Ga0495661_0220140 3300046665 Bacteria 984
523 Ga0495588_0131315 3300046674 Bacteria 1321
524 Ga0495599_0015597 3300046678 Bacteria 4716
525 Ga0495623_0131586 3300046679 Bacteria 1497
526 Ga0495646_0328729 3300046680 Bacteria 804
527 Ga0495669_0011283 3300046684 Bacteria 3792
528 Ga0495670_0273949 3300046691 Bacteria 902
529 Ga0495649_0005932 3300046694 Bacteria 7658
530 Ga0495649_0041294 3300046694 Bacteria 2524
531 Ga0495649_0072591 3300046694 Bacteria 1845
532 Ga0495600_0154182 3300046809 Bacteria 1486
533 Ga0495660_0211114 3300046810 Bacteria 921
534 Ga0495604_0003181 3300047317 Bacteria 13120
535 Ga0495674_0004438 3300047319 Bacteria 13500
536 Ga0495674_0614502 3300047319 Bacteria 860
537 Ga0495672_0029380 3300047320 Bacteria 3462
538 Ga0495680_0035497 3300047322 Bacteria 4015
539 Ga0495683_0013754 3300047323 Bacteria 4225
540 Ga0495683_0341033 3300047323 Bacteria 634
541 Ga0495687_068987 3300047443 Bacteria 1425
542 Ga0495675_0160969 3300047444 Bacteria 1382
543 Ga0495677_0259805 3300047445 Bacteria 680
544 Ga0495673_0016440 3300047469 Bacteria 3782
545 Ga0495681_0002463 3300047470 Bacteria 13207
546 Ga0495684_0291672 3300047471 Bacteria 1174
547 Ga0495602_0040219 3300048088 Bacteria 4292
548 Ga0495615_0089315 3300048090 Bacteria 856
549 Ga0495626_0297573 3300048091 Bacteria 638
550 Ga0496100_0170035 3300048903 Bacteria 1569
551 Ga0496100_0222007 3300048903 Bacteria 1387
552 Ga0496100_0516761 3300048903 Bacteria 921
553 Ga0496101_0047565 3300048904 Bacteria 3080
554 Ga0496101_0270117 3300048904 Bacteria 1327
555 Ga0496101_1559499 3300048904 Bacteria 513
556 Ga0496102_0329157 3300048905 Bacteria 1439
557 Ga0496104_0001998 3300048907 Bacteria 17696
558 Ga0496104_0031337 3300048907 Bacteria 4944
559 Ga0496104_0056798 3300048907 Bacteria 3703
560 Ga0496104_0144181 3300048907 Bacteria 2287
561 Ga0496105_0000273 3300048908 Bacteria 34154
562 Ga0496105_0036399 3300048908 Bacteria 4054
563 Ga0496105_0485746 3300048908 Bacteria 971
564 Ga0496106_0092277 3300048909 Bacteria 2339
565 Ga0496106_0097973 3300048909 Bacteria 2271
566 Ga0496106_0611028 3300048909 Bacteria 873
567 Ga0496106_1310593 3300048909 Bacteria 562
568 Ga0496107_0194645 3300048910 Bacteria 1507
569 Ga0496109_0235182 3300048912 Bacteria 1724
570 Ga0496111_1213658 3300048914 Bacteria 534
571 Ga0496112_0055763 3300048915 Bacteria 3887
572 Ga0496112_1579585 3300048915 Bacteria 569
573 Ga0496113_0065714 3300048916 Bacteria 2746
574 Ga0496113_0083606 3300048916 Bacteria 2449
575 Ga0496114_0067184 3300048917 Bacteria 3007
576 Ga0496114_0943391 3300048917 Bacteria 745
577 Ga0496115_0258584 3300048918 Bacteria 1432
578 Ga0496115_0315331 3300048918 Bacteria 1280
579 Ga0496115_0418158 3300048918 Bacteria 1086
580 Ga0496116_0150245 3300048919 Bacteria 1295
581 Ga0496116_0220999 3300048919 Bacteria 971
582 Ga0496118_0037341 3300048921 Bacteria 3911
583 Ga0496119_0101956 3300048922 Bacteria 1610
584 Ga0496121_0015462 3300048924 Bacteria 7994
585 Ga0496121_0017429 3300048924 Bacteria 7340
586 Ga0496121_0029157 3300048924 Bacteria 5114
587 Ga0496122_0581222 3300048925 Bacteria 527
588 Ga0496123_0086640 3300048926 Bacteria 1877
589 Ga0496124_0334716 3300048927 Bacteria 1078
590 Ga0496124_0786627 3300048927 Bacteria 591
591 Ga0496125_0171819 3300048928 Bacteria 1456
592 Ga0496125_0412315 3300048928 Bacteria 786
593 Ga0496126_0020176 3300048929 Bacteria 6540
594 Ga0496126_0058700 3300048929 Bacteria 3467
595 Ga0496126_0068978 3300048929 Bacteria 3155
596 Ga0496126_0308387 3300048929 Bacteria 1304
597 Ga0496126_0312928 3300048929 Bacteria 1292
598 Ga0496126_0319806 3300048929 Bacteria 1276
599 Ga0496126_0461265 3300048929 Bacteria 1021
600 Ga0495682_0015370 3300049460 Bacteria 2900
601 Ga0501033_0473097 3300049570 Bacteria 869
602 Ga0501036_0778379 3300049572 Bacteria 789
603 Ga0501038_0666857 3300049574 Bacteria 782
604 Ga0501047_0111567 3300049581 Bacteria 2617
605 Ga0501047_0456801 3300049581 Bacteria 1106
606 Ga0501047_0596781 3300049581 Bacteria 926
607 Ga0501073_0547789 3300049589 Bacteria 799
608 Ga0501073_0924066 3300049589 Bacteria 601
609 Ga0501074_0228927 3300049590 Bacteria 1323
610 Ga0501253_098729 3300049683 Bacteria 682
611 Ga0501080_0144322 3300049742 Bacteria 2200
612 Ga0501044_0021138 3300049823 Bacteria 6948
613 Ga0501044_0270015 3300049823 Bacteria 1637
614 nmdc:mga03683_175186_c1 3300050489 Bacteria 976
615 nmdc:mga03683_28674_c1 3300050489 Bacteria 2215
616 nmdc:mga03n38_273943_c1 3300050490 Bacteria 899
617 nmdc:mga03n38_3122_c1 3300050490 Bacteria 5269
618 nmdc:mga00v17_191711_c1 3300050491 Bacteria 1320
619 nmdc:mga00v17_58238_c1 3300050491 Bacteria 2366
620 nmdc:mga0yw44_13300_c1 3300050492 Bacteria 4327
621 nmdc:mga0yw44_15927_c1 3300050492 Bacteria 4045
622 nmdc:mga0yw44_27867_c1 3300050492 Bacteria 3242
623 nmdc:mga0yw44_37622_c1 3300050492 Bacteria 2858
624 nmdc:mga0yw44_70692_c1 3300050492 Bacteria 2165
625 nmdc:mga0k408_117902_c1 3300050493 Bacteria 1571
626 nmdc:mga06z11_14236_c1 3300050494 Bacteria 3518
627 nmdc:mga06z11_15398_c1 3300050494 Bacteria 3413
628 nmdc:mga06z11_58849_c1 3300050494 Bacteria 1995
629 nmdc:mga04h51_17050_c1 3300050495 Bacteria 2117
630 nmdc:mga04h51_37503_c1 3300050495 Bacteria 1565
631 nmdc:mga07m45_5526_c1 3300050496 Bacteria 6301
632 nmdc:mga09592_252034_c1 3300050508 Bacteria 1530
633 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
634 nmdc:mga08y16_76847_c1 3300050511 Bacteria 3480
635 nmdc:mga08x19_140240_c1 3300050514 Bacteria 1632
636 nmdc:mga0sz30_101080_c2 3300050516 Bacteria 960
637 nmdc:mga0sz30_35351_c2 3300050516 Bacteria 1271
638 nmdc:mga0sz30_67386_c1 3300050516 Bacteria 1537
639 Ga0495601_0000379 3300053077 Bacteria 23511
640 Ga0495612_0001697 3300053078 Bacteria 9058
641 Ga0495655_0083124 3300053083 Bacteria 919
642 Ga0495595_0010843 3300053084 Bacteria 3800
643 Ga0495595_0664721 3300053084 Bacteria 533
644 Ga0495619_0005722 3300053085 Bacteria 7884
645 Ga0500643_165727 3300053087 Bacteria 593
646 Ga0500644_0478910 3300053088 Bacteria 547
647 Ga0500644_0485992 3300053088 Unclassified 543
648 Ga0500555_042115 3300053103 Bacteria 1269
649 Ga0500628_136059 3300053129 Bacteria 678
650 Ga0500642_0071449 3300053130 Bacteria 1580
651 Ga0500655_117467 3300053133 Bacteria 563
652 Ga0500577_0131826 3300053142 Bacteria 1048
653 Ga0500604_0002531 3300053151 Bacteria 4987
654 Ga0500616_0000231 3300053153 Bacteria 87444
655 Ga0500616_0091885 3300053153 Bacteria 1501
656 Ga0500645_015755 3300053730 Bacteria 2390
657 Ga0466962_0261216 3300061719 Bacteria 852

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046514 Ga0495618_0397690 Ga0495618_0397690_393_827 143
2 3300049574 Ga0501038_0666857 Ga0501038_0666857_132_587 145
3 iso_pu_bacteria 2919462493 2919465605 147
4 iso_pu_bacteria 2929520902 2929526338 147
5 3300005333 Ga0070677_10098517 Ga0070677_100985172 148
6 3300005353 Ga0070669_100407460 Ga0070669_1004074601 148
7 3300005354 Ga0070675_100055471 Ga0070675_1000554711 148
8 3300005367 Ga0070667_100076083 Ga0070667_1000760834 148
9 3300005438 Ga0070701_11012170 Ga0070701_110121701 148
10 3300005459 Ga0068867_100161280 Ga0068867_1001612801 148
11 3300005543 Ga0070672_100058890 Ga0070672_1000588902 148
12 3300005617 Ga0068859_100218559 Ga0068859_1002185593 148
13 3300005719 Ga0068861_101096342 Ga0068861_1010963422 148
14 3300005840 Ga0068870_10224425 Ga0068870_102244252 148
15 3300006931 Ga0097620_100218568 Ga0097620_1002185683 148
16 3300009011 Ga0105251_10219096 Ga0105251_102190962 148
17 3300009553 Ga0105249_10384842 Ga0105249_103848422 148
18 3300014326 Ga0157380_10140437 Ga0157380_101404373 148
19 3300025893 Ga0207682_10075318 Ga0207682_100753181 148
20 3300025933 Ga0207706_10070521 Ga0207706_100705215 148
21 3300025940 Ga0207691_10081903 Ga0207691_100819032 148
22 3300025960 Ga0207651_10026070 Ga0207651_100260703 148
23 3300025972 Ga0207668_10501411 Ga0207668_105014112 148
24 3300025986 Ga0207658_10885829 Ga0207658_108858292 148
25 3300026089 Ga0207648_10116615 Ga0207648_101166153 148
26 3300026118 Ga0207675_100783549 Ga0207675_1007835492 148
27 3300026121 Ga0207683_10091351 Ga0207683_100913511 148
28 3300031548 Ga0307408_100822667 Ga0307408_1008226672 148
29 3300031824 Ga0307413_11570608 Ga0307413_115706081 148
30 3300031852 Ga0307410_10114355 Ga0307410_101143552 148
31 3300031901 Ga0307406_10800219 Ga0307406_108002191 148
32 3300032005 Ga0307411_10122472 Ga0307411_101224721 148
33 3300046455 Ga0495603_0030348 Ga0495603_0030348_2611_3069 148
34 3300046472 Ga0495580_0047649 Ga0495580_0047649_2140_2598 148
35 3300046472 Ga0495580_0182139 Ga0495580_0182139_590_1048 148
36 3300046472 Ga0495580_0399003 Ga0495580_0399003_272_730 148
37 3300046474 Ga0495605_0009619 Ga0495605_0009619_1802_2260 148
38 3300046506 Ga0495583_0017895 Ga0495583_0017895_971_1429 148
39 3300046513 Ga0495616_0008546 Ga0495616_0008546_5333_5791 148
40 3300046531 Ga0495665_0326364 Ga0495665_0326364_177_635 148
41 3300046539 Ga0495621_0107422 Ga0495621_0107422_458_949 148
42 3300046694 Ga0495649_0072591 Ga0495649_0072591_1350_1808 148
43 3300047319 Ga0495674_0004438 Ga0495674_0004438_6188_6646 148
44 3300047320 Ga0495672_0029380 Ga0495672_0029380_218_676 148
45 3300047323 Ga0495683_0013754 Ga0495683_0013754_230_688 148
46 3300047443 Ga0495687_068987 Ga0495687_068987_298_756 148
47 3300047445 Ga0495677_0259805 Ga0495677_0259805_133_591 148
48 3300047469 Ga0495673_0016440 Ga0495673_0016440_794_1252 148
49 3300048904 Ga0496101_0270117 Ga0496101_0270117_240_698 148
50 3300048907 Ga0496104_0031337 Ga0496104_0031337_552_1010 148
51 3300048907 Ga0496104_0144181 Ga0496104_0144181_1650_2108 148
52 3300048908 Ga0496105_0036399 Ga0496105_0036399_1012_1470 148
53 3300048909 Ga0496106_0611028 Ga0496106_0611028_393_851 148
54 3300048915 Ga0496112_0055763 Ga0496112_0055763_2783_3241 148
55 3300048916 Ga0496113_0083606 Ga0496113_0083606_216_674 148
56 3300048918 Ga0496115_0418158 Ga0496115_0418158_433_891 148
57 3300048919 Ga0496116_0220999 Ga0496116_0220999_73_531 148
58 3300048924 Ga0496121_0015462 Ga0496121_0015462_5695_6153 148
59 3300049460 Ga0495682_0015370 Ga0495682_0015370_761_1219 148
60 3300053078 Ga0495612_0001697 Ga0495612_0001697_8356_8805 148
61 iso_pu_bacteria 2643221621 2644124153 148
62 iso_pu_bacteria 2643221688 2644492854 148
63 iso_pu_bacteria 2791355199 2793079110 148
64 iso_pu_bacteria 2808606384 2808970475 148
65 iso_pu_bacteria 2808606390 2809005418 148
66 iso_pu_bacteria 2808606391 2809012181 148
67 3300003322 rootL2_10103187 rootL2_101031874 149
68 3300003781 Ga0055536_1007742 Ga0055536_10077422 149
69 3300003856 Ga0058692_1000001 Ga0058692_1000001220 149
70 3300005272 Ga0065703_1000131 Ga0065703_10001313 149
71 3300005289 Ga0065704_10143141 Ga0065704_101431411 149
72 3300005347 Ga0070668_100072369 Ga0070668_1000723693 149
73 3300005436 Ga0070713_101234426 Ga0070713_1012344261 149
74 3300005457 Ga0070662_100594683 Ga0070662_1005946831 149
75 3300005473 Ga0074250_10309 Ga0074250_103093 149
76 3300005844 Ga0068862_100838924 Ga0068862_1008389242 149
77 3300006028 Ga0070717_10271232 Ga0070717_102712322 149
78 3300006943 Ga0099822_1001480 Ga0099822_100148010 149
79 3300009011 Ga0105251_10377892 Ga0105251_103778921 149
80 3300009036 Ga0105244_10003674 Ga0105244_1000367410 149
81 3300009092 Ga0105250_10002955 Ga0105250_100029554 149
82 3300009148 Ga0105243_10000266 Ga0105243_1000026657 149
83 3300009148 Ga0105243_10509428 Ga0105243_105094282 149
84 3300012502 Ga0157347_1004269 Ga0157347_10042692 149
85 3300013104 Ga0157370_10375663 Ga0157370_103756633 149
86 3300013104 Ga0157370_10375665 Ga0157370_103756653 149
87 3300025711 Ga0207696_1002904 Ga0207696_10029048 149
88 3300025728 Ga0207655_1000353 Ga0207655_100035330 149
89 3300025735 Ga0207713_1010634 Ga0207713_10106345 149
90 3300025898 Ga0207692_10456035 Ga0207692_104560352 149
91 3300025910 Ga0207684_10644341 Ga0207684_106443411 149
92 3300025935 Ga0207709_10000001 Ga0207709_10000001594 149
93 3300027312 Ga0209371_1000008 Ga0209371_1000008352 149
94 3300030500 Ga0268256_1000009 Ga0268256_1000009352 149
95 3300031548 Ga0307408_100068556 Ga0307408_1000685563 149
96 3300031731 Ga0307405_10204225 Ga0307405_102042252 149
97 3300031824 Ga0307413_10035168 Ga0307413_100351684 149
98 3300031852 Ga0307410_10158694 Ga0307410_101586941 149
99 3300031911 Ga0307412_11449999 Ga0307412_114499991 149
100 3300031995 Ga0307409_100657915 Ga0307409_1006579152 149
101 3300031995 Ga0307409_101230461 Ga0307409_1012304611 149
102 3300032126 Ga0307415_101092084 Ga0307415_1010920841 149
103 3300033180 Ga0307510_10021950 Ga0307510_100219503 149
104 3300037466 Ga0395898_0192576 Ga0395898_0192576_601_1053 149
105 3300037471 Ga0395905_0211175 Ga0395905_0211175_198_650 149
106 3300038443 Ga0395901_0090246 Ga0395901_0090246_854_1306 149
107 3300044684 Ga0466966_0027387 Ga0466966_0027387_303_764 149
108 3300045049 Ga0466959_0376904 Ga0466959_0376904_399_860 149
109 3300045836 Ga0466958_0331865 Ga0466958_0331865_53_514 149
110 3300046453 Ga0495627_008180 Ga0495627_008180_2470_2919 149
111 3300046501 Ga0495607_0003992 Ga0495607_0003992_3806_4255 149
112 3300046519 Ga0495632_0013141 Ga0495632_0013141_53_502 149
113 3300046519 Ga0495632_0253038 Ga0495632_0253038_288_737 149
114 3300046525 Ga0495663_0001454 Ga0495663_0001454_4012_4461 149
115 3300046525 Ga0495663_0003151 Ga0495663_0003151_2473_2922 149
116 3300046525 Ga0495663_0006965 Ga0495663_0006965_1204_1653 149
117 3300046530 Ga0495654_0013759 Ga0495654_0013759_16_465 149
118 3300046558 Ga0495633_0002319 Ga0495633_0002319_11668_12117 149
119 3300046665 Ga0495661_0002545 Ga0495661_0002545_11648_12097 149
120 3300046674 Ga0495588_0131315 Ga0495588_0131315_109_570 149
121 3300046694 Ga0495649_0005932 Ga0495649_0005932_275_724 149
122 3300047470 Ga0495681_0002463 Ga0495681_0002463_2263_2712 149
123 3300048090 Ga0495615_0089315 Ga0495615_0089315_171_620 149
124 3300048914 Ga0496111_1213658 Ga0496111_1213658_40_489 149
125 3300048917 Ga0496114_0067184 Ga0496114_0067184_2075_2524 149
126 3300049683 Ga0501253_098729 Ga0501253_098729_42_503 149
127 3300050491 nmdc:mga00v17_191711_c1 nmdc:mga00v17_191711_c1_468_917 149
128 iso_pu_bacteria 2513237102 2513700626 149
129 iso_pu_bacteria 2515154112 2515628898 149
130 iso_pu_bacteria 2617270735 2617352900 149
131 iso_pu_bacteria 2617270741 2617376428 149
132 iso_pu_bacteria 2791355196 2793063997 149
133 iso_pu_bacteria 2824617872 2824619877 149
134 iso_pu_bacteria 2824626560 2824629485 149
135 iso_pu_bacteria 2824635225 2824637126 149
136 iso_pu_bacteria 2824644064 2824650451 149
137 iso_pu_bacteria 2824714736 2824720979 149
138 iso_pu_bacteria 2824723954 2824730349 149
139 iso_pu_bacteria 2824732956 2824738399 149
140 iso_pu_bacteria 2847930680 2847935310 149
141 iso_pu_bacteria 2849076700 2849079971 149
142 iso_pu_bacteria 2857509624 2857510675 149
143 iso_pu_bacteria 2874628541 2874631100 149
144 iso_pu_bacteria 2879083081 2879088946 149
145 iso_pu_bacteria 2881364244 2881366740 149
146 iso_pu_bacteria 2888419890 2888423767 149
147 iso_pu_bacteria 2908775508 2908779468 149
148 iso_pu_bacteria 2935975950 2935980994 149
149 iso_pu_bacteria 8019619141 8019627388 149
150 iso_pu_bacteria 8019629233 8019635187 149
151 iso_pu_bacteria 8019659431 8019663029 149
152 iso_pu_bacteria 8019668869 8019672627 149
153 iso_pu_bacteria 8019678201 8019683533 149
154 3300003781 Ga0055536_1006143 Ga0055536_10061431 150
155 3300003791 Ga0055530_10002071 Ga0055530_1000207112 150
156 3300005366 Ga0070659_100314000 Ga0070659_1003140002 150
157 3300005548 Ga0070665_100818314 Ga0070665_1008183142 150
158 3300005615 Ga0070702_100507423 Ga0070702_1005074232 150
159 3300006178 Ga0075367_10065291 Ga0075367_100652912 150
160 3300010375 Ga0105239_12403338 Ga0105239_124033382 150
161 3300013306 Ga0163162_10536128 Ga0163162_105361282 150
162 3300014969 Ga0157376_12740164 Ga0157376_127401641 150
163 3300025298 Ga0209050_1000829 Ga0209050_100082932 150
164 3300025303 Ga0209051_1005795 Ga0209051_10057953 150
165 3300025304 Ga0209257_1006755 Ga0209257_10067554 150
166 3300028379 Ga0268266_10959847 Ga0268266_109598471 150
167 3300037466 Ga0395898_0240966 Ga0395898_0240966_360_812 150
168 3300037471 Ga0395905_0145461 Ga0395905_0145461_798_1250 150
169 3300041512 Ga0451853_0116443 Ga0451853_0116443_73_528 150
170 3300044735 Ga0466968_0016580 Ga0466968_0016580_2218_2673 150
171 3300048909 Ga0496106_1310593 Ga0496106_1310593_35_490 150
172 3300048928 Ga0496125_0412315 Ga0496125_0412315_80_535 150
173 3300050492 nmdc:mga0yw44_13300_c1 nmdc:mga0yw44_13300_c1_394_849 150
174 3300050494 nmdc:mga06z11_14236_c1 nmdc:mga06z11_14236_c1_2338_2793 150
175 3300053153 Ga0500616_0091885 Ga0500616_0091885_692_1147 150
176 iso_pu_bacteria 2508501042 2508698871 150
177 iso_pu_bacteria 2513237098 2513676999 150
178 iso_pu_bacteria 2903768456 2903769215 150
179 iso_pu_bacteria 2933577622 2933580362 150
180 iso_pu_bacteria 2935648319 2935651877 150
181 iso_pu_bacteria 2935656913 2935660687 150
182 iso_pu_bacteria 2935908558 2935914059 150
183 iso_pu_bacteria 2935916978 2935921228 150
184 iso_pu_bacteria 2935926038 2935931752 150
185 iso_pu_bacteria 2935934488 2935940313 150
186 iso_pu_bacteria 2935942939 2935947862 150
187 iso_pu_bacteria 2935951376 2935956597 150
188 iso_pu_bacteria 2935967501 2935973390 150
189 iso_pu_bacteria 2935984226 2935989554 150
190 iso_pu_bacteria 2936011229 2936014743 150
191 iso_pu_bacteria 2936019824 2936023460 150
192 iso_pu_bacteria 2936028420 2936032488 150
193 iso_pu_bacteria 2936046547 2936050484 150
194 iso_pu_bacteria 2936055302 2936059024 150
195 iso_pu_bacteria 8016630954 8016631751 150
196 iso_pu_bacteria 8019687851 8019689278 150
197 iso_pu_bacteria 8055742211 8055742777 150
198 3300002987 JGI25159J45721_1024677 JGI25159J45721_10246772 151
199 3300003215 JGI25153J46596_10001083 JGI25153J46596_100010836 151
200 3300003354 JGI25160J50197_1000042 JGI25160J50197_1000042151 151
201 3300003354 JGI25160J50197_1000866 JGI25160J50197_100086626 151
202 3300003354 JGI25160J50197_1006131 JGI25160J50197_10061312 151
203 3300003374 JGI25161J50226_1000305 JGI25161J50226_100030526 151
204 3300003374 JGI25161J50226_1001004 JGI25161J50226_100100414 151
205 3300003771 Ga0055526_1010501 Ga0055526_10105019 151
206 3300003781 Ga0055536_1017623 Ga0055536_10176234 151
207 3300003781 Ga0055536_1076350 Ga0055536_10763501 151
208 3300003792 Ga0055540_1030767 Ga0055540_10307672 151
209 3300003794 Ga0055531_10009625 Ga0055531_100096254 151
210 3300003794 Ga0055531_10010201 Ga0055531_100102013 151
211 3300003794 Ga0055531_10032714 Ga0055531_100327143 151
212 3300003794 Ga0055531_10063562 Ga0055531_100635622 151
213 3300003794 Ga0055531_10097207 Ga0055531_100972071 151
214 3300004625 Ga0055543_1004885 Ga0055543_10048851 151
215 3300004625 Ga0055543_1009945 Ga0055543_10099451 151
216 3300005262 Ga0065165_1000174 Ga0065165_10001741 151
217 3300005262 Ga0065165_1002379 Ga0065165_100237926 151
218 3300005328 Ga0070676_10328699 Ga0070676_103286992 151
219 3300005334 Ga0068869_100275724 Ga0068869_1002757243 151
220 3300005347 Ga0070668_100740222 Ga0070668_1007402222 151
221 3300005355 Ga0070671_100162396 Ga0070671_1001623962 151
222 3300005356 Ga0070674_100606065 Ga0070674_1006060652 151
223 3300005434 Ga0070709_10650413 Ga0070709_106504131 151
224 3300005437 Ga0070710_10201708 Ga0070710_102017083 151
225 3300005439 Ga0070711_100021672 Ga0070711_1000216725 151
226 3300005455 Ga0070663_100010319 Ga0070663_1000103194 151
227 3300005456 Ga0070678_100558792 Ga0070678_1005587922 151
228 3300005466 Ga0070685_10104337 Ga0070685_101043371 151
229 3300005530 Ga0070679_101368979 Ga0070679_1013689791 151
230 3300005543 Ga0070672_100355511 Ga0070672_1003555111 151
231 3300005546 Ga0070696_100257861 Ga0070696_1002578613 151
232 3300005548 Ga0070665_100090619 Ga0070665_1000906191 151
233 3300005578 Ga0068854_100181619 Ga0068854_1001816192 151
234 3300005578 Ga0068854_100312121 Ga0068854_1003121212 151
235 3300005614 Ga0068856_101644676 Ga0068856_1016446762 151
236 3300005615 Ga0070702_100198571 Ga0070702_1001985712 151
237 3300005719 Ga0068861_100372557 Ga0068861_1003725572 151
238 3300005843 Ga0068860_100611825 Ga0068860_1006118252 151
239 3300005844 Ga0068862_100263365 Ga0068862_1002633654 151
240 3300005937 Ga0081455_10008875 Ga0081455_100088758 151
241 3300005983 Ga0081540_1025746 Ga0081540_10257462 151
242 3300005983 Ga0081540_1069324 Ga0081540_10693242 151
243 3300006038 Ga0075365_10021797 Ga0075365_100217972 151
244 3300006038 Ga0075365_10259007 Ga0075365_102590072 151
245 3300006038 Ga0075365_10273586 Ga0075365_102735862 151
246 3300006042 Ga0075368_10007588 Ga0075368_100075884 151
247 3300006048 Ga0075363_100286802 Ga0075363_1002868022 151
248 3300006051 Ga0075364_10068084 Ga0075364_100680842 151
249 3300006175 Ga0070712_100232157 Ga0070712_1002321573 151
250 3300006177 Ga0075362_10072044 Ga0075362_100720442 151
251 3300006178 Ga0075367_10009129 Ga0075367_100091292 151
252 3300006186 Ga0075369_10407673 Ga0075369_104076731 151
253 3300006195 Ga0075366_10124393 Ga0075366_101243932 151
254 3300006353 Ga0075370_10016633 Ga0075370_100166333 151
255 3300006358 Ga0068871_101621804 Ga0068871_1016218041 151
256 3300006844 Ga0075428_100005277 Ga0075428_1000052773 151
257 3300006846 Ga0075430_100166379 Ga0075430_1001663793 151
258 3300006846 Ga0075430_100251539 Ga0075430_1002515392 151
259 3300007788 Ga0099795_10059300 Ga0099795_100593002 151
260 3300009093 Ga0105240_11082850 Ga0105240_110828501 151
261 3300009094 Ga0111539_10000616 Ga0111539_1000061635 151
262 3300009094 Ga0111539_10038859 Ga0111539_100388594 151
263 3300009098 Ga0105245_10167231 Ga0105245_101672313 151
264 3300009098 Ga0105245_11825840 Ga0105245_118258401 151
265 3300009147 Ga0114129_10294342 Ga0114129_102943421 151
266 3300009177 Ga0105248_10044933 Ga0105248_100449333 151
267 3300009177 Ga0105248_10770113 Ga0105248_107701131 151
268 3300009545 Ga0105237_10401732 Ga0105237_104017322 151
269 3300009545 Ga0105237_10571391 Ga0105237_105713912 151
270 3300009551 Ga0105238_10232064 Ga0105238_102320643 151
271 3300009986 Ga0105033_103627 Ga0105033_1036272 151
272 3300010375 Ga0105239_10114797 Ga0105239_101147972 151
273 3300011119 Ga0105246_10035339 Ga0105246_100353394 151
274 3300012497 Ga0157319_1018736 Ga0157319_10187361 151
275 3300013296 Ga0157374_10321643 Ga0157374_103216434 151
276 3300013297 Ga0157378_10139282 Ga0157378_101392823 151
277 3300013306 Ga0163162_10314987 Ga0163162_103149872 151
278 3300013306 Ga0163162_10321431 Ga0163162_103214312 151
279 3300014325 Ga0163163_11675239 Ga0163163_116752391 151
280 3300014968 Ga0157379_10606445 Ga0157379_106064452 151
281 3300020070 Ga0206356_11226433 Ga0206356_112264331 151
282 3300025208 Ga0209436_100151 Ga0209436_10015129 151
283 3300025245 Ga0207425_1029235 Ga0207425_10292351 151
284 3300025263 Ga0209565_1014942 Ga0209565_10149422 151
285 3300025273 Ga0209673_1066743 Ga0209673_10667431 151
286 3300025284 Ga0209130_1000054 Ga0209130_1000054172 151
287 3300025284 Ga0209130_1000075 Ga0209130_1000075152 151
288 3300025284 Ga0209130_1000304 Ga0209130_100030419 151
289 3300025291 Ga0209675_1009191 Ga0209675_10091912 151
290 3300025291 Ga0209675_1068308 Ga0209675_10683081 151
291 3300025292 Ga0209676_1001001 Ga0209676_100100132 151
292 3300025292 Ga0209676_1013489 Ga0209676_10134896 151
293 3300025292 Ga0209676_1022145 Ga0209676_10221452 151
294 3300025292 Ga0209676_1042456 Ga0209676_10424561 151
295 3300025294 Ga0209025_1003491 Ga0209025_100349118 151
296 3300025294 Ga0209025_1005830 Ga0209025_10058304 151
297 3300025295 Ga0209564_1000869 Ga0209564_100086937 151
298 3300025297 Ga0209758_1035436 Ga0209758_10354363 151
299 3300025298 Ga0209050_1008936 Ga0209050_10089364 151
300 3300025299 Ga0209256_1000951 Ga0209256_100095125 151
301 3300025302 Ga0207426_1000127 Ga0207426_1000127172 151
302 3300025302 Ga0207426_1000141 Ga0207426_1000141119 151
303 3300025302 Ga0207426_1000163 Ga0207426_1000163152 151
304 3300025303 Ga0209051_1003765 Ga0209051_10037653 151
305 3300025303 Ga0209051_1050873 Ga0209051_10508732 151
306 3300025304 Ga0209257_1002128 Ga0209257_10021284 151
307 3300025304 Ga0209257_1013823 Ga0209257_10138234 151
308 3300025304 Ga0209257_1056450 Ga0209257_10564502 151
309 3300025898 Ga0207692_10338185 Ga0207692_103381851 151
310 3300025899 Ga0207642_10020311 Ga0207642_100203112 151
311 3300025906 Ga0207699_10659853 Ga0207699_106598532 151
312 3300025907 Ga0207645_10224793 Ga0207645_102247933 151
313 3300025916 Ga0207663_10017262 Ga0207663_100172623 151
314 3300025927 Ga0207687_10048099 Ga0207687_100480997 151
315 3300025928 Ga0207700_10691526 Ga0207700_106915261 151
316 3300025931 Ga0207644_10236839 Ga0207644_102368392 151
317 3300025933 Ga0207706_10093854 Ga0207706_100938544 151
318 3300025937 Ga0207669_10095538 Ga0207669_100955382 151
319 3300025940 Ga0207691_10351200 Ga0207691_103512003 151
320 3300025941 Ga0207711_10014773 Ga0207711_100147735 151
321 3300025972 Ga0207668_10061259 Ga0207668_100612591 151
322 3300025972 Ga0207668_10253973 Ga0207668_102539733 151
323 3300025981 Ga0207640_10188773 Ga0207640_101887732 151
324 3300026035 Ga0207703_10658188 Ga0207703_106581882 151
325 3300026067 Ga0207678_10015102 Ga0207678_100151023 151
326 3300026118 Ga0207675_100182160 Ga0207675_1001821603 151
327 3300026142 Ga0207698_10286246 Ga0207698_102862464 151
328 3300027111 Ga0209281_1001247 Ga0209281_10012476 151
329 3300027866 Ga0209813_10031533 Ga0209813_100315332 151
330 3300027907 Ga0207428_10000129 Ga0207428_1000012967 151
331 3300027907 Ga0207428_10292680 Ga0207428_102926802 151
332 3300028379 Ga0268266_10004234 Ga0268266_100042342 151
333 3300028381 Ga0268264_10303587 Ga0268264_103035872 151
334 3300031911 Ga0307412_10015743 Ga0307412_100157437 151
335 3300033180 Ga0307510_10110805 Ga0307510_101108053 151
336 3300034957 Ga0373938_0166361 Ga0373938_0166361_26_481 151
337 3300037312 Ga0395899_0203784 Ga0395899_0203784_912_1367 151
338 3300037418 Ga0395900_0078574 Ga0395900_0078574_1416_1871 151
339 3300038443 Ga0395901_0671761 Ga0395901_0671761_95_550 151
340 3300038443 Ga0395901_0688838 Ga0395901_0688838_18_473 151
341 3300039450 Ga0436363_0870267 Ga0436363_0870267_494_958 151
342 3300041411 Ga0439466_0031676 Ga0439466_0031676_201_656 151
343 3300041413 Ga0439465_0021404 Ga0439465_0021404_201_656 151
344 3300042007 Ga0439449_0114735 Ga0439449_0114735_531_986 151
345 3300042015 Ga0439462_0091124 Ga0439462_0091124_344_799 151
346 3300042122 Ga0450920_037838 Ga0450920_037838_135_590 151
347 3300042435 Ga0439434_0209834 Ga0439434_0209834_42_497 151
348 3300045051 Ga0451576_0673067 Ga0451576_0673067_191_646 151
349 3300046491 Ga0495584_0159084 Ga0495584_0159084_244_699 151
350 3300046660 Ga0495625_0020420 Ga0495625_0020420_1118_1573 151
351 3300046664 Ga0495659_0052725 Ga0495659_0052725_123_578 151
352 3300046691 Ga0495670_0273949 Ga0495670_0273949_107_562 151
353 3300048903 Ga0496100_0170035 Ga0496100_0170035_1069_1524 151
354 3300048903 Ga0496100_0222007 Ga0496100_0222007_243_698 151
355 3300048904 Ga0496101_1559499 Ga0496101_1559499_18_473 151
356 3300048907 Ga0496104_0056798 Ga0496104_0056798_3232_3687 151
357 3300048908 Ga0496105_0485746 Ga0496105_0485746_488_943 151
358 3300048909 Ga0496106_0092277 Ga0496106_0092277_1856_2311 151
359 3300048909 Ga0496106_0097973 Ga0496106_0097973_444_899 151
360 3300048912 Ga0496109_0235182 Ga0496109_0235182_973_1428 151
361 3300048915 Ga0496112_1579585 Ga0496112_1579585_21_476 151
362 3300048916 Ga0496113_0065714 Ga0496113_0065714_385_840 151
363 3300048917 Ga0496114_0943391 Ga0496114_0943391_122_577 151
364 3300048919 Ga0496116_0150245 Ga0496116_0150245_67_522 151
365 3300048921 Ga0496118_0037341 Ga0496118_0037341_1046_1501 151
366 3300048925 Ga0496122_0581222 Ga0496122_0581222_29_484 151
367 3300048926 Ga0496123_0086640 Ga0496123_0086640_941_1396 151
368 3300048929 Ga0496126_0058700 Ga0496126_0058700_840_1295 151
369 3300048929 Ga0496126_0461265 Ga0496126_0461265_166_621 151
370 3300050489 nmdc:mga03683_28674_c1 nmdc:mga03683_28674_c1_769_1224 151
371 3300050490 nmdc:mga03n38_3122_c1 nmdc:mga03n38_3122_c1_2474_2929 151
372 3300050491 nmdc:mga00v17_58238_c1 nmdc:mga00v17_58238_c1_1213_1668 151
373 3300050492 nmdc:mga0yw44_15927_c1 nmdc:mga0yw44_15927_c1_2463_2918 151
374 3300050494 nmdc:mga06z11_15398_c1 nmdc:mga06z11_15398_c1_146_601 151
375 3300050495 nmdc:mga04h51_37503_c1 nmdc:mga04h51_37503_c1_819_1274 151
376 3300050496 nmdc:mga07m45_5526_c1 nmdc:mga07m45_5526_c1_1183_1638 151
377 3300050508 nmdc:mga09592_252034_c1 nmdc:mga09592_252034_c1_530_985 151
378 3300050511 nmdc:mga08y16_51_c1 nmdc:mga08y16_51_c1_29916_30371 151
379 3300050511 nmdc:mga08y16_76847_c1 nmdc:mga08y16_76847_c1_1924_2379 151
380 3300050514 nmdc:mga08x19_140240_c1 nmdc:mga08x19_140240_c1_853_1308 151
381 3300050516 nmdc:mga0sz30_35351_c2 nmdc:mga0sz30_35351_c2_146_601 151
382 3300053088 Ga0500644_0485992 Ga0500644_0485992_24_479 151
383 3300053153 Ga0500616_0000231 Ga0500616_0000231_12606_13061 151
384 iso_pu_bacteria 2842038055 2842039713 151
385 iso_pu_bacteria 2842045827 2842047341 151
386 3300002741 JGI25157J39369_1000188 JGI25157J39369_100018823 152
387 3300003794 Ga0055531_10017573 Ga0055531_100175735 152
388 3300005367 Ga0070667_101509436 Ga0070667_1015094361 152
389 3300005434 Ga0070709_10125212 Ga0070709_101252122 152
390 3300005436 Ga0070713_100039260 Ga0070713_1000392605 152
391 3300005437 Ga0070710_10039060 Ga0070710_100390603 152
392 3300005439 Ga0070711_100114383 Ga0070711_1001143831 152
393 3300006028 Ga0070717_10294822 Ga0070717_102948222 152
394 3300006175 Ga0070712_100242366 Ga0070712_1002423662 152
395 3300006178 Ga0075367_10397203 Ga0075367_103972031 152
396 3300025250 Ga0209026_1000070 Ga0209026_100007050 152
397 3300025256 Ga0209759_1000293 Ga0209759_100029323 152
398 3300025304 Ga0209257_1000846 Ga0209257_100084613 152
399 3300025906 Ga0207699_10157918 Ga0207699_101579182 152
400 3300025915 Ga0207693_10016626 Ga0207693_100166267 152
401 3300025915 Ga0207693_10423993 Ga0207693_104239932 152
402 3300025916 Ga0207663_10060620 Ga0207663_100606204 152
403 3300025916 Ga0207663_10104535 Ga0207663_101045351 152
404 3300025928 Ga0207700_10056696 Ga0207700_100566964 152
405 3300025929 Ga0207664_10800973 Ga0207664_108009731 152
406 3300025939 Ga0207665_10353162 Ga0207665_103531622 152
407 3300031241 Ga0265325_10000105 Ga0265325_100001054 152
408 3300031456 Ga0307513_10100903 Ga0307513_101009033 152
409 3300035086 Ga0373934_0051305 Ga0373934_0051305_833_1294 152
410 3300035117 Ga0373953_0009557 Ga0373953_0009557_22_483 152
411 3300035118 Ga0373954_0087805 Ga0373954_0087805_12_473 152
412 3300035119 Ga0373956_0009924 Ga0373956_0009924_2660_3121 152
413 3300035120 Ga0373957_0008716 Ga0373957_0008716_659_1120 152
414 3300035170 Ga0373943_0792030 Ga0373943_0792030_32_493 152
415 3300035171 Ga0373946_0073638 Ga0373946_0073638_728_1189 152
416 3300035172 Ga0373955_0141191 Ga0373955_0141191_690_1151 152
417 3300035692 Ga0373935_0104971 Ga0373935_0104971_1272_1733 152
418 3300035695 Ga0373927_0227925 Ga0373927_0227925_531_992 152
419 3300035724 Ga0373933_0052122 Ga0373933_0052122_943_1404 152
420 3300035725 Ga0373947_0290077 Ga0373947_0290077_145_606 152
421 3300036401 Ga0373937_0106404 Ga0373937_0106404_121_582 152
422 3300037068 Ga0373925_0023713 Ga0373925_0023713_637_1098 152
423 3300044656 Ga0466969_0014849 Ga0466969_0014849_1649_2110 152
424 3300044656 Ga0466969_0500522 Ga0466969_0500522_52_513 152
425 3300044683 Ga0466965_0204621 Ga0466965_0204621_424_882 152
426 3300044684 Ga0466966_0041116 Ga0466966_0041116_531_992 152
427 3300044693 Ga0466961_0002159 Ga0466961_0002159_1609_2070 152
428 3300044693 Ga0466961_0040907 Ga0466961_0040907_1980_2441 152
429 3300044765 Ga0466970_0002619 Ga0466970_0002619_5794_6255 152
430 3300044765 Ga0466970_0012602 Ga0466970_0012602_3334_3795 152
431 3300044842 Ga0466957_0007034 Ga0466957_0007034_2090_2551 152
432 3300044842 Ga0466957_0150838 Ga0466957_0150838_14_472 152
433 3300045049 Ga0466959_0048015 Ga0466959_0048015_1050_1511 152
434 3300045049 Ga0466959_0070011 Ga0466959_0070011_101_562 152
435 3300045836 Ga0466958_0079373 Ga0466958_0079373_1257_1715 152
436 3300045976 Ga0466967_0066737 Ga0466967_0066737_2092_2553 152
437 3300046454 Ga0495592_0002225 Ga0495592_0002225_10112_10573 152
438 3300046462 Ga0495651_0013966 Ga0495651_0013966_5700_6161 152
439 3300046511 Ga0495608_0233270 Ga0495608_0233270_74_535 152
440 3300046516 Ga0495628_0061133 Ga0495628_0061133_88_549 152
441 3300046517 Ga0495630_0978324 Ga0495630_0978324_111_572 152
442 3300046529 Ga0495652_0713977 Ga0495652_0713977_117_578 152
443 3300046536 Ga0495587_0050129 Ga0495587_0050129_382_843 152
444 3300046543 Ga0495645_0011752 Ga0495645_0011752_3922_4383 152
445 3300046559 Ga0495667_0071090 Ga0495667_0071090_814_1275 152
446 3300046616 Ga0495668_0163383 Ga0495668_0163383_303_779 152
447 3300046663 Ga0495635_0054146 Ga0495635_0054146_1531_1992 152
448 3300046678 Ga0495599_0015597 Ga0495599_0015597_2053_2514 152
449 3300046679 Ga0495623_0131586 Ga0495623_0131586_637_1098 152
450 3300046680 Ga0495646_0328729 Ga0495646_0328729_249_710 152
451 3300046809 Ga0495600_0154182 Ga0495600_0154182_186_647 152
452 3300047317 Ga0495604_0003181 Ga0495604_0003181_6344_6805 152
453 3300047319 Ga0495674_0614502 Ga0495674_0614502_203_664 152
454 3300047322 Ga0495680_0035497 Ga0495680_0035497_1368_1829 152
455 3300047444 Ga0495675_0160969 Ga0495675_0160969_83_544 152
456 3300047471 Ga0495684_0291672 Ga0495684_0291672_114_575 152
457 3300048088 Ga0495602_0040219 Ga0495602_0040219_1851_2312 152
458 3300048907 Ga0496104_0001998 Ga0496104_0001998_2900_3361 152
459 3300048908 Ga0496105_0000273 Ga0496105_0000273_29970_30431 152
460 3300049589 Ga0501073_0924066 Ga0501073_0924066_32_493 152
461 3300053077 Ga0495601_0000379 Ga0495601_0000379_3900_4361 152
462 3300053084 Ga0495595_0010843 Ga0495595_0010843_3096_3557 152
463 3300053084 Ga0495595_0664721 Ga0495595_0664721_27_488 152
464 3300053085 Ga0495619_0005722 Ga0495619_0005722_3171_3632 152
465 3300053151 Ga0500604_0002531 Ga0500604_0002531_4275_4751 152
466 3300061719 Ga0466962_0261216 Ga0466962_0261216_97_558 152
467 3300002244 JGI24742J22300_10048254 JGI24742J22300_100482541 153
468 3300003354 JGI25160J50197_1012996 JGI25160J50197_10129963 153
469 3300004625 Ga0055543_1000931 Ga0055543_100093111 153
470 3300005262 Ga0065165_1001608 Ga0065165_100160820 153
471 3300005262 Ga0065165_1001780 Ga0065165_10017807 153
472 3300005327 Ga0070658_10230563 Ga0070658_102305633 153
473 3300005334 Ga0068869_100479023 Ga0068869_1004790231 153
474 3300005336 Ga0070680_100060330 Ga0070680_1000603303 153
475 3300005337 Ga0070682_100452345 Ga0070682_1004523451 153
476 3300005340 Ga0070689_100177492 Ga0070689_1001774924 153
477 3300005347 Ga0070668_100011183 Ga0070668_1000111833 153
478 3300005347 Ga0070668_100324292 Ga0070668_1003242923 153
479 3300005353 Ga0070669_100219239 Ga0070669_1002192392 153
480 3300005354 Ga0070675_101395803 Ga0070675_1013958031 153
481 3300005364 Ga0070673_100219296 Ga0070673_1002192962 153
482 3300005365 Ga0070688_100134409 Ga0070688_1001344092 153
483 3300005366 Ga0070659_100699948 Ga0070659_1006999481 153
484 3300005366 Ga0070659_100728875 Ga0070659_1007288752 153
485 3300005367 Ga0070667_100078096 Ga0070667_1000780962 153
486 3300005367 Ga0070667_101351963 Ga0070667_1013519631 153
487 3300005438 Ga0070701_10493251 Ga0070701_104932511 153
488 3300005441 Ga0070700_100174724 Ga0070700_1001747243 153
489 3300005441 Ga0070700_100731868 Ga0070700_1007318681 153
490 3300005455 Ga0070663_100084590 Ga0070663_1000845902 153
491 3300005455 Ga0070663_100097128 Ga0070663_1000971283 153
492 3300005455 Ga0070663_100134325 Ga0070663_1001343252 153
493 3300005455 Ga0070663_100160609 Ga0070663_1001606093 153
494 3300005456 Ga0070678_100375546 Ga0070678_1003755462 153
495 3300005458 Ga0070681_10069696 Ga0070681_100696963 153
496 3300005459 Ga0068867_100269062 Ga0068867_1002690621 153
497 3300005530 Ga0070679_100069731 Ga0070679_1000697313 153
498 3300005544 Ga0070686_100128338 Ga0070686_1001283382 153
499 3300005547 Ga0070693_100144883 Ga0070693_1001448832 153
500 3300005548 Ga0070665_100048897 Ga0070665_1000488973 153
501 3300005548 Ga0070665_100160167 Ga0070665_1001601673 153
502 3300005563 Ga0068855_100005078 Ga0068855_1000050785 153
503 3300005563 Ga0068855_100722433 Ga0068855_1007224331 153
504 3300005564 Ga0070664_100280713 Ga0070664_1002807133 153
505 3300005577 Ga0068857_100630161 Ga0068857_1006301612 153
506 3300005615 Ga0070702_100268914 Ga0070702_1002689141 153
507 3300005718 Ga0068866_10119945 Ga0068866_101199452 153
508 3300005842 Ga0068858_101077175 Ga0068858_1010771751 153
509 3300005842 Ga0068858_101129742 Ga0068858_1011297422 153
510 3300006038 Ga0075365_10026989 Ga0075365_100269894 153
511 3300006042 Ga0075368_10076845 Ga0075368_100768451 153
512 3300006048 Ga0075363_100600248 Ga0075363_1006002482 153
513 3300006051 Ga0075364_10396192 Ga0075364_103961922 153
514 3300006177 Ga0075362_10198503 Ga0075362_101985032 153
515 3300006178 Ga0075367_10056508 Ga0075367_100565082 153
516 3300006186 Ga0075369_10070600 Ga0075369_100706002 153
517 3300006186 Ga0075369_10221796 Ga0075369_102217961 153
518 3300006195 Ga0075366_10280731 Ga0075366_102807312 153
519 3300006353 Ga0075370_10037350 Ga0075370_100373502 153
520 3300006941 Ga0099825_1034652 Ga0099825_10346522 153
521 3300006942 Ga0099824_1038251 Ga0099824_10382511 153
522 3300006944 Ga0099823_1008083 Ga0099823_10080835 153
523 3300009093 Ga0105240_10048479 Ga0105240_100484795 153
524 3300009148 Ga0105243_10349155 Ga0105243_103491552 153
525 3300009148 Ga0105243_10507708 Ga0105243_105077081 153
526 3300009174 Ga0105241_10284981 Ga0105241_102849811 153
527 3300009176 Ga0105242_10313575 Ga0105242_103135752 153
528 3300009176 Ga0105242_10472799 Ga0105242_104727993 153
529 3300009177 Ga0105248_10998688 Ga0105248_109986881 153
530 3300010375 Ga0105239_10010122 Ga0105239_100101227 153
531 3300013104 Ga0157370_10468680 Ga0157370_104686802 153
532 3300013105 Ga0157369_10005932 Ga0157369_100059326 153
533 3300013306 Ga0163162_12384606 Ga0163162_123846061 153
534 3300013308 Ga0157375_10239587 Ga0157375_102395873 153
535 3300014325 Ga0163163_10772530 Ga0163163_107725302 153
536 3300014969 Ga0157376_11067171 Ga0157376_110671711 153
537 3300017792 Ga0163161_10339933 Ga0163161_103399332 153
538 3300021320 Ga0214544_1000009 Ga0214544_1000009249 153
539 3300021321 Ga0214542_1000002 Ga0214542_1000002691 153
540 3300021324 Ga0214545_1000002 Ga0214545_100000229 153
541 3300021327 Ga0214543_1000013 Ga0214543_1000013293 153
542 3300025261 Ga0209233_1016754 Ga0209233_10167542 153
543 3300025297 Ga0209758_1016348 Ga0209758_10163483 153
544 3300025302 Ga0207426_1001352 Ga0207426_10013527 153
545 3300025302 Ga0207426_1035887 Ga0207426_10358872 153
546 3300025304 Ga0209257_1071995 Ga0209257_10719952 153
547 3300025315 Ga0207697_10035429 Ga0207697_100354292 153
548 3300025901 Ga0207688_10009650 Ga0207688_100096502 153
549 3300025903 Ga0207680_10742839 Ga0207680_107428392 153
550 3300025909 Ga0207705_10136113 Ga0207705_101361132 153
551 3300025912 Ga0207707_10992937 Ga0207707_109929372 153
552 3300025913 Ga0207695_10052552 Ga0207695_100525523 153
553 3300025914 Ga0207671_10321495 Ga0207671_103214952 153
554 3300025917 Ga0207660_10149059 Ga0207660_101490592 153
555 3300025920 Ga0207649_10209964 Ga0207649_102099641 153
556 3300025921 Ga0207652_10139022 Ga0207652_101390223 153
557 3300025932 Ga0207690_10078188 Ga0207690_100781882 153
558 3300025932 Ga0207690_10589659 Ga0207690_105896592 153
559 3300025934 Ga0207686_10725983 Ga0207686_107259832 153
560 3300025934 Ga0207686_10766790 Ga0207686_107667901 153
561 3300025935 Ga0207709_10009200 Ga0207709_100092008 153
562 3300025936 Ga0207670_10157026 Ga0207670_101570263 153
563 3300025942 Ga0207689_11175991 Ga0207689_111759911 153
564 3300025949 Ga0207667_10147307 Ga0207667_101473072 153
565 3300025949 Ga0207667_11615261 Ga0207667_116152611 153
566 3300025961 Ga0207712_10012307 Ga0207712_100123072 153
567 3300025986 Ga0207658_10063431 Ga0207658_100634314 153
568 3300026023 Ga0207677_10536595 Ga0207677_105365952 153
569 3300026041 Ga0207639_11182835 Ga0207639_111828352 153
570 3300026067 Ga0207678_10037726 Ga0207678_100377263 153
571 3300026067 Ga0207678_10057840 Ga0207678_100578402 153
572 3300026067 Ga0207678_10067602 Ga0207678_100676022 153
573 3300026067 Ga0207678_10074338 Ga0207678_100743383 153
574 3300026067 Ga0207678_10343446 Ga0207678_103434462 153
575 3300026075 Ga0207708_10173851 Ga0207708_101738513 153
576 3300026075 Ga0207708_10309833 Ga0207708_103098332 153
577 3300026089 Ga0207648_10086382 Ga0207648_100863822 153
578 3300026116 Ga0207674_10446969 Ga0207674_104469692 153
579 3300026121 Ga0207683_10205747 Ga0207683_102057472 153
580 3300026121 Ga0207683_10417232 Ga0207683_104172322 153
581 3300027296 Ga0209389_1000117 Ga0209389_100011731 153
582 3300027361 Ga0209489_102405 Ga0209489_10240510 153
583 3300027363 Ga0209700_100021 Ga0209700_10002131 153
584 3300027866 Ga0209813_10105763 Ga0209813_101057632 153
585 3300028380 Ga0268265_10220021 Ga0268265_102200212 153
586 3300031456 Ga0307513_10276049 Ga0307513_102760492 153
587 3300031507 Ga0307509_10032602 Ga0307509_100326023 153
588 3300031852 Ga0307410_11703053 Ga0307410_117030531 153
589 3300032002 Ga0307416_101121835 Ga0307416_1011218352 153
590 3300032126 Ga0307415_100092914 Ga0307415_1000929143 153
591 3300033180 Ga0307510_10064539 Ga0307510_100645393 153
592 3300041411 Ga0439466_0138311 Ga0439466_0138311_78_545 153
593 3300041443 Ga0451789_0744550 Ga0451789_0744550_631_1098 153
594 3300041451 Ga0451791_1567305 Ga0451791_1567305_147_614 153
595 3300041460 Ga0451802_0456888 Ga0451802_0456888_26_487 153
596 3300041496 Ga0451839_1130307 Ga0451839_1130307_972_1439 153
597 3300041997 Ga0439431_0092733 Ga0439431_0092733_137_604 153
598 3300044656 Ga0466969_0009042 Ga0466969_0009042_1737_2198 153
599 3300044656 Ga0466969_0012357 Ga0466969_0012357_2352_2813 153
600 3300044656 Ga0466969_0086269 Ga0466969_0086269_457_918 153
601 3300044683 Ga0466965_0002917 Ga0466965_0002917_1757_2218 153
602 3300044683 Ga0466965_0085356 Ga0466965_0085356_469_930 153
603 3300044684 Ga0466966_0012747 Ga0466966_0012747_1797_2258 153
604 3300044684 Ga0466966_0015365 Ga0466966_0015365_524_985 153
605 3300044684 Ga0466966_0027652 Ga0466966_0027652_1047_1508 153
606 3300044693 Ga0466961_0008083 Ga0466961_0008083_6103_6564 153
607 3300044693 Ga0466961_0190679 Ga0466961_0190679_54_515 153
608 3300044694 Ga0466963_0906651 Ga0466963_0906651_21_482 153
609 3300044735 Ga0466968_0137551 Ga0466968_0137551_325_786 153
610 3300044765 Ga0466970_0059479 Ga0466970_0059479_439_900 153
611 3300044842 Ga0466957_0039939 Ga0466957_0039939_755_1216 153
612 3300045049 Ga0466959_0005778 Ga0466959_0005778_6184_6645 153
613 3300045049 Ga0466959_0008526 Ga0466959_0008526_3270_3731 153
614 3300045049 Ga0466959_0100592 Ga0466959_0100592_914_1375 153
615 3300045836 Ga0466958_0005296 Ga0466958_0005296_6009_6470 153
616 3300046452 Ga0495617_003222 Ga0495617_003222_4308_4769 153
617 3300046455 Ga0495603_0046262 Ga0495603_0046262_1272_1733 153
618 3300046457 Ga0495590_0080086 Ga0495590_0080086_244_705 153
619 3300046460 Ga0495638_0011589 Ga0495638_0011589_306_773 153
620 3300046460 Ga0495638_0435671 Ga0495638_0435671_104_565 153
621 3300046471 Ga0495650_0018771 Ga0495650_0018771_88_549 153
622 3300046474 Ga0495605_0172835 Ga0495605_0172835_270_731 153
623 3300046499 Ga0495594_0805226 Ga0495594_0805226_52_513 153
624 3300046500 Ga0495596_0404284 Ga0495596_0404284_48_509 153
625 3300046507 Ga0495606_0128253 Ga0495606_0128253_452_913 153
626 3300046522 Ga0495643_0328357 Ga0495643_0328357_80_547 153
627 3300046523 Ga0495644_0102722 Ga0495644_0102722_532_993 153
628 3300046524 Ga0495648_0056053 Ga0495648_0056053_484_945 153
629 3300046525 Ga0495663_0144045 Ga0495663_0144045_81_548 153
630 3300046528 Ga0495642_0129201 Ga0495642_0129201_270_731 153
631 3300046538 Ga0495609_0014953 Ga0495609_0014953_3141_3602 153
632 3300046542 Ga0495597_0218746 Ga0495597_0218746_238_699 153
633 3300046557 Ga0495622_0156788 Ga0495622_0156788_51_512 153
634 3300046558 Ga0495633_0392788 Ga0495633_0392788_82_543 153
635 3300046615 Ga0495656_0110402 Ga0495656_0110402_230_697 153
636 3300046615 Ga0495656_0417213 Ga0495656_0417213_83_544 153
637 3300046616 Ga0495668_0213174 Ga0495668_0213174_302_763 153
638 3300046616 Ga0495668_0770872 Ga0495668_0770872_44_505 153
639 3300046660 Ga0495625_0043325 Ga0495625_0043325_1298_1759 153
640 3300046660 Ga0495625_0131372 Ga0495625_0131372_966_1427 153
641 3300046665 Ga0495661_0220140 Ga0495661_0220140_70_537 153
642 3300046684 Ga0495669_0011283 Ga0495669_0011283_274_741 153
643 3300046694 Ga0495649_0041294 Ga0495649_0041294_1994_2455 153
644 3300046810 Ga0495660_0211114 Ga0495660_0211114_348_809 153
645 3300047323 Ga0495683_0341033 Ga0495683_0341033_150_617 153
646 3300048091 Ga0495626_0297573 Ga0495626_0297573_18_479 153
647 3300048903 Ga0496100_0516761 Ga0496100_0516761_152_619 153
648 3300048904 Ga0496101_0047565 Ga0496101_0047565_500_967 153
649 3300048905 Ga0496102_0329157 Ga0496102_0329157_323_790 153
650 3300048910 Ga0496107_0194645 Ga0496107_0194645_433_900 153
651 3300048918 Ga0496115_0258584 Ga0496115_0258584_813_1274 153
652 3300048918 Ga0496115_0315331 Ga0496115_0315331_386_853 153
653 3300048924 Ga0496121_0017429 Ga0496121_0017429_433_894 153
654 3300048924 Ga0496121_0029157 Ga0496121_0029157_545_1006 153
655 3300048927 Ga0496124_0334716 Ga0496124_0334716_325_786 153
656 3300048928 Ga0496125_0171819 Ga0496125_0171819_228_689 153
657 3300048929 Ga0496126_0020176 Ga0496126_0020176_5072_5533 153
658 3300048929 Ga0496126_0068978 Ga0496126_0068978_2389_2850 153
659 3300048929 Ga0496126_0308387 Ga0496126_0308387_588_1055 153
660 3300048929 Ga0496126_0312928 Ga0496126_0312928_674_1135 153
661 3300048929 Ga0496126_0319806 Ga0496126_0319806_150_611 153
662 3300049570 Ga0501033_0473097 Ga0501033_0473097_36_497 153
663 3300049572 Ga0501036_0778379 Ga0501036_0778379_96_557 153
664 3300049581 Ga0501047_0111567 Ga0501047_0111567_232_693 153
665 3300049589 Ga0501073_0547789 Ga0501073_0547789_66_527 153
666 3300049590 Ga0501074_0228927 Ga0501074_0228927_357_818 153
667 3300049742 Ga0501080_0144322 Ga0501080_0144322_1542_2003 153
668 3300049823 Ga0501044_0021138 Ga0501044_0021138_4058_4519 153
669 3300050489 nmdc:mga03683_175186_c1 nmdc:mga03683_175186_c1_384_851 153
670 3300050490 nmdc:mga03n38_273943_c1 nmdc:mga03n38_273943_c1_383_844 153
671 3300050492 nmdc:mga0yw44_37622_c1 nmdc:mga0yw44_37622_c1_1182_1643 153
672 3300050492 nmdc:mga0yw44_70692_c1 nmdc:mga0yw44_70692_c1_201_668 153
673 3300050493 nmdc:mga0k408_117902_c1 nmdc:mga0k408_117902_c1_860_1321 153
674 3300050494 nmdc:mga06z11_58849_c1 nmdc:mga06z11_58849_c1_1017_1478 153
675 3300050495 nmdc:mga04h51_17050_c1 nmdc:mga04h51_17050_c1_859_1320 153
676 3300050516 nmdc:mga0sz30_101080_c2 nmdc:mga0sz30_101080_c2_181_642 153
677 3300050516 nmdc:mga0sz30_67386_c1 nmdc:mga0sz30_67386_c1_533_1000 153
678 3300053083 Ga0495655_0083124 Ga0495655_0083124_439_900 153
679 3300053087 Ga0500643_165727 Ga0500643_165727_106_567 153
680 3300053088 Ga0500644_0478910 Ga0500644_0478910_44_505 153
681 3300053103 Ga0500555_042115 Ga0500555_042115_525_986 153
682 3300053129 Ga0500628_136059 Ga0500628_136059_133_663 153
683 3300053130 Ga0500642_0071449 Ga0500642_0071449_312_773 153
684 3300053133 Ga0500655_117467 Ga0500655_117467_50_511 153
685 3300053142 Ga0500577_0131826 Ga0500577_0131826_411_872 153
686 3300053730 Ga0500645_015755 Ga0500645_015755_390_851 153
687 iso_pu_bacteria 2874590934 2874597416 153
688 iso_pu_bacteria 2874645413 2874648492 153
689 iso_pu_bacteria 2876771140 2876777787 153
690 iso_pu_bacteria 2876818435 2876822454 153
691 iso_pu_bacteria 2879074833 2879078195 153
692 iso_pu_bacteria 2879127579 2879134464 153
693 iso_pu_bacteria 2879142872 2879150001 153
694 3300005539 Ga0068853_101928495 Ga0068853_1019284951 154
695 3300005937 Ga0081455_10062419 Ga0081455_100624193 154
696 3300013296 Ga0157374_10544571 Ga0157374_105445711 154
697 3300013875 Ga0157515_156067 Ga0157515_1560672 154
698 3300025923 Ga0207681_10199018 Ga0207681_101990182 154
699 3300026041 Ga0207639_11385021 Ga0207639_113850211 154
700 3300028379 Ga0268266_10001892 Ga0268266_1000189213 154
701 3300037471 Ga0395905_0015261 Ga0395905_0015261_2355_2822 154
702 3300037471 Ga0395905_0408981 Ga0395905_0408981_62_535 154
703 3300041498 Ga0451841_0068232 Ga0451841_0068232_175_645 154
704 3300041505 Ga0451849_1320375 Ga0451849_1320375_767_1237 154
705 3300048922 Ga0496119_0101956 Ga0496119_0101956_721_1185 154
706 3300048927 Ga0496124_0786627 Ga0496124_0786627_64_528 154
707 3300049581 Ga0501047_0456801 Ga0501047_0456801_471_998 154
708 3300049581 Ga0501047_0596781 Ga0501047_0596781_72_599 154
709 3300049823 Ga0501044_0270015 Ga0501044_0270015_374_901 154
710 3300050492 nmdc:mga0yw44_27867_c1 nmdc:mga0yw44_27867_c1_38_502 154
711 iso_pu_bacteria 2935608549 2935611805 154
712 iso_pu_bacteria 2935819856 2935821283 154
713 iso_pu_bacteria 2935847175 2935850456 154
714 3300002075 JGI24738J21930_10012390 JGI24738J21930_100123904 155
715 3300005578 Ga0068854_100084200 Ga0068854_1000842001 155
716 3300009551 Ga0105238_10650453 Ga0105238_106504532 155
717 3300025924 Ga0207694_10183403 Ga0207694_101834032 155
718 3300025981 Ga0207640_10014710 Ga0207640_100147103 155
719 3300026116 Ga0207674_10064324 Ga0207674_100643245 155
720 3300031548 Ga0307408_100171429 Ga0307408_1001714292 155
721 3300031731 Ga0307405_10069466 Ga0307405_100694663 155
722 3300031901 Ga0307406_10018932 Ga0307406_100189321 155
723 3300031911 Ga0307412_10003244 Ga0307412_100032448 155
724 3300031995 Ga0307409_100095290 Ga0307409_1000952901 155
725 3300032002 Ga0307416_100022587 Ga0307416_1000225875 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

44

127

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9747 11 140
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9682 1 145
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.963 2 145
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9552 1 145
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9391 11 140
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9666 2 145 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9656 2 139 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9602 2 145 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9525 6 143 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9469 2 145 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4P7L6S2-F1-model_v4 Carboxymuconolactone decarboxylase family protein 1 4 152 GO:0051920
AF-I2B5E8-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 1 1 149 GO:0051920
AF-A0A506VCW6-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9995 1 153 GO:0051920
AF-A0A4Q7RCA5-F1-model_v4 AhpD family alkylhydroperoxidase 0.9992 4 145 GO:0051920
AF-A0A1V2H0A2-F1-model_v4 Alkylhydroperoxidase 0.9972 2 148 GO:0051920

Feature Viewer

pLDDT pTM Quality
95.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map