F477651
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 725 | 463 | 657 | 153 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2935608549|2935611805 |
| Length | 186 |
| Sequence | SWCFFVDQRGDIYRQGKYAATAAEQNRSWSMKMAKRLDYDRIAPAGMKALGGVYGYVMQSNLPATLVTLVYLRISQINNCAYCLDMHTRDLLKSGQKIEKIALVQAWAEGGHLFDERERAALAWAETVTRVAETGIPDQAYEAARAVFEERELVDLTIAIGLMNAYNRMAISFRNTPQAAKEEMAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 4 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 5 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 6 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 7 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 8 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 9 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 10 | 2791355199 | |||
| 11 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 12 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 13 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 14 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 15 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 16 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 17 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 18 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 19 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 20 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 21 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 22 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 23 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 24 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 25 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 26 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 27 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 28 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 29 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 30 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 31 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 32 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 33 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 34 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 35 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 36 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 37 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 38 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 39 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 40 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 41 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 42 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 43 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 44 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 45 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 46 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 47 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 48 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 49 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 50 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 51 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 52 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 53 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 54 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 55 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 56 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 57 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 58 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 59 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 60 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 61 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 62 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 63 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 64 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 65 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 66 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 67 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 68 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 69 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 75 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 77 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 78 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 83 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 106 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005473 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 110 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 116 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 119 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 120 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 122 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 123 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 124 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 129 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 130 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 132 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 133 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 134 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 135 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 137 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 138 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 139 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 140 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 141 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 142 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 143 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 144 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 146 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 147 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 148 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 149 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 150 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 165 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 168 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 169 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 176 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 182 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 183 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 184 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 185 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 186 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 258 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 259 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 264 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 268 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 269 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 270 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 271 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 272 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 273 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 274 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 275 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 276 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 277 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 278 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 279 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 280 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 281 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 282 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 283 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 285 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 286 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 288 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 289 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 292 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 293 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 294 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 295 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 298 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 299 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 300 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 301 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 302 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 303 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 308 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 309 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 310 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 311 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 312 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 313 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 314 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 315 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 316 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 317 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 318 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 319 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 320 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 321 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 322 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 323 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 324 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 325 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 326 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 327 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 328 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 329 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 399 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 400 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 401 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 402 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 403 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 405 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 406 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 407 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 408 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 409 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 410 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 411 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 412 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 413 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 414 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 415 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 416 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 417 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 418 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 426 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 431 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 432 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 433 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 434 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 435 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 436 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 440 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 446 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 448 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 449 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 450 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 451 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 452 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 454 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 455 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 456 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 457 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 458 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 459 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 460 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 461 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 462 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 463 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.61 |
| Metatranscriptomes | 0.14 |
| Isolates | 9.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.83 |
| Nodule | 7.86 |
| Rhizoplane | 4.55 |
| Rhizosphere | 63.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10012390 | 3300002075 | Bacteria | 1863 |
| 2 | JGI24742J22300_10048254 | 3300002244 | Bacteria | 768 |
| 3 | JGI25157J39369_1000188 | 3300002741 | Bacteria | 52162 |
| 4 | JGI25159J45721_1024677 | 3300002987 | Bacteria | 1065 |
| 5 | JGI25153J46596_10001083 | 3300003215 | Bacteria | 16602 |
| 6 | rootL2_10103187 | 3300003322 | Bacteria | 3485 |
| 7 | JGI25160J50197_1000042 | 3300003354 | Bacteria | 149808 |
| 8 | JGI25160J50197_1000866 | 3300003354 | Bacteria | 16040 |
| 9 | JGI25160J50197_1006131 | 3300003354 | Bacteria | 4902 |
| 10 | JGI25160J50197_1012996 | 3300003354 | Bacteria | 2858 |
| 11 | JGI25161J50226_1000305 | 3300003374 | Bacteria | 27361 |
| 12 | JGI25161J50226_1001004 | 3300003374 | Bacteria | 9892 |
| 13 | Ga0055526_1010501 | 3300003771 | Bacteria | 4297 |
| 14 | Ga0055536_1006143 | 3300003781 | Bacteria | 5679 |
| 15 | Ga0055536_1007742 | 3300003781 | Bacteria | 4750 |
| 16 | Ga0055536_1017623 | 3300003781 | Bacteria | 2327 |
| 17 | Ga0055536_1076350 | 3300003781 | Bacteria | 646 |
| 18 | Ga0055530_10002071 | 3300003791 | Bacteria | 13463 |
| 19 | Ga0055540_1030767 | 3300003792 | Bacteria | 1241 |
| 20 | Ga0055531_10009625 | 3300003794 | Bacteria | 4919 |
| 21 | Ga0055531_10010201 | 3300003794 | Bacteria | 4698 |
| 22 | Ga0055531_10017573 | 3300003794 | Bacteria | 3011 |
| 23 | Ga0055531_10032714 | 3300003794 | Bacteria | 1692 |
| 24 | Ga0055531_10063562 | 3300003794 | Bacteria | 887 |
| 25 | Ga0055531_10097207 | 3300003794 | Bacteria | 612 |
| 26 | Ga0058692_1000001 | 3300003856 | Bacteria | 834230 |
| 27 | Ga0055543_1000931 | 3300004625 | Bacteria | 13557 |
| 28 | Ga0055543_1004885 | 3300004625 | Bacteria | 3542 |
| 29 | Ga0055543_1009945 | 3300004625 | Bacteria | 2017 |
| 30 | Ga0065165_1000174 | 3300005262 | Bacteria | 113769 |
| 31 | Ga0065165_1001608 | 3300005262 | Bacteria | 23076 |
| 32 | Ga0065165_1001780 | 3300005262 | Bacteria | 21284 |
| 33 | Ga0065165_1002379 | 3300005262 | Bacteria | 16214 |
| 34 | Ga0065703_1000131 | 3300005272 | Bacteria | 12048 |
| 35 | Ga0065704_10143141 | 3300005289 | Bacteria | 1498 |
| 36 | Ga0070658_10230563 | 3300005327 | Bacteria | 1568 |
| 37 | Ga0070676_10328699 | 3300005328 | Bacteria | 1045 |
| 38 | Ga0070677_10098517 | 3300005333 | Bacteria | 1285 |
| 39 | Ga0068869_100275724 | 3300005334 | Bacteria | 1351 |
| 40 | Ga0068869_100479023 | 3300005334 | Bacteria | 1036 |
| 41 | Ga0070680_100060330 | 3300005336 | Bacteria | 3104 |
| 42 | Ga0070682_100452345 | 3300005337 | Bacteria | 984 |
| 43 | Ga0070689_100177492 | 3300005340 | Bacteria | 1728 |
| 44 | Ga0070668_100011183 | 3300005347 | Bacteria | 6683 |
| 45 | Ga0070668_100072369 | 3300005347 | Bacteria | 2686 |
| 46 | Ga0070668_100324292 | 3300005347 | Bacteria | 1297 |
| 47 | Ga0070668_100740222 | 3300005347 | Bacteria | 869 |
| 48 | Ga0070669_100219239 | 3300005353 | Bacteria | 1504 |
| 49 | Ga0070669_100407460 | 3300005353 | Bacteria | 1114 |
| 50 | Ga0070675_100055471 | 3300005354 | Bacteria | 3262 |
| 51 | Ga0070675_101395803 | 3300005354 | Bacteria | 646 |
| 52 | Ga0070671_100162396 | 3300005355 | Bacteria | 1888 |
| 53 | Ga0070674_100606065 | 3300005356 | Bacteria | 926 |
| 54 | Ga0070673_100219296 | 3300005364 | Bacteria | 1646 |
| 55 | Ga0070688_100134409 | 3300005365 | Bacteria | 1673 |
| 56 | Ga0070659_100314000 | 3300005366 | Bacteria | 1309 |
| 57 | Ga0070659_100699948 | 3300005366 | Bacteria | 876 |
| 58 | Ga0070659_100728875 | 3300005366 | Bacteria | 859 |
| 59 | Ga0070667_100076083 | 3300005367 | Bacteria | 2866 |
| 60 | Ga0070667_100078096 | 3300005367 | Bacteria | 2827 |
| 61 | Ga0070667_101351963 | 3300005367 | Bacteria | 668 |
| 62 | Ga0070667_101509436 | 3300005367 | Bacteria | 631 |
| 63 | Ga0070709_10125212 | 3300005434 | Bacteria | 1747 |
| 64 | Ga0070709_10650413 | 3300005434 | Bacteria | 816 |
| 65 | Ga0070713_100039260 | 3300005436 | Bacteria | 3841 |
| 66 | Ga0070713_101234426 | 3300005436 | Bacteria | 724 |
| 67 | Ga0070710_10039060 | 3300005437 | Bacteria | 2610 |
| 68 | Ga0070710_10201708 | 3300005437 | Bacteria | 1256 |
| 69 | Ga0070701_10493251 | 3300005438 | Bacteria | 794 |
| 70 | Ga0070701_11012170 | 3300005438 | Bacteria | 580 |
| 71 | Ga0070711_100021672 | 3300005439 | Bacteria | 4157 |
| 72 | Ga0070711_100114383 | 3300005439 | Bacteria | 1986 |
| 73 | Ga0070700_100174724 | 3300005441 | Bacteria | 1490 |
| 74 | Ga0070700_100731868 | 3300005441 | Bacteria | 790 |
| 75 | Ga0070663_100010319 | 3300005455 | Bacteria | 5821 |
| 76 | Ga0070663_100084590 | 3300005455 | Bacteria | 2339 |
| 77 | Ga0070663_100097128 | 3300005455 | Bacteria | 2193 |
| 78 | Ga0070663_100134325 | 3300005455 | Bacteria | 1882 |
| 79 | Ga0070663_100160609 | 3300005455 | Bacteria | 1729 |
| 80 | Ga0070678_100375546 | 3300005456 | Bacteria | 1229 |
| 81 | Ga0070678_100558792 | 3300005456 | Bacteria | 1017 |
| 82 | Ga0070662_100594683 | 3300005457 | Bacteria | 930 |
| 83 | Ga0070681_10069696 | 3300005458 | Bacteria | 3483 |
| 84 | Ga0068867_100161280 | 3300005459 | Bacteria | 1768 |
| 85 | Ga0068867_100269062 | 3300005459 | Bacteria | 1392 |
| 86 | Ga0070685_10104337 | 3300005466 | Bacteria | 1736 |
| 87 | Ga0074250_10309 | 3300005473 | Bacteria | 2158 |
| 88 | Ga0070679_100069731 | 3300005530 | Bacteria | 3507 |
| 89 | Ga0070679_101368979 | 3300005530 | Bacteria | 654 |
| 90 | Ga0068853_101928495 | 3300005539 | Bacteria | 573 |
| 91 | Ga0070672_100058890 | 3300005543 | Bacteria | 3021 |
| 92 | Ga0070672_100355511 | 3300005543 | Bacteria | 1249 |
| 93 | Ga0070686_100128338 | 3300005544 | Bacteria | 1750 |
| 94 | Ga0070696_100257861 | 3300005546 | Bacteria | 1321 |
| 95 | Ga0070693_100144883 | 3300005547 | Bacteria | 1499 |
| 96 | Ga0070665_100048897 | 3300005548 | Bacteria | 4245 |
| 97 | Ga0070665_100090619 | 3300005548 | Bacteria | 3063 |
| 98 | Ga0070665_100160167 | 3300005548 | Bacteria | 2252 |
| 99 | Ga0070665_100818314 | 3300005548 | Bacteria | 944 |
| 100 | Ga0068855_100005078 | 3300005563 | Bacteria | 16046 |
| 101 | Ga0068855_100722433 | 3300005563 | Bacteria | 1064 |
| 102 | Ga0070664_100280713 | 3300005564 | Bacteria | 1502 |
| 103 | Ga0068857_100630161 | 3300005577 | Bacteria | 1015 |
| 104 | Ga0068854_100084200 | 3300005578 | Bacteria | 2353 |
| 105 | Ga0068854_100181619 | 3300005578 | Bacteria | 1644 |
| 106 | Ga0068854_100312121 | 3300005578 | Bacteria | 1275 |
| 107 | Ga0068856_101644676 | 3300005614 | Bacteria | 655 |
| 108 | Ga0070702_100198571 | 3300005615 | Bacteria | 1326 |
| 109 | Ga0070702_100268914 | 3300005615 | Bacteria | 1165 |
| 110 | Ga0070702_100507423 | 3300005615 | Bacteria | 887 |
| 111 | Ga0068859_100218559 | 3300005617 | Bacteria | 1993 |
| 112 | Ga0068866_10119945 | 3300005718 | Bacteria | 1480 |
| 113 | Ga0068861_100372557 | 3300005719 | Bacteria | 1259 |
| 114 | Ga0068861_101096342 | 3300005719 | Bacteria | 765 |
| 115 | Ga0068870_10224425 | 3300005840 | Bacteria | 1152 |
| 116 | Ga0068858_101077175 | 3300005842 | Bacteria | 789 |
| 117 | Ga0068858_101129742 | 3300005842 | Bacteria | 769 |
| 118 | Ga0068860_100611825 | 3300005843 | Bacteria | 1095 |
| 119 | Ga0068862_100263365 | 3300005844 | Bacteria | 1574 |
| 120 | Ga0068862_100838924 | 3300005844 | Bacteria | 900 |
| 121 | Ga0081455_10008875 | 3300005937 | Bacteria | 10395 |
| 122 | Ga0081455_10062419 | 3300005937 | Bacteria | 3131 |
| 123 | Ga0081540_1025746 | 3300005983 | Bacteria | 3377 |
| 124 | Ga0081540_1069324 | 3300005983 | Bacteria | 1639 |
| 125 | Ga0070717_10271232 | 3300006028 | Bacteria | 1503 |
| 126 | Ga0070717_10294822 | 3300006028 | Bacteria | 1441 |
| 127 | Ga0075365_10021797 | 3300006038 | Bacteria | 4003 |
| 128 | Ga0075365_10026989 | 3300006038 | Bacteria | 3649 |
| 129 | Ga0075365_10259007 | 3300006038 | Bacteria | 1223 |
| 130 | Ga0075365_10273586 | 3300006038 | Bacteria | 1188 |
| 131 | Ga0075368_10007588 | 3300006042 | Bacteria | 3828 |
| 132 | Ga0075368_10076845 | 3300006042 | Bacteria | 1355 |
| 133 | Ga0075363_100286802 | 3300006048 | Bacteria | 953 |
| 134 | Ga0075363_100600248 | 3300006048 | Bacteria | 660 |
| 135 | Ga0075364_10068084 | 3300006051 | Bacteria | 2341 |
| 136 | Ga0075364_10396192 | 3300006051 | Bacteria | 942 |
| 137 | Ga0070712_100232157 | 3300006175 | Bacteria | 1466 |
| 138 | Ga0070712_100242366 | 3300006175 | Bacteria | 1437 |
| 139 | Ga0075362_10072044 | 3300006177 | Bacteria | 1580 |
| 140 | Ga0075362_10198503 | 3300006177 | Bacteria | 976 |
| 141 | Ga0075367_10009129 | 3300006178 | Bacteria | 5170 |
| 142 | Ga0075367_10056508 | 3300006178 | Bacteria | 2331 |
| 143 | Ga0075367_10065291 | 3300006178 | Bacteria | 2179 |
| 144 | Ga0075367_10397203 | 3300006178 | Bacteria | 872 |
| 145 | Ga0075369_10070600 | 3300006186 | Bacteria | 1537 |
| 146 | Ga0075369_10221796 | 3300006186 | Bacteria | 875 |
| 147 | Ga0075369_10407673 | 3300006186 | Bacteria | 641 |
| 148 | Ga0075366_10124393 | 3300006195 | Bacteria | 1555 |
| 149 | Ga0075366_10280731 | 3300006195 | Bacteria | 1018 |
| 150 | Ga0075370_10016633 | 3300006353 | Bacteria | 3959 |
| 151 | Ga0075370_10037350 | 3300006353 | Bacteria | 2731 |
| 152 | Ga0068871_101621804 | 3300006358 | Bacteria | 613 |
| 153 | Ga0075428_100005277 | 3300006844 | Bacteria | 14368 |
| 154 | Ga0075430_100166379 | 3300006846 | Bacteria | 1835 |
| 155 | Ga0075430_100251539 | 3300006846 | Bacteria | 1464 |
| 156 | Ga0097620_100218568 | 3300006931 | Bacteria | 1993 |
| 157 | Ga0099825_1034652 | 3300006941 | Bacteria | 1862 |
| 158 | Ga0099824_1038251 | 3300006942 | Bacteria | 1288 |
| 159 | Ga0099822_1001480 | 3300006943 | Bacteria | 27484 |
| 160 | Ga0099823_1008083 | 3300006944 | Bacteria | 10710 |
| 161 | Ga0099795_10059300 | 3300007788 | Bacteria | 1416 |
| 162 | Ga0105251_10219096 | 3300009011 | Bacteria | 857 |
| 163 | Ga0105251_10377892 | 3300009011 | Bacteria | 649 |
| 164 | Ga0105244_10003674 | 3300009036 | Bacteria | 10835 |
| 165 | Ga0105250_10002955 | 3300009092 | Bacteria | 8276 |
| 166 | Ga0105240_10048479 | 3300009093 | Bacteria | 5368 |
| 167 | Ga0105240_11082850 | 3300009093 | Bacteria | 853 |
| 168 | Ga0111539_10000616 | 3300009094 | Bacteria | 46125 |
| 169 | Ga0111539_10038859 | 3300009094 | Bacteria | 5741 |
| 170 | Ga0105245_10167231 | 3300009098 | Bacteria | 2091 |
| 171 | Ga0105245_11825840 | 3300009098 | Bacteria | 661 |
| 172 | Ga0114129_10294342 | 3300009147 | Bacteria | 2165 |
| 173 | Ga0105243_10000266 | 3300009148 | Bacteria | 58762 |
| 174 | Ga0105243_10349155 | 3300009148 | Bacteria | 1358 |
| 175 | Ga0105243_10507708 | 3300009148 | Bacteria | 1144 |
| 176 | Ga0105243_10509428 | 3300009148 | Bacteria | 1142 |
| 177 | Ga0105241_10284981 | 3300009174 | Bacteria | 1412 |
| 178 | Ga0105242_10313575 | 3300009176 | Bacteria | 1436 |
| 179 | Ga0105242_10472799 | 3300009176 | Bacteria | 1186 |
| 180 | Ga0105248_10044933 | 3300009177 | Bacteria | 4954 |
| 181 | Ga0105248_10770113 | 3300009177 | Bacteria | 1086 |
| 182 | Ga0105248_10998688 | 3300009177 | Bacteria | 945 |
| 183 | Ga0105237_10401732 | 3300009545 | Bacteria | 1375 |
| 184 | Ga0105237_10571391 | 3300009545 | Bacteria | 1137 |
| 185 | Ga0105238_10232064 | 3300009551 | Bacteria | 1822 |
| 186 | Ga0105238_10650453 | 3300009551 | Bacteria | 1064 |
| 187 | Ga0105249_10384842 | 3300009553 | Bacteria | 1430 |
| 188 | Ga0105033_103627 | 3300009986 | Bacteria | 1304 |
| 189 | Ga0105239_10010122 | 3300010375 | Bacteria | 10567 |
| 190 | Ga0105239_10114797 | 3300010375 | Bacteria | 2987 |
| 191 | Ga0105239_12403338 | 3300010375 | Bacteria | 614 |
| 192 | Ga0105246_10035339 | 3300011119 | Bacteria | 3340 |
| 193 | Ga0157319_1018736 | 3300012497 | Bacteria | 652 |
| 194 | Ga0157347_1004269 | 3300012502 | Bacteria | 1319 |
| 195 | Ga0157370_10375663 | 3300013104 | Bacteria | 1309 |
| 196 | Ga0157370_10375665 | 3300013104 | Bacteria | 1309 |
| 197 | Ga0157370_10468680 | 3300013104 | Bacteria | 1157 |
| 198 | Ga0157369_10005932 | 3300013105 | Bacteria | 14188 |
| 199 | Ga0157374_10321643 | 3300013296 | Bacteria | 1533 |
| 200 | Ga0157374_10544571 | 3300013296 | Bacteria | 1168 |
| 201 | Ga0157378_10139282 | 3300013297 | Bacteria | 2252 |
| 202 | Ga0163162_10314987 | 3300013306 | Bacteria | 1697 |
| 203 | Ga0163162_10321431 | 3300013306 | Bacteria | 1680 |
| 204 | Ga0163162_10536128 | 3300013306 | Bacteria | 1299 |
| 205 | Ga0163162_12384606 | 3300013306 | Bacteria | 608 |
| 206 | Ga0157375_10239587 | 3300013308 | Bacteria | 1974 |
| 207 | Ga0157515_156067 | 3300013875 | Bacteria | 1360 |
| 208 | Ga0163163_10772530 | 3300014325 | Bacteria | 1024 |
| 209 | Ga0163163_11675239 | 3300014325 | Bacteria | 697 |
| 210 | Ga0157380_10140437 | 3300014326 | Bacteria | 2074 |
| 211 | Ga0157379_10606445 | 3300014968 | Bacteria | 1022 |
| 212 | Ga0157376_11067171 | 3300014969 | Bacteria | 832 |
| 213 | Ga0157376_12740164 | 3300014969 | Bacteria | 533 |
| 214 | Ga0163161_10339933 | 3300017792 | Bacteria | 1191 |
| 215 | Ga0206356_11226433 | 3300020070 | Bacteria | 632 |
| 216 | Ga0214544_1000009 | 3300021320 | Bacteria | 285865 |
| 217 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 218 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 219 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 220 | Ga0209436_100151 | 3300025208 | Bacteria | 33281 |
| 221 | Ga0207425_1029235 | 3300025245 | Bacteria | 1112 |
| 222 | Ga0209026_1000070 | 3300025250 | Bacteria | 205861 |
| 223 | Ga0209759_1000293 | 3300025256 | Bacteria | 69229 |
| 224 | Ga0209233_1016754 | 3300025261 | Bacteria | 2012 |
| 225 | Ga0209565_1014942 | 3300025263 | Bacteria | 1766 |
| 226 | Ga0209673_1066743 | 3300025273 | Bacteria | 873 |
| 227 | Ga0209130_1000054 | 3300025284 | Bacteria | 212299 |
| 228 | Ga0209130_1000075 | 3300025284 | Bacteria | 171698 |
| 229 | Ga0209130_1000304 | 3300025284 | Bacteria | 59784 |
| 230 | Ga0209675_1009191 | 3300025291 | Bacteria | 3516 |
| 231 | Ga0209675_1068308 | 3300025291 | Bacteria | 683 |
| 232 | Ga0209676_1001001 | 3300025292 | Bacteria | 33180 |
| 233 | Ga0209676_1013489 | 3300025292 | Bacteria | 3140 |
| 234 | Ga0209676_1022145 | 3300025292 | Bacteria | 2113 |
| 235 | Ga0209676_1042456 | 3300025292 | Bacteria | 1262 |
| 236 | Ga0209025_1003491 | 3300025294 | Bacteria | 14807 |
| 237 | Ga0209025_1005830 | 3300025294 | Bacteria | 9864 |
| 238 | Ga0209564_1000869 | 3300025295 | Bacteria | 40151 |
| 239 | Ga0209758_1016348 | 3300025297 | Bacteria | 3775 |
| 240 | Ga0209758_1035436 | 3300025297 | Bacteria | 1967 |
| 241 | Ga0209050_1000829 | 3300025298 | Bacteria | 42838 |
| 242 | Ga0209050_1008936 | 3300025298 | Bacteria | 5229 |
| 243 | Ga0209256_1000951 | 3300025299 | Bacteria | 35127 |
| 244 | Ga0207426_1000127 | 3300025302 | Bacteria | 212942 |
| 245 | Ga0207426_1000141 | 3300025302 | Bacteria | 194453 |
| 246 | Ga0207426_1000163 | 3300025302 | Bacteria | 171698 |
| 247 | Ga0207426_1001352 | 3300025302 | Bacteria | 20790 |
| 248 | Ga0207426_1035887 | 3300025302 | Bacteria | 1579 |
| 249 | Ga0209051_1003765 | 3300025303 | Bacteria | 9731 |
| 250 | Ga0209051_1005795 | 3300025303 | Bacteria | 7110 |
| 251 | Ga0209051_1050873 | 3300025303 | Bacteria | 1383 |
| 252 | Ga0209257_1000846 | 3300025304 | Bacteria | 43824 |
| 253 | Ga0209257_1002128 | 3300025304 | Bacteria | 20658 |
| 254 | Ga0209257_1006755 | 3300025304 | Bacteria | 7231 |
| 255 | Ga0209257_1013823 | 3300025304 | Bacteria | 3538 |
| 256 | Ga0209257_1056450 | 3300025304 | Bacteria | 1084 |
| 257 | Ga0209257_1071995 | 3300025304 | Bacteria | 908 |
| 258 | Ga0207697_10035429 | 3300025315 | Bacteria | 2043 |
| 259 | Ga0207696_1002904 | 3300025711 | Bacteria | 8065 |
| 260 | Ga0207655_1000353 | 3300025728 | Bacteria | 66222 |
| 261 | Ga0207713_1010634 | 3300025735 | Bacteria | 5074 |
| 262 | Ga0207682_10075318 | 3300025893 | Bacteria | 1436 |
| 263 | Ga0207692_10338185 | 3300025898 | Bacteria | 925 |
| 264 | Ga0207692_10456035 | 3300025898 | Bacteria | 805 |
| 265 | Ga0207642_10020311 | 3300025899 | Bacteria | 2590 |
| 266 | Ga0207688_10009650 | 3300025901 | Bacteria | 5255 |
| 267 | Ga0207680_10742839 | 3300025903 | Bacteria | 703 |
| 268 | Ga0207699_10157918 | 3300025906 | Bacteria | 1507 |
| 269 | Ga0207699_10659853 | 3300025906 | Bacteria | 764 |
| 270 | Ga0207645_10224793 | 3300025907 | Bacteria | 1238 |
| 271 | Ga0207705_10136113 | 3300025909 | Bacteria | 1831 |
| 272 | Ga0207684_10644341 | 3300025910 | Bacteria | 903 |
| 273 | Ga0207707_10992937 | 3300025912 | Bacteria | 689 |
| 274 | Ga0207695_10052552 | 3300025913 | Bacteria | 4267 |
| 275 | Ga0207671_10321495 | 3300025914 | Bacteria | 1224 |
| 276 | Ga0207693_10016626 | 3300025915 | Bacteria | 5877 |
| 277 | Ga0207693_10423993 | 3300025915 | Bacteria | 1040 |
| 278 | Ga0207663_10017262 | 3300025916 | Bacteria | 4017 |
| 279 | Ga0207663_10060620 | 3300025916 | Bacteria | 2398 |
| 280 | Ga0207663_10104535 | 3300025916 | Bacteria | 1909 |
| 281 | Ga0207660_10149059 | 3300025917 | Bacteria | 1796 |
| 282 | Ga0207649_10209964 | 3300025920 | Bacteria | 1380 |
| 283 | Ga0207652_10139022 | 3300025921 | Bacteria | 2171 |
| 284 | Ga0207681_10199018 | 3300025923 | Bacteria | 1537 |
| 285 | Ga0207694_10183403 | 3300025924 | Bacteria | 1698 |
| 286 | Ga0207687_10048099 | 3300025927 | Bacteria | 2959 |
| 287 | Ga0207700_10056696 | 3300025928 | Bacteria | 2950 |
| 288 | Ga0207700_10691526 | 3300025928 | Bacteria | 910 |
| 289 | Ga0207664_10800973 | 3300025929 | Bacteria | 847 |
| 290 | Ga0207644_10236839 | 3300025931 | Bacteria | 1452 |
| 291 | Ga0207690_10078188 | 3300025932 | Bacteria | 2301 |
| 292 | Ga0207690_10589659 | 3300025932 | Bacteria | 906 |
| 293 | Ga0207706_10070521 | 3300025933 | Bacteria | 3074 |
| 294 | Ga0207706_10093854 | 3300025933 | Bacteria | 2639 |
| 295 | Ga0207686_10725983 | 3300025934 | Bacteria | 791 |
| 296 | Ga0207686_10766790 | 3300025934 | Bacteria | 771 |
| 297 | Ga0207709_10000001 | 3300025935 | Bacteria | 2228154 |
| 298 | Ga0207709_10009200 | 3300025935 | Bacteria | 5441 |
| 299 | Ga0207670_10157026 | 3300025936 | Bacteria | 1694 |
| 300 | Ga0207669_10095538 | 3300025937 | Bacteria | 1948 |
| 301 | Ga0207665_10353162 | 3300025939 | Bacteria | 1110 |
| 302 | Ga0207691_10081903 | 3300025940 | Bacteria | 2900 |
| 303 | Ga0207691_10351200 | 3300025940 | Bacteria | 1262 |
| 304 | Ga0207711_10014773 | 3300025941 | Bacteria | 6489 |
| 305 | Ga0207689_11175991 | 3300025942 | Bacteria | 646 |
| 306 | Ga0207667_10147307 | 3300025949 | Bacteria | 2423 |
| 307 | Ga0207667_11615261 | 3300025949 | Bacteria | 617 |
| 308 | Ga0207651_10026070 | 3300025960 | Bacteria | 3645 |
| 309 | Ga0207712_10012307 | 3300025961 | Bacteria | 5468 |
| 310 | Ga0207668_10061259 | 3300025972 | Bacteria | 2645 |
| 311 | Ga0207668_10253973 | 3300025972 | Bacteria | 1429 |
| 312 | Ga0207668_10501411 | 3300025972 | Bacteria | 1044 |
| 313 | Ga0207640_10014710 | 3300025981 | Bacteria | 4510 |
| 314 | Ga0207640_10188773 | 3300025981 | Bacteria | 1552 |
| 315 | Ga0207658_10063431 | 3300025986 | Bacteria | 2769 |
| 316 | Ga0207658_10885829 | 3300025986 | Bacteria | 812 |
| 317 | Ga0207677_10536595 | 3300026023 | Bacteria | 1017 |
| 318 | Ga0207703_10658188 | 3300026035 | Bacteria | 994 |
| 319 | Ga0207639_11182835 | 3300026041 | Bacteria | 717 |
| 320 | Ga0207639_11385021 | 3300026041 | Bacteria | 660 |
| 321 | Ga0207678_10015102 | 3300026067 | Bacteria | 6793 |
| 322 | Ga0207678_10037726 | 3300026067 | Bacteria | 4202 |
| 323 | Ga0207678_10057840 | 3300026067 | Bacteria | 3336 |
| 324 | Ga0207678_10067602 | 3300026067 | Bacteria | 3067 |
| 325 | Ga0207678_10074338 | 3300026067 | Bacteria | 2912 |
| 326 | Ga0207678_10343446 | 3300026067 | Bacteria | 1286 |
| 327 | Ga0207708_10173851 | 3300026075 | Bacteria | 1707 |
| 328 | Ga0207708_10309833 | 3300026075 | Bacteria | 1286 |
| 329 | Ga0207648_10086382 | 3300026089 | Bacteria | 2737 |
| 330 | Ga0207648_10116615 | 3300026089 | Bacteria | 2347 |
| 331 | Ga0207674_10064324 | 3300026116 | Bacteria | 3700 |
| 332 | Ga0207674_10446969 | 3300026116 | Bacteria | 1249 |
| 333 | Ga0207675_100182160 | 3300026118 | Bacteria | 2012 |
| 334 | Ga0207675_100783549 | 3300026118 | Bacteria | 966 |
| 335 | Ga0207683_10091351 | 3300026121 | Bacteria | 2712 |
| 336 | Ga0207683_10205747 | 3300026121 | Bacteria | 1790 |
| 337 | Ga0207683_10417232 | 3300026121 | Bacteria | 1236 |
| 338 | Ga0207698_10286246 | 3300026142 | Bacteria | 1527 |
| 339 | Ga0209281_1001247 | 3300027111 | Bacteria | 16688 |
| 340 | Ga0209389_1000117 | 3300027296 | Bacteria | 71506 |
| 341 | Ga0209371_1000008 | 3300027312 | Bacteria | 1024606 |
| 342 | Ga0209489_102405 | 3300027361 | Bacteria | 38216 |
| 343 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 344 | Ga0209813_10031533 | 3300027866 | Bacteria | 1565 |
| 345 | Ga0209813_10105763 | 3300027866 | Bacteria | 963 |
| 346 | Ga0207428_10000129 | 3300027907 | Bacteria | 104467 |
| 347 | Ga0207428_10292680 | 3300027907 | Bacteria | 1206 |
| 348 | Ga0268266_10001892 | 3300028379 | Bacteria | 23598 |
| 349 | Ga0268266_10004234 | 3300028379 | Bacteria | 13815 |
| 350 | Ga0268266_10959847 | 3300028379 | Bacteria | 827 |
| 351 | Ga0268265_10220021 | 3300028380 | Bacteria | 1661 |
| 352 | Ga0268264_10303587 | 3300028381 | Bacteria | 1504 |
| 353 | Ga0268256_1000009 | 3300030500 | Bacteria | 1022625 |
| 354 | Ga0265325_10000105 | 3300031241 | Bacteria | 59642 |
| 355 | Ga0307513_10100903 | 3300031456 | Bacteria | 2910 |
| 356 | Ga0307513_10276049 | 3300031456 | Bacteria | 1461 |
| 357 | Ga0307509_10032602 | 3300031507 | Bacteria | 5740 |
| 358 | Ga0307408_100068556 | 3300031548 | Bacteria | 2612 |
| 359 | Ga0307408_100171429 | 3300031548 | Bacteria | 1733 |
| 360 | Ga0307408_100822667 | 3300031548 | Bacteria | 844 |
| 361 | Ga0307405_10069466 | 3300031731 | Bacteria | 2258 |
| 362 | Ga0307405_10204225 | 3300031731 | Bacteria | 1437 |
| 363 | Ga0307413_10035168 | 3300031824 | Bacteria | 2871 |
| 364 | Ga0307413_11570608 | 3300031824 | Bacteria | 583 |
| 365 | Ga0307410_10114355 | 3300031852 | Bacteria | 1958 |
| 366 | Ga0307410_10158694 | 3300031852 | Bacteria | 1692 |
| 367 | Ga0307410_11703053 | 3300031852 | Bacteria | 559 |
| 368 | Ga0307406_10018932 | 3300031901 | Bacteria | 4033 |
| 369 | Ga0307406_10800219 | 3300031901 | Bacteria | 795 |
| 370 | Ga0307412_10003244 | 3300031911 | Bacteria | 9042 |
| 371 | Ga0307412_10015743 | 3300031911 | Bacteria | 4489 |
| 372 | Ga0307412_11449999 | 3300031911 | Bacteria | 622 |
| 373 | Ga0307409_100095290 | 3300031995 | Bacteria | 2452 |
| 374 | Ga0307409_100657915 | 3300031995 | Bacteria | 1042 |
| 375 | Ga0307409_101230461 | 3300031995 | Bacteria | 773 |
| 376 | Ga0307416_100022587 | 3300032002 | Bacteria | 4544 |
| 377 | Ga0307416_101121835 | 3300032002 | Bacteria | 891 |
| 378 | Ga0307411_10122472 | 3300032005 | Bacteria | 1885 |
| 379 | Ga0307415_100092914 | 3300032126 | Bacteria | 2189 |
| 380 | Ga0307415_101092084 | 3300032126 | Bacteria | 746 |
| 381 | Ga0307510_10021950 | 3300033180 | Bacteria | 7426 |
| 382 | Ga0307510_10064539 | 3300033180 | Bacteria | 3718 |
| 383 | Ga0307510_10110805 | 3300033180 | Bacteria | 2488 |
| 384 | Ga0373938_0166361 | 3300034957 | Bacteria | 595 |
| 385 | Ga0373934_0051305 | 3300035086 | Bacteria | 1635 |
| 386 | Ga0373953_0009557 | 3300035117 | Bacteria | 3343 |
| 387 | Ga0373954_0087805 | 3300035118 | Bacteria | 1491 |
| 388 | Ga0373956_0009924 | 3300035119 | Bacteria | 3883 |
| 389 | Ga0373957_0008716 | 3300035120 | Bacteria | 3299 |
| 390 | Ga0373943_0792030 | 3300035170 | Bacteria | 564 |
| 391 | Ga0373946_0073638 | 3300035171 | Bacteria | 1481 |
| 392 | Ga0373955_0141191 | 3300035172 | Bacteria | 1412 |
| 393 | Ga0373935_0104971 | 3300035692 | Bacteria | 1868 |
| 394 | Ga0373927_0227925 | 3300035695 | Bacteria | 1224 |
| 395 | Ga0373933_0052122 | 3300035724 | Bacteria | 2447 |
| 396 | Ga0373947_0290077 | 3300035725 | Bacteria | 1089 |
| 397 | Ga0373937_0106404 | 3300036401 | Bacteria | 2607 |
| 398 | Ga0373925_0023713 | 3300037068 | Bacteria | 4477 |
| 399 | Ga0395899_0203784 | 3300037312 | Bacteria | 1378 |
| 400 | Ga0395900_0078574 | 3300037418 | Bacteria | 3390 |
| 401 | Ga0395898_0192576 | 3300037466 | Bacteria | 1948 |
| 402 | Ga0395898_0240966 | 3300037466 | Bacteria | 1725 |
| 403 | Ga0395905_0015261 | 3300037471 | Bacteria | 7304 |
| 404 | Ga0395905_0145461 | 3300037471 | Bacteria | 2230 |
| 405 | Ga0395905_0211175 | 3300037471 | Bacteria | 1818 |
| 406 | Ga0395905_0408981 | 3300037471 | Bacteria | 1252 |
| 407 | Ga0395901_0090246 | 3300038443 | Bacteria | 3207 |
| 408 | Ga0395901_0671761 | 3300038443 | Bacteria | 1037 |
| 409 | Ga0395901_0688838 | 3300038443 | Bacteria | 1021 |
| 410 | Ga0436363_0870267 | 3300039450 | Bacteria | 2358 |
| 411 | Ga0439466_0031676 | 3300041411 | Bacteria | 1807 |
| 412 | Ga0439466_0138311 | 3300041411 | Bacteria | 748 |
| 413 | Ga0439465_0021404 | 3300041413 | Bacteria | 2027 |
| 414 | Ga0451789_0744550 | 3300041443 | Bacteria | 1630 |
| 415 | Ga0451791_1567305 | 3300041451 | Bacteria | 650 |
| 416 | Ga0451802_0456888 | 3300041460 | Bacteria | 904 |
| 417 | Ga0451839_1130307 | 3300041496 | Bacteria | 1548 |
| 418 | Ga0451841_0068232 | 3300041498 | Bacteria | 757 |
| 419 | Ga0451849_1320375 | 3300041505 | Bacteria | 1378 |
| 420 | Ga0451853_0116443 | 3300041512 | Bacteria | 647 |
| 421 | Ga0439431_0092733 | 3300041997 | Bacteria | 824 |
| 422 | Ga0439449_0114735 | 3300042007 | Bacteria | 999 |
| 423 | Ga0439462_0091124 | 3300042015 | Bacteria | 836 |
| 424 | Ga0450920_037838 | 3300042122 | Bacteria | 959 |
| 425 | Ga0439434_0209834 | 3300042435 | Bacteria | 658 |
| 426 | Ga0466969_0009042 | 3300044656 | Bacteria | 5278 |
| 427 | Ga0466969_0012357 | 3300044656 | Bacteria | 4504 |
| 428 | Ga0466969_0014849 | 3300044656 | Bacteria | 4089 |
| 429 | Ga0466969_0086269 | 3300044656 | Bacteria | 1492 |
| 430 | Ga0466969_0500522 | 3300044656 | Bacteria | 554 |
| 431 | Ga0466965_0002917 | 3300044683 | Bacteria | 7391 |
| 432 | Ga0466965_0085356 | 3300044683 | Bacteria | 1600 |
| 433 | Ga0466965_0204621 | 3300044683 | Unclassified | 1048 |
| 434 | Ga0466966_0012747 | 3300044684 | Bacteria | 5572 |
| 435 | Ga0466966_0015365 | 3300044684 | Bacteria | 5063 |
| 436 | Ga0466966_0027387 | 3300044684 | Bacteria | 3717 |
| 437 | Ga0466966_0027652 | 3300044684 | Bacteria | 3697 |
| 438 | Ga0466966_0041116 | 3300044684 | Bacteria | 2971 |
| 439 | Ga0466961_0002159 | 3300044693 | Bacteria | 12238 |
| 440 | Ga0466961_0008083 | 3300044693 | Bacteria | 6704 |
| 441 | Ga0466961_0040907 | 3300044693 | Bacteria | 2971 |
| 442 | Ga0466961_0190679 | 3300044693 | Bacteria | 1270 |
| 443 | Ga0466963_0906651 | 3300044694 | Bacteria | 621 |
| 444 | Ga0466968_0016580 | 3300044735 | Bacteria | 2935 |
| 445 | Ga0466968_0137551 | 3300044735 | Bacteria | 1115 |
| 446 | Ga0466970_0002619 | 3300044765 | Bacteria | 8681 |
| 447 | Ga0466970_0012602 | 3300044765 | Bacteria | 4325 |
| 448 | Ga0466970_0059479 | 3300044765 | Bacteria | 2046 |
| 449 | Ga0466957_0007034 | 3300044842 | Bacteria | 6359 |
| 450 | Ga0466957_0039939 | 3300044842 | Bacteria | 2832 |
| 451 | Ga0466957_0150838 | 3300044842 | Unclassified | 1503 |
| 452 | Ga0466959_0005778 | 3300045049 | Bacteria | 8520 |
| 453 | Ga0466959_0008526 | 3300045049 | Bacteria | 7254 |
| 454 | Ga0466959_0048015 | 3300045049 | Bacteria | 3138 |
| 455 | Ga0466959_0070011 | 3300045049 | Bacteria | 2541 |
| 456 | Ga0466959_0100592 | 3300045049 | Bacteria | 2069 |
| 457 | Ga0466959_0376904 | 3300045049 | Bacteria | 966 |
| 458 | Ga0451576_0673067 | 3300045051 | Bacteria | 1087 |
| 459 | Ga0466958_0005296 | 3300045836 | Bacteria | 6921 |
| 460 | Ga0466958_0079373 | 3300045836 | Unclassified | 2018 |
| 461 | Ga0466958_0331865 | 3300045836 | Bacteria | 978 |
| 462 | Ga0466967_0066737 | 3300045976 | Bacteria | 3207 |
| 463 | Ga0495617_003222 | 3300046452 | Bacteria | 6198 |
| 464 | Ga0495627_008180 | 3300046453 | Bacteria | 3937 |
| 465 | Ga0495592_0002225 | 3300046454 | Bacteria | 13688 |
| 466 | Ga0495603_0030348 | 3300046455 | Bacteria | 3256 |
| 467 | Ga0495603_0046262 | 3300046455 | Bacteria | 2593 |
| 468 | Ga0495590_0080086 | 3300046457 | Bacteria | 1150 |
| 469 | Ga0495638_0011589 | 3300046460 | Bacteria | 6074 |
| 470 | Ga0495638_0435671 | 3300046460 | Bacteria | 672 |
| 471 | Ga0495651_0013966 | 3300046462 | Bacteria | 6211 |
| 472 | Ga0495650_0018771 | 3300046471 | Bacteria | 3428 |
| 473 | Ga0495580_0047649 | 3300046472 | Bacteria | 3037 |
| 474 | Ga0495580_0182139 | 3300046472 | Bacteria | 1450 |
| 475 | Ga0495580_0399003 | 3300046472 | Bacteria | 927 |
| 476 | Ga0495605_0009619 | 3300046474 | Bacteria | 5429 |
| 477 | Ga0495605_0172835 | 3300046474 | Bacteria | 954 |
| 478 | Ga0495584_0159084 | 3300046491 | Bacteria | 1148 |
| 479 | Ga0495594_0805226 | 3300046499 | Bacteria | 529 |
| 480 | Ga0495596_0404284 | 3300046500 | Bacteria | 532 |
| 481 | Ga0495607_0003992 | 3300046501 | Bacteria | 11086 |
| 482 | Ga0495583_0017895 | 3300046506 | Bacteria | 3748 |
| 483 | Ga0495606_0128253 | 3300046507 | Bacteria | 1511 |
| 484 | Ga0495608_0233270 | 3300046511 | Bacteria | 1151 |
| 485 | Ga0495616_0008546 | 3300046513 | Bacteria | 6055 |
| 486 | Ga0495618_0397690 | 3300046514 | Bacteria | 843 |
| 487 | Ga0495628_0061133 | 3300046516 | Bacteria | 2954 |
| 488 | Ga0495630_0978324 | 3300046517 | Bacteria | 643 |
| 489 | Ga0495632_0013141 | 3300046519 | Bacteria | 4740 |
| 490 | Ga0495632_0253038 | 3300046519 | Bacteria | 789 |
| 491 | Ga0495643_0328357 | 3300046522 | Bacteria | 690 |
| 492 | Ga0495644_0102722 | 3300046523 | Bacteria | 1082 |
| 493 | Ga0495648_0056053 | 3300046524 | Bacteria | 2373 |
| 494 | Ga0495663_0001454 | 3300046525 | Bacteria | 7467 |
| 495 | Ga0495663_0003151 | 3300046525 | Bacteria | 4809 |
| 496 | Ga0495663_0006965 | 3300046525 | Bacteria | 3118 |
| 497 | Ga0495663_0144045 | 3300046525 | Bacteria | 810 |
| 498 | Ga0495642_0129201 | 3300046528 | Bacteria | 1087 |
| 499 | Ga0495652_0713977 | 3300046529 | Bacteria | 673 |
| 500 | Ga0495654_0013759 | 3300046530 | Bacteria | 4323 |
| 501 | Ga0495665_0326364 | 3300046531 | Bacteria | 783 |
| 502 | Ga0495587_0050129 | 3300046536 | Bacteria | 2470 |
| 503 | Ga0495609_0014953 | 3300046538 | Bacteria | 3641 |
| 504 | Ga0495621_0107422 | 3300046539 | Bacteria | 1067 |
| 505 | Ga0495597_0218746 | 3300046542 | Bacteria | 757 |
| 506 | Ga0495645_0011752 | 3300046543 | Bacteria | 6166 |
| 507 | Ga0495622_0156788 | 3300046557 | Bacteria | 1028 |
| 508 | Ga0495633_0002319 | 3300046558 | Bacteria | 13550 |
| 509 | Ga0495633_0392788 | 3300046558 | Bacteria | 627 |
| 510 | Ga0495667_0071090 | 3300046559 | Bacteria | 2270 |
| 511 | Ga0495656_0110402 | 3300046615 | Bacteria | 1285 |
| 512 | Ga0495656_0417213 | 3300046615 | Bacteria | 704 |
| 513 | Ga0495668_0163383 | 3300046616 | Bacteria | 1220 |
| 514 | Ga0495668_0213174 | 3300046616 | Bacteria | 1057 |
| 515 | Ga0495668_0770872 | 3300046616 | Bacteria | 532 |
| 516 | Ga0495625_0020420 | 3300046660 | Bacteria | 5115 |
| 517 | Ga0495625_0043325 | 3300046660 | Bacteria | 3264 |
| 518 | Ga0495625_0131372 | 3300046660 | Bacteria | 1696 |
| 519 | Ga0495635_0054146 | 3300046663 | Bacteria | 2764 |
| 520 | Ga0495659_0052725 | 3300046664 | Bacteria | 1485 |
| 521 | Ga0495661_0002545 | 3300046665 | Bacteria | 13993 |
| 522 | Ga0495661_0220140 | 3300046665 | Bacteria | 984 |
| 523 | Ga0495588_0131315 | 3300046674 | Bacteria | 1321 |
| 524 | Ga0495599_0015597 | 3300046678 | Bacteria | 4716 |
| 525 | Ga0495623_0131586 | 3300046679 | Bacteria | 1497 |
| 526 | Ga0495646_0328729 | 3300046680 | Bacteria | 804 |
| 527 | Ga0495669_0011283 | 3300046684 | Bacteria | 3792 |
| 528 | Ga0495670_0273949 | 3300046691 | Bacteria | 902 |
| 529 | Ga0495649_0005932 | 3300046694 | Bacteria | 7658 |
| 530 | Ga0495649_0041294 | 3300046694 | Bacteria | 2524 |
| 531 | Ga0495649_0072591 | 3300046694 | Bacteria | 1845 |
| 532 | Ga0495600_0154182 | 3300046809 | Bacteria | 1486 |
| 533 | Ga0495660_0211114 | 3300046810 | Bacteria | 921 |
| 534 | Ga0495604_0003181 | 3300047317 | Bacteria | 13120 |
| 535 | Ga0495674_0004438 | 3300047319 | Bacteria | 13500 |
| 536 | Ga0495674_0614502 | 3300047319 | Bacteria | 860 |
| 537 | Ga0495672_0029380 | 3300047320 | Bacteria | 3462 |
| 538 | Ga0495680_0035497 | 3300047322 | Bacteria | 4015 |
| 539 | Ga0495683_0013754 | 3300047323 | Bacteria | 4225 |
| 540 | Ga0495683_0341033 | 3300047323 | Bacteria | 634 |
| 541 | Ga0495687_068987 | 3300047443 | Bacteria | 1425 |
| 542 | Ga0495675_0160969 | 3300047444 | Bacteria | 1382 |
| 543 | Ga0495677_0259805 | 3300047445 | Bacteria | 680 |
| 544 | Ga0495673_0016440 | 3300047469 | Bacteria | 3782 |
| 545 | Ga0495681_0002463 | 3300047470 | Bacteria | 13207 |
| 546 | Ga0495684_0291672 | 3300047471 | Bacteria | 1174 |
| 547 | Ga0495602_0040219 | 3300048088 | Bacteria | 4292 |
| 548 | Ga0495615_0089315 | 3300048090 | Bacteria | 856 |
| 549 | Ga0495626_0297573 | 3300048091 | Bacteria | 638 |
| 550 | Ga0496100_0170035 | 3300048903 | Bacteria | 1569 |
| 551 | Ga0496100_0222007 | 3300048903 | Bacteria | 1387 |
| 552 | Ga0496100_0516761 | 3300048903 | Bacteria | 921 |
| 553 | Ga0496101_0047565 | 3300048904 | Bacteria | 3080 |
| 554 | Ga0496101_0270117 | 3300048904 | Bacteria | 1327 |
| 555 | Ga0496101_1559499 | 3300048904 | Bacteria | 513 |
| 556 | Ga0496102_0329157 | 3300048905 | Bacteria | 1439 |
| 557 | Ga0496104_0001998 | 3300048907 | Bacteria | 17696 |
| 558 | Ga0496104_0031337 | 3300048907 | Bacteria | 4944 |
| 559 | Ga0496104_0056798 | 3300048907 | Bacteria | 3703 |
| 560 | Ga0496104_0144181 | 3300048907 | Bacteria | 2287 |
| 561 | Ga0496105_0000273 | 3300048908 | Bacteria | 34154 |
| 562 | Ga0496105_0036399 | 3300048908 | Bacteria | 4054 |
| 563 | Ga0496105_0485746 | 3300048908 | Bacteria | 971 |
| 564 | Ga0496106_0092277 | 3300048909 | Bacteria | 2339 |
| 565 | Ga0496106_0097973 | 3300048909 | Bacteria | 2271 |
| 566 | Ga0496106_0611028 | 3300048909 | Bacteria | 873 |
| 567 | Ga0496106_1310593 | 3300048909 | Bacteria | 562 |
| 568 | Ga0496107_0194645 | 3300048910 | Bacteria | 1507 |
| 569 | Ga0496109_0235182 | 3300048912 | Bacteria | 1724 |
| 570 | Ga0496111_1213658 | 3300048914 | Bacteria | 534 |
| 571 | Ga0496112_0055763 | 3300048915 | Bacteria | 3887 |
| 572 | Ga0496112_1579585 | 3300048915 | Bacteria | 569 |
| 573 | Ga0496113_0065714 | 3300048916 | Bacteria | 2746 |
| 574 | Ga0496113_0083606 | 3300048916 | Bacteria | 2449 |
| 575 | Ga0496114_0067184 | 3300048917 | Bacteria | 3007 |
| 576 | Ga0496114_0943391 | 3300048917 | Bacteria | 745 |
| 577 | Ga0496115_0258584 | 3300048918 | Bacteria | 1432 |
| 578 | Ga0496115_0315331 | 3300048918 | Bacteria | 1280 |
| 579 | Ga0496115_0418158 | 3300048918 | Bacteria | 1086 |
| 580 | Ga0496116_0150245 | 3300048919 | Bacteria | 1295 |
| 581 | Ga0496116_0220999 | 3300048919 | Bacteria | 971 |
| 582 | Ga0496118_0037341 | 3300048921 | Bacteria | 3911 |
| 583 | Ga0496119_0101956 | 3300048922 | Bacteria | 1610 |
| 584 | Ga0496121_0015462 | 3300048924 | Bacteria | 7994 |
| 585 | Ga0496121_0017429 | 3300048924 | Bacteria | 7340 |
| 586 | Ga0496121_0029157 | 3300048924 | Bacteria | 5114 |
| 587 | Ga0496122_0581222 | 3300048925 | Bacteria | 527 |
| 588 | Ga0496123_0086640 | 3300048926 | Bacteria | 1877 |
| 589 | Ga0496124_0334716 | 3300048927 | Bacteria | 1078 |
| 590 | Ga0496124_0786627 | 3300048927 | Bacteria | 591 |
| 591 | Ga0496125_0171819 | 3300048928 | Bacteria | 1456 |
| 592 | Ga0496125_0412315 | 3300048928 | Bacteria | 786 |
| 593 | Ga0496126_0020176 | 3300048929 | Bacteria | 6540 |
| 594 | Ga0496126_0058700 | 3300048929 | Bacteria | 3467 |
| 595 | Ga0496126_0068978 | 3300048929 | Bacteria | 3155 |
| 596 | Ga0496126_0308387 | 3300048929 | Bacteria | 1304 |
| 597 | Ga0496126_0312928 | 3300048929 | Bacteria | 1292 |
| 598 | Ga0496126_0319806 | 3300048929 | Bacteria | 1276 |
| 599 | Ga0496126_0461265 | 3300048929 | Bacteria | 1021 |
| 600 | Ga0495682_0015370 | 3300049460 | Bacteria | 2900 |
| 601 | Ga0501033_0473097 | 3300049570 | Bacteria | 869 |
| 602 | Ga0501036_0778379 | 3300049572 | Bacteria | 789 |
| 603 | Ga0501038_0666857 | 3300049574 | Bacteria | 782 |
| 604 | Ga0501047_0111567 | 3300049581 | Bacteria | 2617 |
| 605 | Ga0501047_0456801 | 3300049581 | Bacteria | 1106 |
| 606 | Ga0501047_0596781 | 3300049581 | Bacteria | 926 |
| 607 | Ga0501073_0547789 | 3300049589 | Bacteria | 799 |
| 608 | Ga0501073_0924066 | 3300049589 | Bacteria | 601 |
| 609 | Ga0501074_0228927 | 3300049590 | Bacteria | 1323 |
| 610 | Ga0501253_098729 | 3300049683 | Bacteria | 682 |
| 611 | Ga0501080_0144322 | 3300049742 | Bacteria | 2200 |
| 612 | Ga0501044_0021138 | 3300049823 | Bacteria | 6948 |
| 613 | Ga0501044_0270015 | 3300049823 | Bacteria | 1637 |
| 614 | nmdc:mga03683_175186_c1 | 3300050489 | Bacteria | 976 |
| 615 | nmdc:mga03683_28674_c1 | 3300050489 | Bacteria | 2215 |
| 616 | nmdc:mga03n38_273943_c1 | 3300050490 | Bacteria | 899 |
| 617 | nmdc:mga03n38_3122_c1 | 3300050490 | Bacteria | 5269 |
| 618 | nmdc:mga00v17_191711_c1 | 3300050491 | Bacteria | 1320 |
| 619 | nmdc:mga00v17_58238_c1 | 3300050491 | Bacteria | 2366 |
| 620 | nmdc:mga0yw44_13300_c1 | 3300050492 | Bacteria | 4327 |
| 621 | nmdc:mga0yw44_15927_c1 | 3300050492 | Bacteria | 4045 |
| 622 | nmdc:mga0yw44_27867_c1 | 3300050492 | Bacteria | 3242 |
| 623 | nmdc:mga0yw44_37622_c1 | 3300050492 | Bacteria | 2858 |
| 624 | nmdc:mga0yw44_70692_c1 | 3300050492 | Bacteria | 2165 |
| 625 | nmdc:mga0k408_117902_c1 | 3300050493 | Bacteria | 1571 |
| 626 | nmdc:mga06z11_14236_c1 | 3300050494 | Bacteria | 3518 |
| 627 | nmdc:mga06z11_15398_c1 | 3300050494 | Bacteria | 3413 |
| 628 | nmdc:mga06z11_58849_c1 | 3300050494 | Bacteria | 1995 |
| 629 | nmdc:mga04h51_17050_c1 | 3300050495 | Bacteria | 2117 |
| 630 | nmdc:mga04h51_37503_c1 | 3300050495 | Bacteria | 1565 |
| 631 | nmdc:mga07m45_5526_c1 | 3300050496 | Bacteria | 6301 |
| 632 | nmdc:mga09592_252034_c1 | 3300050508 | Bacteria | 1530 |
| 633 | nmdc:mga08y16_51_c1 | 3300050511 | Bacteria | 105348 |
| 634 | nmdc:mga08y16_76847_c1 | 3300050511 | Bacteria | 3480 |
| 635 | nmdc:mga08x19_140240_c1 | 3300050514 | Bacteria | 1632 |
| 636 | nmdc:mga0sz30_101080_c2 | 3300050516 | Bacteria | 960 |
| 637 | nmdc:mga0sz30_35351_c2 | 3300050516 | Bacteria | 1271 |
| 638 | nmdc:mga0sz30_67386_c1 | 3300050516 | Bacteria | 1537 |
| 639 | Ga0495601_0000379 | 3300053077 | Bacteria | 23511 |
| 640 | Ga0495612_0001697 | 3300053078 | Bacteria | 9058 |
| 641 | Ga0495655_0083124 | 3300053083 | Bacteria | 919 |
| 642 | Ga0495595_0010843 | 3300053084 | Bacteria | 3800 |
| 643 | Ga0495595_0664721 | 3300053084 | Bacteria | 533 |
| 644 | Ga0495619_0005722 | 3300053085 | Bacteria | 7884 |
| 645 | Ga0500643_165727 | 3300053087 | Bacteria | 593 |
| 646 | Ga0500644_0478910 | 3300053088 | Bacteria | 547 |
| 647 | Ga0500644_0485992 | 3300053088 | Unclassified | 543 |
| 648 | Ga0500555_042115 | 3300053103 | Bacteria | 1269 |
| 649 | Ga0500628_136059 | 3300053129 | Bacteria | 678 |
| 650 | Ga0500642_0071449 | 3300053130 | Bacteria | 1580 |
| 651 | Ga0500655_117467 | 3300053133 | Bacteria | 563 |
| 652 | Ga0500577_0131826 | 3300053142 | Bacteria | 1048 |
| 653 | Ga0500604_0002531 | 3300053151 | Bacteria | 4987 |
| 654 | Ga0500616_0000231 | 3300053153 | Bacteria | 87444 |
| 655 | Ga0500616_0091885 | 3300053153 | Bacteria | 1501 |
| 656 | Ga0500645_015755 | 3300053730 | Bacteria | 2390 |
| 657 | Ga0466962_0261216 | 3300061719 | Bacteria | 852 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046514 | Ga0495618_0397690 | Ga0495618_0397690_393_827 | 143 |
| 2 | 3300049574 | Ga0501038_0666857 | Ga0501038_0666857_132_587 | 145 |
| 3 | iso_pu_bacteria | 2919462493 | 2919465605 | 147 |
| 4 | iso_pu_bacteria | 2929520902 | 2929526338 | 147 |
| 5 | 3300005333 | Ga0070677_10098517 | Ga0070677_100985172 | 148 |
| 6 | 3300005353 | Ga0070669_100407460 | Ga0070669_1004074601 | 148 |
| 7 | 3300005354 | Ga0070675_100055471 | Ga0070675_1000554711 | 148 |
| 8 | 3300005367 | Ga0070667_100076083 | Ga0070667_1000760834 | 148 |
| 9 | 3300005438 | Ga0070701_11012170 | Ga0070701_110121701 | 148 |
| 10 | 3300005459 | Ga0068867_100161280 | Ga0068867_1001612801 | 148 |
| 11 | 3300005543 | Ga0070672_100058890 | Ga0070672_1000588902 | 148 |
| 12 | 3300005617 | Ga0068859_100218559 | Ga0068859_1002185593 | 148 |
| 13 | 3300005719 | Ga0068861_101096342 | Ga0068861_1010963422 | 148 |
| 14 | 3300005840 | Ga0068870_10224425 | Ga0068870_102244252 | 148 |
| 15 | 3300006931 | Ga0097620_100218568 | Ga0097620_1002185683 | 148 |
| 16 | 3300009011 | Ga0105251_10219096 | Ga0105251_102190962 | 148 |
| 17 | 3300009553 | Ga0105249_10384842 | Ga0105249_103848422 | 148 |
| 18 | 3300014326 | Ga0157380_10140437 | Ga0157380_101404373 | 148 |
| 19 | 3300025893 | Ga0207682_10075318 | Ga0207682_100753181 | 148 |
| 20 | 3300025933 | Ga0207706_10070521 | Ga0207706_100705215 | 148 |
| 21 | 3300025940 | Ga0207691_10081903 | Ga0207691_100819032 | 148 |
| 22 | 3300025960 | Ga0207651_10026070 | Ga0207651_100260703 | 148 |
| 23 | 3300025972 | Ga0207668_10501411 | Ga0207668_105014112 | 148 |
| 24 | 3300025986 | Ga0207658_10885829 | Ga0207658_108858292 | 148 |
| 25 | 3300026089 | Ga0207648_10116615 | Ga0207648_101166153 | 148 |
| 26 | 3300026118 | Ga0207675_100783549 | Ga0207675_1007835492 | 148 |
| 27 | 3300026121 | Ga0207683_10091351 | Ga0207683_100913511 | 148 |
| 28 | 3300031548 | Ga0307408_100822667 | Ga0307408_1008226672 | 148 |
| 29 | 3300031824 | Ga0307413_11570608 | Ga0307413_115706081 | 148 |
| 30 | 3300031852 | Ga0307410_10114355 | Ga0307410_101143552 | 148 |
| 31 | 3300031901 | Ga0307406_10800219 | Ga0307406_108002191 | 148 |
| 32 | 3300032005 | Ga0307411_10122472 | Ga0307411_101224721 | 148 |
| 33 | 3300046455 | Ga0495603_0030348 | Ga0495603_0030348_2611_3069 | 148 |
| 34 | 3300046472 | Ga0495580_0047649 | Ga0495580_0047649_2140_2598 | 148 |
| 35 | 3300046472 | Ga0495580_0182139 | Ga0495580_0182139_590_1048 | 148 |
| 36 | 3300046472 | Ga0495580_0399003 | Ga0495580_0399003_272_730 | 148 |
| 37 | 3300046474 | Ga0495605_0009619 | Ga0495605_0009619_1802_2260 | 148 |
| 38 | 3300046506 | Ga0495583_0017895 | Ga0495583_0017895_971_1429 | 148 |
| 39 | 3300046513 | Ga0495616_0008546 | Ga0495616_0008546_5333_5791 | 148 |
| 40 | 3300046531 | Ga0495665_0326364 | Ga0495665_0326364_177_635 | 148 |
| 41 | 3300046539 | Ga0495621_0107422 | Ga0495621_0107422_458_949 | 148 |
| 42 | 3300046694 | Ga0495649_0072591 | Ga0495649_0072591_1350_1808 | 148 |
| 43 | 3300047319 | Ga0495674_0004438 | Ga0495674_0004438_6188_6646 | 148 |
| 44 | 3300047320 | Ga0495672_0029380 | Ga0495672_0029380_218_676 | 148 |
| 45 | 3300047323 | Ga0495683_0013754 | Ga0495683_0013754_230_688 | 148 |
| 46 | 3300047443 | Ga0495687_068987 | Ga0495687_068987_298_756 | 148 |
| 47 | 3300047445 | Ga0495677_0259805 | Ga0495677_0259805_133_591 | 148 |
| 48 | 3300047469 | Ga0495673_0016440 | Ga0495673_0016440_794_1252 | 148 |
| 49 | 3300048904 | Ga0496101_0270117 | Ga0496101_0270117_240_698 | 148 |
| 50 | 3300048907 | Ga0496104_0031337 | Ga0496104_0031337_552_1010 | 148 |
| 51 | 3300048907 | Ga0496104_0144181 | Ga0496104_0144181_1650_2108 | 148 |
| 52 | 3300048908 | Ga0496105_0036399 | Ga0496105_0036399_1012_1470 | 148 |
| 53 | 3300048909 | Ga0496106_0611028 | Ga0496106_0611028_393_851 | 148 |
| 54 | 3300048915 | Ga0496112_0055763 | Ga0496112_0055763_2783_3241 | 148 |
| 55 | 3300048916 | Ga0496113_0083606 | Ga0496113_0083606_216_674 | 148 |
| 56 | 3300048918 | Ga0496115_0418158 | Ga0496115_0418158_433_891 | 148 |
| 57 | 3300048919 | Ga0496116_0220999 | Ga0496116_0220999_73_531 | 148 |
| 58 | 3300048924 | Ga0496121_0015462 | Ga0496121_0015462_5695_6153 | 148 |
| 59 | 3300049460 | Ga0495682_0015370 | Ga0495682_0015370_761_1219 | 148 |
| 60 | 3300053078 | Ga0495612_0001697 | Ga0495612_0001697_8356_8805 | 148 |
| 61 | iso_pu_bacteria | 2643221621 | 2644124153 | 148 |
| 62 | iso_pu_bacteria | 2643221688 | 2644492854 | 148 |
| 63 | iso_pu_bacteria | 2791355199 | 2793079110 | 148 |
| 64 | iso_pu_bacteria | 2808606384 | 2808970475 | 148 |
| 65 | iso_pu_bacteria | 2808606390 | 2809005418 | 148 |
| 66 | iso_pu_bacteria | 2808606391 | 2809012181 | 148 |
| 67 | 3300003322 | rootL2_10103187 | rootL2_101031874 | 149 |
| 68 | 3300003781 | Ga0055536_1007742 | Ga0055536_10077422 | 149 |
| 69 | 3300003856 | Ga0058692_1000001 | Ga0058692_1000001220 | 149 |
| 70 | 3300005272 | Ga0065703_1000131 | Ga0065703_10001313 | 149 |
| 71 | 3300005289 | Ga0065704_10143141 | Ga0065704_101431411 | 149 |
| 72 | 3300005347 | Ga0070668_100072369 | Ga0070668_1000723693 | 149 |
| 73 | 3300005436 | Ga0070713_101234426 | Ga0070713_1012344261 | 149 |
| 74 | 3300005457 | Ga0070662_100594683 | Ga0070662_1005946831 | 149 |
| 75 | 3300005473 | Ga0074250_10309 | Ga0074250_103093 | 149 |
| 76 | 3300005844 | Ga0068862_100838924 | Ga0068862_1008389242 | 149 |
| 77 | 3300006028 | Ga0070717_10271232 | Ga0070717_102712322 | 149 |
| 78 | 3300006943 | Ga0099822_1001480 | Ga0099822_100148010 | 149 |
| 79 | 3300009011 | Ga0105251_10377892 | Ga0105251_103778921 | 149 |
| 80 | 3300009036 | Ga0105244_10003674 | Ga0105244_1000367410 | 149 |
| 81 | 3300009092 | Ga0105250_10002955 | Ga0105250_100029554 | 149 |
| 82 | 3300009148 | Ga0105243_10000266 | Ga0105243_1000026657 | 149 |
| 83 | 3300009148 | Ga0105243_10509428 | Ga0105243_105094282 | 149 |
| 84 | 3300012502 | Ga0157347_1004269 | Ga0157347_10042692 | 149 |
| 85 | 3300013104 | Ga0157370_10375663 | Ga0157370_103756633 | 149 |
| 86 | 3300013104 | Ga0157370_10375665 | Ga0157370_103756653 | 149 |
| 87 | 3300025711 | Ga0207696_1002904 | Ga0207696_10029048 | 149 |
| 88 | 3300025728 | Ga0207655_1000353 | Ga0207655_100035330 | 149 |
| 89 | 3300025735 | Ga0207713_1010634 | Ga0207713_10106345 | 149 |
| 90 | 3300025898 | Ga0207692_10456035 | Ga0207692_104560352 | 149 |
| 91 | 3300025910 | Ga0207684_10644341 | Ga0207684_106443411 | 149 |
| 92 | 3300025935 | Ga0207709_10000001 | Ga0207709_10000001594 | 149 |
| 93 | 3300027312 | Ga0209371_1000008 | Ga0209371_1000008352 | 149 |
| 94 | 3300030500 | Ga0268256_1000009 | Ga0268256_1000009352 | 149 |
| 95 | 3300031548 | Ga0307408_100068556 | Ga0307408_1000685563 | 149 |
| 96 | 3300031731 | Ga0307405_10204225 | Ga0307405_102042252 | 149 |
| 97 | 3300031824 | Ga0307413_10035168 | Ga0307413_100351684 | 149 |
| 98 | 3300031852 | Ga0307410_10158694 | Ga0307410_101586941 | 149 |
| 99 | 3300031911 | Ga0307412_11449999 | Ga0307412_114499991 | 149 |
| 100 | 3300031995 | Ga0307409_100657915 | Ga0307409_1006579152 | 149 |
| 101 | 3300031995 | Ga0307409_101230461 | Ga0307409_1012304611 | 149 |
| 102 | 3300032126 | Ga0307415_101092084 | Ga0307415_1010920841 | 149 |
| 103 | 3300033180 | Ga0307510_10021950 | Ga0307510_100219503 | 149 |
| 104 | 3300037466 | Ga0395898_0192576 | Ga0395898_0192576_601_1053 | 149 |
| 105 | 3300037471 | Ga0395905_0211175 | Ga0395905_0211175_198_650 | 149 |
| 106 | 3300038443 | Ga0395901_0090246 | Ga0395901_0090246_854_1306 | 149 |
| 107 | 3300044684 | Ga0466966_0027387 | Ga0466966_0027387_303_764 | 149 |
| 108 | 3300045049 | Ga0466959_0376904 | Ga0466959_0376904_399_860 | 149 |
| 109 | 3300045836 | Ga0466958_0331865 | Ga0466958_0331865_53_514 | 149 |
| 110 | 3300046453 | Ga0495627_008180 | Ga0495627_008180_2470_2919 | 149 |
| 111 | 3300046501 | Ga0495607_0003992 | Ga0495607_0003992_3806_4255 | 149 |
| 112 | 3300046519 | Ga0495632_0013141 | Ga0495632_0013141_53_502 | 149 |
| 113 | 3300046519 | Ga0495632_0253038 | Ga0495632_0253038_288_737 | 149 |
| 114 | 3300046525 | Ga0495663_0001454 | Ga0495663_0001454_4012_4461 | 149 |
| 115 | 3300046525 | Ga0495663_0003151 | Ga0495663_0003151_2473_2922 | 149 |
| 116 | 3300046525 | Ga0495663_0006965 | Ga0495663_0006965_1204_1653 | 149 |
| 117 | 3300046530 | Ga0495654_0013759 | Ga0495654_0013759_16_465 | 149 |
| 118 | 3300046558 | Ga0495633_0002319 | Ga0495633_0002319_11668_12117 | 149 |
| 119 | 3300046665 | Ga0495661_0002545 | Ga0495661_0002545_11648_12097 | 149 |
| 120 | 3300046674 | Ga0495588_0131315 | Ga0495588_0131315_109_570 | 149 |
| 121 | 3300046694 | Ga0495649_0005932 | Ga0495649_0005932_275_724 | 149 |
| 122 | 3300047470 | Ga0495681_0002463 | Ga0495681_0002463_2263_2712 | 149 |
| 123 | 3300048090 | Ga0495615_0089315 | Ga0495615_0089315_171_620 | 149 |
| 124 | 3300048914 | Ga0496111_1213658 | Ga0496111_1213658_40_489 | 149 |
| 125 | 3300048917 | Ga0496114_0067184 | Ga0496114_0067184_2075_2524 | 149 |
| 126 | 3300049683 | Ga0501253_098729 | Ga0501253_098729_42_503 | 149 |
| 127 | 3300050491 | nmdc:mga00v17_191711_c1 | nmdc:mga00v17_191711_c1_468_917 | 149 |
| 128 | iso_pu_bacteria | 2513237102 | 2513700626 | 149 |
| 129 | iso_pu_bacteria | 2515154112 | 2515628898 | 149 |
| 130 | iso_pu_bacteria | 2617270735 | 2617352900 | 149 |
| 131 | iso_pu_bacteria | 2617270741 | 2617376428 | 149 |
| 132 | iso_pu_bacteria | 2791355196 | 2793063997 | 149 |
| 133 | iso_pu_bacteria | 2824617872 | 2824619877 | 149 |
| 134 | iso_pu_bacteria | 2824626560 | 2824629485 | 149 |
| 135 | iso_pu_bacteria | 2824635225 | 2824637126 | 149 |
| 136 | iso_pu_bacteria | 2824644064 | 2824650451 | 149 |
| 137 | iso_pu_bacteria | 2824714736 | 2824720979 | 149 |
| 138 | iso_pu_bacteria | 2824723954 | 2824730349 | 149 |
| 139 | iso_pu_bacteria | 2824732956 | 2824738399 | 149 |
| 140 | iso_pu_bacteria | 2847930680 | 2847935310 | 149 |
| 141 | iso_pu_bacteria | 2849076700 | 2849079971 | 149 |
| 142 | iso_pu_bacteria | 2857509624 | 2857510675 | 149 |
| 143 | iso_pu_bacteria | 2874628541 | 2874631100 | 149 |
| 144 | iso_pu_bacteria | 2879083081 | 2879088946 | 149 |
| 145 | iso_pu_bacteria | 2881364244 | 2881366740 | 149 |
| 146 | iso_pu_bacteria | 2888419890 | 2888423767 | 149 |
| 147 | iso_pu_bacteria | 2908775508 | 2908779468 | 149 |
| 148 | iso_pu_bacteria | 2935975950 | 2935980994 | 149 |
| 149 | iso_pu_bacteria | 8019619141 | 8019627388 | 149 |
| 150 | iso_pu_bacteria | 8019629233 | 8019635187 | 149 |
| 151 | iso_pu_bacteria | 8019659431 | 8019663029 | 149 |
| 152 | iso_pu_bacteria | 8019668869 | 8019672627 | 149 |
| 153 | iso_pu_bacteria | 8019678201 | 8019683533 | 149 |
| 154 | 3300003781 | Ga0055536_1006143 | Ga0055536_10061431 | 150 |
| 155 | 3300003791 | Ga0055530_10002071 | Ga0055530_1000207112 | 150 |
| 156 | 3300005366 | Ga0070659_100314000 | Ga0070659_1003140002 | 150 |
| 157 | 3300005548 | Ga0070665_100818314 | Ga0070665_1008183142 | 150 |
| 158 | 3300005615 | Ga0070702_100507423 | Ga0070702_1005074232 | 150 |
| 159 | 3300006178 | Ga0075367_10065291 | Ga0075367_100652912 | 150 |
| 160 | 3300010375 | Ga0105239_12403338 | Ga0105239_124033382 | 150 |
| 161 | 3300013306 | Ga0163162_10536128 | Ga0163162_105361282 | 150 |
| 162 | 3300014969 | Ga0157376_12740164 | Ga0157376_127401641 | 150 |
| 163 | 3300025298 | Ga0209050_1000829 | Ga0209050_100082932 | 150 |
| 164 | 3300025303 | Ga0209051_1005795 | Ga0209051_10057953 | 150 |
| 165 | 3300025304 | Ga0209257_1006755 | Ga0209257_10067554 | 150 |
| 166 | 3300028379 | Ga0268266_10959847 | Ga0268266_109598471 | 150 |
| 167 | 3300037466 | Ga0395898_0240966 | Ga0395898_0240966_360_812 | 150 |
| 168 | 3300037471 | Ga0395905_0145461 | Ga0395905_0145461_798_1250 | 150 |
| 169 | 3300041512 | Ga0451853_0116443 | Ga0451853_0116443_73_528 | 150 |
| 170 | 3300044735 | Ga0466968_0016580 | Ga0466968_0016580_2218_2673 | 150 |
| 171 | 3300048909 | Ga0496106_1310593 | Ga0496106_1310593_35_490 | 150 |
| 172 | 3300048928 | Ga0496125_0412315 | Ga0496125_0412315_80_535 | 150 |
| 173 | 3300050492 | nmdc:mga0yw44_13300_c1 | nmdc:mga0yw44_13300_c1_394_849 | 150 |
| 174 | 3300050494 | nmdc:mga06z11_14236_c1 | nmdc:mga06z11_14236_c1_2338_2793 | 150 |
| 175 | 3300053153 | Ga0500616_0091885 | Ga0500616_0091885_692_1147 | 150 |
| 176 | iso_pu_bacteria | 2508501042 | 2508698871 | 150 |
| 177 | iso_pu_bacteria | 2513237098 | 2513676999 | 150 |
| 178 | iso_pu_bacteria | 2903768456 | 2903769215 | 150 |
| 179 | iso_pu_bacteria | 2933577622 | 2933580362 | 150 |
| 180 | iso_pu_bacteria | 2935648319 | 2935651877 | 150 |
| 181 | iso_pu_bacteria | 2935656913 | 2935660687 | 150 |
| 182 | iso_pu_bacteria | 2935908558 | 2935914059 | 150 |
| 183 | iso_pu_bacteria | 2935916978 | 2935921228 | 150 |
| 184 | iso_pu_bacteria | 2935926038 | 2935931752 | 150 |
| 185 | iso_pu_bacteria | 2935934488 | 2935940313 | 150 |
| 186 | iso_pu_bacteria | 2935942939 | 2935947862 | 150 |
| 187 | iso_pu_bacteria | 2935951376 | 2935956597 | 150 |
| 188 | iso_pu_bacteria | 2935967501 | 2935973390 | 150 |
| 189 | iso_pu_bacteria | 2935984226 | 2935989554 | 150 |
| 190 | iso_pu_bacteria | 2936011229 | 2936014743 | 150 |
| 191 | iso_pu_bacteria | 2936019824 | 2936023460 | 150 |
| 192 | iso_pu_bacteria | 2936028420 | 2936032488 | 150 |
| 193 | iso_pu_bacteria | 2936046547 | 2936050484 | 150 |
| 194 | iso_pu_bacteria | 2936055302 | 2936059024 | 150 |
| 195 | iso_pu_bacteria | 8016630954 | 8016631751 | 150 |
| 196 | iso_pu_bacteria | 8019687851 | 8019689278 | 150 |
| 197 | iso_pu_bacteria | 8055742211 | 8055742777 | 150 |
| 198 | 3300002987 | JGI25159J45721_1024677 | JGI25159J45721_10246772 | 151 |
| 199 | 3300003215 | JGI25153J46596_10001083 | JGI25153J46596_100010836 | 151 |
| 200 | 3300003354 | JGI25160J50197_1000042 | JGI25160J50197_1000042151 | 151 |
| 201 | 3300003354 | JGI25160J50197_1000866 | JGI25160J50197_100086626 | 151 |
| 202 | 3300003354 | JGI25160J50197_1006131 | JGI25160J50197_10061312 | 151 |
| 203 | 3300003374 | JGI25161J50226_1000305 | JGI25161J50226_100030526 | 151 |
| 204 | 3300003374 | JGI25161J50226_1001004 | JGI25161J50226_100100414 | 151 |
| 205 | 3300003771 | Ga0055526_1010501 | Ga0055526_10105019 | 151 |
| 206 | 3300003781 | Ga0055536_1017623 | Ga0055536_10176234 | 151 |
| 207 | 3300003781 | Ga0055536_1076350 | Ga0055536_10763501 | 151 |
| 208 | 3300003792 | Ga0055540_1030767 | Ga0055540_10307672 | 151 |
| 209 | 3300003794 | Ga0055531_10009625 | Ga0055531_100096254 | 151 |
| 210 | 3300003794 | Ga0055531_10010201 | Ga0055531_100102013 | 151 |
| 211 | 3300003794 | Ga0055531_10032714 | Ga0055531_100327143 | 151 |
| 212 | 3300003794 | Ga0055531_10063562 | Ga0055531_100635622 | 151 |
| 213 | 3300003794 | Ga0055531_10097207 | Ga0055531_100972071 | 151 |
| 214 | 3300004625 | Ga0055543_1004885 | Ga0055543_10048851 | 151 |
| 215 | 3300004625 | Ga0055543_1009945 | Ga0055543_10099451 | 151 |
| 216 | 3300005262 | Ga0065165_1000174 | Ga0065165_10001741 | 151 |
| 217 | 3300005262 | Ga0065165_1002379 | Ga0065165_100237926 | 151 |
| 218 | 3300005328 | Ga0070676_10328699 | Ga0070676_103286992 | 151 |
| 219 | 3300005334 | Ga0068869_100275724 | Ga0068869_1002757243 | 151 |
| 220 | 3300005347 | Ga0070668_100740222 | Ga0070668_1007402222 | 151 |
| 221 | 3300005355 | Ga0070671_100162396 | Ga0070671_1001623962 | 151 |
| 222 | 3300005356 | Ga0070674_100606065 | Ga0070674_1006060652 | 151 |
| 223 | 3300005434 | Ga0070709_10650413 | Ga0070709_106504131 | 151 |
| 224 | 3300005437 | Ga0070710_10201708 | Ga0070710_102017083 | 151 |
| 225 | 3300005439 | Ga0070711_100021672 | Ga0070711_1000216725 | 151 |
| 226 | 3300005455 | Ga0070663_100010319 | Ga0070663_1000103194 | 151 |
| 227 | 3300005456 | Ga0070678_100558792 | Ga0070678_1005587922 | 151 |
| 228 | 3300005466 | Ga0070685_10104337 | Ga0070685_101043371 | 151 |
| 229 | 3300005530 | Ga0070679_101368979 | Ga0070679_1013689791 | 151 |
| 230 | 3300005543 | Ga0070672_100355511 | Ga0070672_1003555111 | 151 |
| 231 | 3300005546 | Ga0070696_100257861 | Ga0070696_1002578613 | 151 |
| 232 | 3300005548 | Ga0070665_100090619 | Ga0070665_1000906191 | 151 |
| 233 | 3300005578 | Ga0068854_100181619 | Ga0068854_1001816192 | 151 |
| 234 | 3300005578 | Ga0068854_100312121 | Ga0068854_1003121212 | 151 |
| 235 | 3300005614 | Ga0068856_101644676 | Ga0068856_1016446762 | 151 |
| 236 | 3300005615 | Ga0070702_100198571 | Ga0070702_1001985712 | 151 |
| 237 | 3300005719 | Ga0068861_100372557 | Ga0068861_1003725572 | 151 |
| 238 | 3300005843 | Ga0068860_100611825 | Ga0068860_1006118252 | 151 |
| 239 | 3300005844 | Ga0068862_100263365 | Ga0068862_1002633654 | 151 |
| 240 | 3300005937 | Ga0081455_10008875 | Ga0081455_100088758 | 151 |
| 241 | 3300005983 | Ga0081540_1025746 | Ga0081540_10257462 | 151 |
| 242 | 3300005983 | Ga0081540_1069324 | Ga0081540_10693242 | 151 |
| 243 | 3300006038 | Ga0075365_10021797 | Ga0075365_100217972 | 151 |
| 244 | 3300006038 | Ga0075365_10259007 | Ga0075365_102590072 | 151 |
| 245 | 3300006038 | Ga0075365_10273586 | Ga0075365_102735862 | 151 |
| 246 | 3300006042 | Ga0075368_10007588 | Ga0075368_100075884 | 151 |
| 247 | 3300006048 | Ga0075363_100286802 | Ga0075363_1002868022 | 151 |
| 248 | 3300006051 | Ga0075364_10068084 | Ga0075364_100680842 | 151 |
| 249 | 3300006175 | Ga0070712_100232157 | Ga0070712_1002321573 | 151 |
| 250 | 3300006177 | Ga0075362_10072044 | Ga0075362_100720442 | 151 |
| 251 | 3300006178 | Ga0075367_10009129 | Ga0075367_100091292 | 151 |
| 252 | 3300006186 | Ga0075369_10407673 | Ga0075369_104076731 | 151 |
| 253 | 3300006195 | Ga0075366_10124393 | Ga0075366_101243932 | 151 |
| 254 | 3300006353 | Ga0075370_10016633 | Ga0075370_100166333 | 151 |
| 255 | 3300006358 | Ga0068871_101621804 | Ga0068871_1016218041 | 151 |
| 256 | 3300006844 | Ga0075428_100005277 | Ga0075428_1000052773 | 151 |
| 257 | 3300006846 | Ga0075430_100166379 | Ga0075430_1001663793 | 151 |
| 258 | 3300006846 | Ga0075430_100251539 | Ga0075430_1002515392 | 151 |
| 259 | 3300007788 | Ga0099795_10059300 | Ga0099795_100593002 | 151 |
| 260 | 3300009093 | Ga0105240_11082850 | Ga0105240_110828501 | 151 |
| 261 | 3300009094 | Ga0111539_10000616 | Ga0111539_1000061635 | 151 |
| 262 | 3300009094 | Ga0111539_10038859 | Ga0111539_100388594 | 151 |
| 263 | 3300009098 | Ga0105245_10167231 | Ga0105245_101672313 | 151 |
| 264 | 3300009098 | Ga0105245_11825840 | Ga0105245_118258401 | 151 |
| 265 | 3300009147 | Ga0114129_10294342 | Ga0114129_102943421 | 151 |
| 266 | 3300009177 | Ga0105248_10044933 | Ga0105248_100449333 | 151 |
| 267 | 3300009177 | Ga0105248_10770113 | Ga0105248_107701131 | 151 |
| 268 | 3300009545 | Ga0105237_10401732 | Ga0105237_104017322 | 151 |
| 269 | 3300009545 | Ga0105237_10571391 | Ga0105237_105713912 | 151 |
| 270 | 3300009551 | Ga0105238_10232064 | Ga0105238_102320643 | 151 |
| 271 | 3300009986 | Ga0105033_103627 | Ga0105033_1036272 | 151 |
| 272 | 3300010375 | Ga0105239_10114797 | Ga0105239_101147972 | 151 |
| 273 | 3300011119 | Ga0105246_10035339 | Ga0105246_100353394 | 151 |
| 274 | 3300012497 | Ga0157319_1018736 | Ga0157319_10187361 | 151 |
| 275 | 3300013296 | Ga0157374_10321643 | Ga0157374_103216434 | 151 |
| 276 | 3300013297 | Ga0157378_10139282 | Ga0157378_101392823 | 151 |
| 277 | 3300013306 | Ga0163162_10314987 | Ga0163162_103149872 | 151 |
| 278 | 3300013306 | Ga0163162_10321431 | Ga0163162_103214312 | 151 |
| 279 | 3300014325 | Ga0163163_11675239 | Ga0163163_116752391 | 151 |
| 280 | 3300014968 | Ga0157379_10606445 | Ga0157379_106064452 | 151 |
| 281 | 3300020070 | Ga0206356_11226433 | Ga0206356_112264331 | 151 |
| 282 | 3300025208 | Ga0209436_100151 | Ga0209436_10015129 | 151 |
| 283 | 3300025245 | Ga0207425_1029235 | Ga0207425_10292351 | 151 |
| 284 | 3300025263 | Ga0209565_1014942 | Ga0209565_10149422 | 151 |
| 285 | 3300025273 | Ga0209673_1066743 | Ga0209673_10667431 | 151 |
| 286 | 3300025284 | Ga0209130_1000054 | Ga0209130_1000054172 | 151 |
| 287 | 3300025284 | Ga0209130_1000075 | Ga0209130_1000075152 | 151 |
| 288 | 3300025284 | Ga0209130_1000304 | Ga0209130_100030419 | 151 |
| 289 | 3300025291 | Ga0209675_1009191 | Ga0209675_10091912 | 151 |
| 290 | 3300025291 | Ga0209675_1068308 | Ga0209675_10683081 | 151 |
| 291 | 3300025292 | Ga0209676_1001001 | Ga0209676_100100132 | 151 |
| 292 | 3300025292 | Ga0209676_1013489 | Ga0209676_10134896 | 151 |
| 293 | 3300025292 | Ga0209676_1022145 | Ga0209676_10221452 | 151 |
| 294 | 3300025292 | Ga0209676_1042456 | Ga0209676_10424561 | 151 |
| 295 | 3300025294 | Ga0209025_1003491 | Ga0209025_100349118 | 151 |
| 296 | 3300025294 | Ga0209025_1005830 | Ga0209025_10058304 | 151 |
| 297 | 3300025295 | Ga0209564_1000869 | Ga0209564_100086937 | 151 |
| 298 | 3300025297 | Ga0209758_1035436 | Ga0209758_10354363 | 151 |
| 299 | 3300025298 | Ga0209050_1008936 | Ga0209050_10089364 | 151 |
| 300 | 3300025299 | Ga0209256_1000951 | Ga0209256_100095125 | 151 |
| 301 | 3300025302 | Ga0207426_1000127 | Ga0207426_1000127172 | 151 |
| 302 | 3300025302 | Ga0207426_1000141 | Ga0207426_1000141119 | 151 |
| 303 | 3300025302 | Ga0207426_1000163 | Ga0207426_1000163152 | 151 |
| 304 | 3300025303 | Ga0209051_1003765 | Ga0209051_10037653 | 151 |
| 305 | 3300025303 | Ga0209051_1050873 | Ga0209051_10508732 | 151 |
| 306 | 3300025304 | Ga0209257_1002128 | Ga0209257_10021284 | 151 |
| 307 | 3300025304 | Ga0209257_1013823 | Ga0209257_10138234 | 151 |
| 308 | 3300025304 | Ga0209257_1056450 | Ga0209257_10564502 | 151 |
| 309 | 3300025898 | Ga0207692_10338185 | Ga0207692_103381851 | 151 |
| 310 | 3300025899 | Ga0207642_10020311 | Ga0207642_100203112 | 151 |
| 311 | 3300025906 | Ga0207699_10659853 | Ga0207699_106598532 | 151 |
| 312 | 3300025907 | Ga0207645_10224793 | Ga0207645_102247933 | 151 |
| 313 | 3300025916 | Ga0207663_10017262 | Ga0207663_100172623 | 151 |
| 314 | 3300025927 | Ga0207687_10048099 | Ga0207687_100480997 | 151 |
| 315 | 3300025928 | Ga0207700_10691526 | Ga0207700_106915261 | 151 |
| 316 | 3300025931 | Ga0207644_10236839 | Ga0207644_102368392 | 151 |
| 317 | 3300025933 | Ga0207706_10093854 | Ga0207706_100938544 | 151 |
| 318 | 3300025937 | Ga0207669_10095538 | Ga0207669_100955382 | 151 |
| 319 | 3300025940 | Ga0207691_10351200 | Ga0207691_103512003 | 151 |
| 320 | 3300025941 | Ga0207711_10014773 | Ga0207711_100147735 | 151 |
| 321 | 3300025972 | Ga0207668_10061259 | Ga0207668_100612591 | 151 |
| 322 | 3300025972 | Ga0207668_10253973 | Ga0207668_102539733 | 151 |
| 323 | 3300025981 | Ga0207640_10188773 | Ga0207640_101887732 | 151 |
| 324 | 3300026035 | Ga0207703_10658188 | Ga0207703_106581882 | 151 |
| 325 | 3300026067 | Ga0207678_10015102 | Ga0207678_100151023 | 151 |
| 326 | 3300026118 | Ga0207675_100182160 | Ga0207675_1001821603 | 151 |
| 327 | 3300026142 | Ga0207698_10286246 | Ga0207698_102862464 | 151 |
| 328 | 3300027111 | Ga0209281_1001247 | Ga0209281_10012476 | 151 |
| 329 | 3300027866 | Ga0209813_10031533 | Ga0209813_100315332 | 151 |
| 330 | 3300027907 | Ga0207428_10000129 | Ga0207428_1000012967 | 151 |
| 331 | 3300027907 | Ga0207428_10292680 | Ga0207428_102926802 | 151 |
| 332 | 3300028379 | Ga0268266_10004234 | Ga0268266_100042342 | 151 |
| 333 | 3300028381 | Ga0268264_10303587 | Ga0268264_103035872 | 151 |
| 334 | 3300031911 | Ga0307412_10015743 | Ga0307412_100157437 | 151 |
| 335 | 3300033180 | Ga0307510_10110805 | Ga0307510_101108053 | 151 |
| 336 | 3300034957 | Ga0373938_0166361 | Ga0373938_0166361_26_481 | 151 |
| 337 | 3300037312 | Ga0395899_0203784 | Ga0395899_0203784_912_1367 | 151 |
| 338 | 3300037418 | Ga0395900_0078574 | Ga0395900_0078574_1416_1871 | 151 |
| 339 | 3300038443 | Ga0395901_0671761 | Ga0395901_0671761_95_550 | 151 |
| 340 | 3300038443 | Ga0395901_0688838 | Ga0395901_0688838_18_473 | 151 |
| 341 | 3300039450 | Ga0436363_0870267 | Ga0436363_0870267_494_958 | 151 |
| 342 | 3300041411 | Ga0439466_0031676 | Ga0439466_0031676_201_656 | 151 |
| 343 | 3300041413 | Ga0439465_0021404 | Ga0439465_0021404_201_656 | 151 |
| 344 | 3300042007 | Ga0439449_0114735 | Ga0439449_0114735_531_986 | 151 |
| 345 | 3300042015 | Ga0439462_0091124 | Ga0439462_0091124_344_799 | 151 |
| 346 | 3300042122 | Ga0450920_037838 | Ga0450920_037838_135_590 | 151 |
| 347 | 3300042435 | Ga0439434_0209834 | Ga0439434_0209834_42_497 | 151 |
| 348 | 3300045051 | Ga0451576_0673067 | Ga0451576_0673067_191_646 | 151 |
| 349 | 3300046491 | Ga0495584_0159084 | Ga0495584_0159084_244_699 | 151 |
| 350 | 3300046660 | Ga0495625_0020420 | Ga0495625_0020420_1118_1573 | 151 |
| 351 | 3300046664 | Ga0495659_0052725 | Ga0495659_0052725_123_578 | 151 |
| 352 | 3300046691 | Ga0495670_0273949 | Ga0495670_0273949_107_562 | 151 |
| 353 | 3300048903 | Ga0496100_0170035 | Ga0496100_0170035_1069_1524 | 151 |
| 354 | 3300048903 | Ga0496100_0222007 | Ga0496100_0222007_243_698 | 151 |
| 355 | 3300048904 | Ga0496101_1559499 | Ga0496101_1559499_18_473 | 151 |
| 356 | 3300048907 | Ga0496104_0056798 | Ga0496104_0056798_3232_3687 | 151 |
| 357 | 3300048908 | Ga0496105_0485746 | Ga0496105_0485746_488_943 | 151 |
| 358 | 3300048909 | Ga0496106_0092277 | Ga0496106_0092277_1856_2311 | 151 |
| 359 | 3300048909 | Ga0496106_0097973 | Ga0496106_0097973_444_899 | 151 |
| 360 | 3300048912 | Ga0496109_0235182 | Ga0496109_0235182_973_1428 | 151 |
| 361 | 3300048915 | Ga0496112_1579585 | Ga0496112_1579585_21_476 | 151 |
| 362 | 3300048916 | Ga0496113_0065714 | Ga0496113_0065714_385_840 | 151 |
| 363 | 3300048917 | Ga0496114_0943391 | Ga0496114_0943391_122_577 | 151 |
| 364 | 3300048919 | Ga0496116_0150245 | Ga0496116_0150245_67_522 | 151 |
| 365 | 3300048921 | Ga0496118_0037341 | Ga0496118_0037341_1046_1501 | 151 |
| 366 | 3300048925 | Ga0496122_0581222 | Ga0496122_0581222_29_484 | 151 |
| 367 | 3300048926 | Ga0496123_0086640 | Ga0496123_0086640_941_1396 | 151 |
| 368 | 3300048929 | Ga0496126_0058700 | Ga0496126_0058700_840_1295 | 151 |
| 369 | 3300048929 | Ga0496126_0461265 | Ga0496126_0461265_166_621 | 151 |
| 370 | 3300050489 | nmdc:mga03683_28674_c1 | nmdc:mga03683_28674_c1_769_1224 | 151 |
| 371 | 3300050490 | nmdc:mga03n38_3122_c1 | nmdc:mga03n38_3122_c1_2474_2929 | 151 |
| 372 | 3300050491 | nmdc:mga00v17_58238_c1 | nmdc:mga00v17_58238_c1_1213_1668 | 151 |
| 373 | 3300050492 | nmdc:mga0yw44_15927_c1 | nmdc:mga0yw44_15927_c1_2463_2918 | 151 |
| 374 | 3300050494 | nmdc:mga06z11_15398_c1 | nmdc:mga06z11_15398_c1_146_601 | 151 |
| 375 | 3300050495 | nmdc:mga04h51_37503_c1 | nmdc:mga04h51_37503_c1_819_1274 | 151 |
| 376 | 3300050496 | nmdc:mga07m45_5526_c1 | nmdc:mga07m45_5526_c1_1183_1638 | 151 |
| 377 | 3300050508 | nmdc:mga09592_252034_c1 | nmdc:mga09592_252034_c1_530_985 | 151 |
| 378 | 3300050511 | nmdc:mga08y16_51_c1 | nmdc:mga08y16_51_c1_29916_30371 | 151 |
| 379 | 3300050511 | nmdc:mga08y16_76847_c1 | nmdc:mga08y16_76847_c1_1924_2379 | 151 |
| 380 | 3300050514 | nmdc:mga08x19_140240_c1 | nmdc:mga08x19_140240_c1_853_1308 | 151 |
| 381 | 3300050516 | nmdc:mga0sz30_35351_c2 | nmdc:mga0sz30_35351_c2_146_601 | 151 |
| 382 | 3300053088 | Ga0500644_0485992 | Ga0500644_0485992_24_479 | 151 |
| 383 | 3300053153 | Ga0500616_0000231 | Ga0500616_0000231_12606_13061 | 151 |
| 384 | iso_pu_bacteria | 2842038055 | 2842039713 | 151 |
| 385 | iso_pu_bacteria | 2842045827 | 2842047341 | 151 |
| 386 | 3300002741 | JGI25157J39369_1000188 | JGI25157J39369_100018823 | 152 |
| 387 | 3300003794 | Ga0055531_10017573 | Ga0055531_100175735 | 152 |
| 388 | 3300005367 | Ga0070667_101509436 | Ga0070667_1015094361 | 152 |
| 389 | 3300005434 | Ga0070709_10125212 | Ga0070709_101252122 | 152 |
| 390 | 3300005436 | Ga0070713_100039260 | Ga0070713_1000392605 | 152 |
| 391 | 3300005437 | Ga0070710_10039060 | Ga0070710_100390603 | 152 |
| 392 | 3300005439 | Ga0070711_100114383 | Ga0070711_1001143831 | 152 |
| 393 | 3300006028 | Ga0070717_10294822 | Ga0070717_102948222 | 152 |
| 394 | 3300006175 | Ga0070712_100242366 | Ga0070712_1002423662 | 152 |
| 395 | 3300006178 | Ga0075367_10397203 | Ga0075367_103972031 | 152 |
| 396 | 3300025250 | Ga0209026_1000070 | Ga0209026_100007050 | 152 |
| 397 | 3300025256 | Ga0209759_1000293 | Ga0209759_100029323 | 152 |
| 398 | 3300025304 | Ga0209257_1000846 | Ga0209257_100084613 | 152 |
| 399 | 3300025906 | Ga0207699_10157918 | Ga0207699_101579182 | 152 |
| 400 | 3300025915 | Ga0207693_10016626 | Ga0207693_100166267 | 152 |
| 401 | 3300025915 | Ga0207693_10423993 | Ga0207693_104239932 | 152 |
| 402 | 3300025916 | Ga0207663_10060620 | Ga0207663_100606204 | 152 |
| 403 | 3300025916 | Ga0207663_10104535 | Ga0207663_101045351 | 152 |
| 404 | 3300025928 | Ga0207700_10056696 | Ga0207700_100566964 | 152 |
| 405 | 3300025929 | Ga0207664_10800973 | Ga0207664_108009731 | 152 |
| 406 | 3300025939 | Ga0207665_10353162 | Ga0207665_103531622 | 152 |
| 407 | 3300031241 | Ga0265325_10000105 | Ga0265325_100001054 | 152 |
| 408 | 3300031456 | Ga0307513_10100903 | Ga0307513_101009033 | 152 |
| 409 | 3300035086 | Ga0373934_0051305 | Ga0373934_0051305_833_1294 | 152 |
| 410 | 3300035117 | Ga0373953_0009557 | Ga0373953_0009557_22_483 | 152 |
| 411 | 3300035118 | Ga0373954_0087805 | Ga0373954_0087805_12_473 | 152 |
| 412 | 3300035119 | Ga0373956_0009924 | Ga0373956_0009924_2660_3121 | 152 |
| 413 | 3300035120 | Ga0373957_0008716 | Ga0373957_0008716_659_1120 | 152 |
| 414 | 3300035170 | Ga0373943_0792030 | Ga0373943_0792030_32_493 | 152 |
| 415 | 3300035171 | Ga0373946_0073638 | Ga0373946_0073638_728_1189 | 152 |
| 416 | 3300035172 | Ga0373955_0141191 | Ga0373955_0141191_690_1151 | 152 |
| 417 | 3300035692 | Ga0373935_0104971 | Ga0373935_0104971_1272_1733 | 152 |
| 418 | 3300035695 | Ga0373927_0227925 | Ga0373927_0227925_531_992 | 152 |
| 419 | 3300035724 | Ga0373933_0052122 | Ga0373933_0052122_943_1404 | 152 |
| 420 | 3300035725 | Ga0373947_0290077 | Ga0373947_0290077_145_606 | 152 |
| 421 | 3300036401 | Ga0373937_0106404 | Ga0373937_0106404_121_582 | 152 |
| 422 | 3300037068 | Ga0373925_0023713 | Ga0373925_0023713_637_1098 | 152 |
| 423 | 3300044656 | Ga0466969_0014849 | Ga0466969_0014849_1649_2110 | 152 |
| 424 | 3300044656 | Ga0466969_0500522 | Ga0466969_0500522_52_513 | 152 |
| 425 | 3300044683 | Ga0466965_0204621 | Ga0466965_0204621_424_882 | 152 |
| 426 | 3300044684 | Ga0466966_0041116 | Ga0466966_0041116_531_992 | 152 |
| 427 | 3300044693 | Ga0466961_0002159 | Ga0466961_0002159_1609_2070 | 152 |
| 428 | 3300044693 | Ga0466961_0040907 | Ga0466961_0040907_1980_2441 | 152 |
| 429 | 3300044765 | Ga0466970_0002619 | Ga0466970_0002619_5794_6255 | 152 |
| 430 | 3300044765 | Ga0466970_0012602 | Ga0466970_0012602_3334_3795 | 152 |
| 431 | 3300044842 | Ga0466957_0007034 | Ga0466957_0007034_2090_2551 | 152 |
| 432 | 3300044842 | Ga0466957_0150838 | Ga0466957_0150838_14_472 | 152 |
| 433 | 3300045049 | Ga0466959_0048015 | Ga0466959_0048015_1050_1511 | 152 |
| 434 | 3300045049 | Ga0466959_0070011 | Ga0466959_0070011_101_562 | 152 |
| 435 | 3300045836 | Ga0466958_0079373 | Ga0466958_0079373_1257_1715 | 152 |
| 436 | 3300045976 | Ga0466967_0066737 | Ga0466967_0066737_2092_2553 | 152 |
| 437 | 3300046454 | Ga0495592_0002225 | Ga0495592_0002225_10112_10573 | 152 |
| 438 | 3300046462 | Ga0495651_0013966 | Ga0495651_0013966_5700_6161 | 152 |
| 439 | 3300046511 | Ga0495608_0233270 | Ga0495608_0233270_74_535 | 152 |
| 440 | 3300046516 | Ga0495628_0061133 | Ga0495628_0061133_88_549 | 152 |
| 441 | 3300046517 | Ga0495630_0978324 | Ga0495630_0978324_111_572 | 152 |
| 442 | 3300046529 | Ga0495652_0713977 | Ga0495652_0713977_117_578 | 152 |
| 443 | 3300046536 | Ga0495587_0050129 | Ga0495587_0050129_382_843 | 152 |
| 444 | 3300046543 | Ga0495645_0011752 | Ga0495645_0011752_3922_4383 | 152 |
| 445 | 3300046559 | Ga0495667_0071090 | Ga0495667_0071090_814_1275 | 152 |
| 446 | 3300046616 | Ga0495668_0163383 | Ga0495668_0163383_303_779 | 152 |
| 447 | 3300046663 | Ga0495635_0054146 | Ga0495635_0054146_1531_1992 | 152 |
| 448 | 3300046678 | Ga0495599_0015597 | Ga0495599_0015597_2053_2514 | 152 |
| 449 | 3300046679 | Ga0495623_0131586 | Ga0495623_0131586_637_1098 | 152 |
| 450 | 3300046680 | Ga0495646_0328729 | Ga0495646_0328729_249_710 | 152 |
| 451 | 3300046809 | Ga0495600_0154182 | Ga0495600_0154182_186_647 | 152 |
| 452 | 3300047317 | Ga0495604_0003181 | Ga0495604_0003181_6344_6805 | 152 |
| 453 | 3300047319 | Ga0495674_0614502 | Ga0495674_0614502_203_664 | 152 |
| 454 | 3300047322 | Ga0495680_0035497 | Ga0495680_0035497_1368_1829 | 152 |
| 455 | 3300047444 | Ga0495675_0160969 | Ga0495675_0160969_83_544 | 152 |
| 456 | 3300047471 | Ga0495684_0291672 | Ga0495684_0291672_114_575 | 152 |
| 457 | 3300048088 | Ga0495602_0040219 | Ga0495602_0040219_1851_2312 | 152 |
| 458 | 3300048907 | Ga0496104_0001998 | Ga0496104_0001998_2900_3361 | 152 |
| 459 | 3300048908 | Ga0496105_0000273 | Ga0496105_0000273_29970_30431 | 152 |
| 460 | 3300049589 | Ga0501073_0924066 | Ga0501073_0924066_32_493 | 152 |
| 461 | 3300053077 | Ga0495601_0000379 | Ga0495601_0000379_3900_4361 | 152 |
| 462 | 3300053084 | Ga0495595_0010843 | Ga0495595_0010843_3096_3557 | 152 |
| 463 | 3300053084 | Ga0495595_0664721 | Ga0495595_0664721_27_488 | 152 |
| 464 | 3300053085 | Ga0495619_0005722 | Ga0495619_0005722_3171_3632 | 152 |
| 465 | 3300053151 | Ga0500604_0002531 | Ga0500604_0002531_4275_4751 | 152 |
| 466 | 3300061719 | Ga0466962_0261216 | Ga0466962_0261216_97_558 | 152 |
| 467 | 3300002244 | JGI24742J22300_10048254 | JGI24742J22300_100482541 | 153 |
| 468 | 3300003354 | JGI25160J50197_1012996 | JGI25160J50197_10129963 | 153 |
| 469 | 3300004625 | Ga0055543_1000931 | Ga0055543_100093111 | 153 |
| 470 | 3300005262 | Ga0065165_1001608 | Ga0065165_100160820 | 153 |
| 471 | 3300005262 | Ga0065165_1001780 | Ga0065165_10017807 | 153 |
| 472 | 3300005327 | Ga0070658_10230563 | Ga0070658_102305633 | 153 |
| 473 | 3300005334 | Ga0068869_100479023 | Ga0068869_1004790231 | 153 |
| 474 | 3300005336 | Ga0070680_100060330 | Ga0070680_1000603303 | 153 |
| 475 | 3300005337 | Ga0070682_100452345 | Ga0070682_1004523451 | 153 |
| 476 | 3300005340 | Ga0070689_100177492 | Ga0070689_1001774924 | 153 |
| 477 | 3300005347 | Ga0070668_100011183 | Ga0070668_1000111833 | 153 |
| 478 | 3300005347 | Ga0070668_100324292 | Ga0070668_1003242923 | 153 |
| 479 | 3300005353 | Ga0070669_100219239 | Ga0070669_1002192392 | 153 |
| 480 | 3300005354 | Ga0070675_101395803 | Ga0070675_1013958031 | 153 |
| 481 | 3300005364 | Ga0070673_100219296 | Ga0070673_1002192962 | 153 |
| 482 | 3300005365 | Ga0070688_100134409 | Ga0070688_1001344092 | 153 |
| 483 | 3300005366 | Ga0070659_100699948 | Ga0070659_1006999481 | 153 |
| 484 | 3300005366 | Ga0070659_100728875 | Ga0070659_1007288752 | 153 |
| 485 | 3300005367 | Ga0070667_100078096 | Ga0070667_1000780962 | 153 |
| 486 | 3300005367 | Ga0070667_101351963 | Ga0070667_1013519631 | 153 |
| 487 | 3300005438 | Ga0070701_10493251 | Ga0070701_104932511 | 153 |
| 488 | 3300005441 | Ga0070700_100174724 | Ga0070700_1001747243 | 153 |
| 489 | 3300005441 | Ga0070700_100731868 | Ga0070700_1007318681 | 153 |
| 490 | 3300005455 | Ga0070663_100084590 | Ga0070663_1000845902 | 153 |
| 491 | 3300005455 | Ga0070663_100097128 | Ga0070663_1000971283 | 153 |
| 492 | 3300005455 | Ga0070663_100134325 | Ga0070663_1001343252 | 153 |
| 493 | 3300005455 | Ga0070663_100160609 | Ga0070663_1001606093 | 153 |
| 494 | 3300005456 | Ga0070678_100375546 | Ga0070678_1003755462 | 153 |
| 495 | 3300005458 | Ga0070681_10069696 | Ga0070681_100696963 | 153 |
| 496 | 3300005459 | Ga0068867_100269062 | Ga0068867_1002690621 | 153 |
| 497 | 3300005530 | Ga0070679_100069731 | Ga0070679_1000697313 | 153 |
| 498 | 3300005544 | Ga0070686_100128338 | Ga0070686_1001283382 | 153 |
| 499 | 3300005547 | Ga0070693_100144883 | Ga0070693_1001448832 | 153 |
| 500 | 3300005548 | Ga0070665_100048897 | Ga0070665_1000488973 | 153 |
| 501 | 3300005548 | Ga0070665_100160167 | Ga0070665_1001601673 | 153 |
| 502 | 3300005563 | Ga0068855_100005078 | Ga0068855_1000050785 | 153 |
| 503 | 3300005563 | Ga0068855_100722433 | Ga0068855_1007224331 | 153 |
| 504 | 3300005564 | Ga0070664_100280713 | Ga0070664_1002807133 | 153 |
| 505 | 3300005577 | Ga0068857_100630161 | Ga0068857_1006301612 | 153 |
| 506 | 3300005615 | Ga0070702_100268914 | Ga0070702_1002689141 | 153 |
| 507 | 3300005718 | Ga0068866_10119945 | Ga0068866_101199452 | 153 |
| 508 | 3300005842 | Ga0068858_101077175 | Ga0068858_1010771751 | 153 |
| 509 | 3300005842 | Ga0068858_101129742 | Ga0068858_1011297422 | 153 |
| 510 | 3300006038 | Ga0075365_10026989 | Ga0075365_100269894 | 153 |
| 511 | 3300006042 | Ga0075368_10076845 | Ga0075368_100768451 | 153 |
| 512 | 3300006048 | Ga0075363_100600248 | Ga0075363_1006002482 | 153 |
| 513 | 3300006051 | Ga0075364_10396192 | Ga0075364_103961922 | 153 |
| 514 | 3300006177 | Ga0075362_10198503 | Ga0075362_101985032 | 153 |
| 515 | 3300006178 | Ga0075367_10056508 | Ga0075367_100565082 | 153 |
| 516 | 3300006186 | Ga0075369_10070600 | Ga0075369_100706002 | 153 |
| 517 | 3300006186 | Ga0075369_10221796 | Ga0075369_102217961 | 153 |
| 518 | 3300006195 | Ga0075366_10280731 | Ga0075366_102807312 | 153 |
| 519 | 3300006353 | Ga0075370_10037350 | Ga0075370_100373502 | 153 |
| 520 | 3300006941 | Ga0099825_1034652 | Ga0099825_10346522 | 153 |
| 521 | 3300006942 | Ga0099824_1038251 | Ga0099824_10382511 | 153 |
| 522 | 3300006944 | Ga0099823_1008083 | Ga0099823_10080835 | 153 |
| 523 | 3300009093 | Ga0105240_10048479 | Ga0105240_100484795 | 153 |
| 524 | 3300009148 | Ga0105243_10349155 | Ga0105243_103491552 | 153 |
| 525 | 3300009148 | Ga0105243_10507708 | Ga0105243_105077081 | 153 |
| 526 | 3300009174 | Ga0105241_10284981 | Ga0105241_102849811 | 153 |
| 527 | 3300009176 | Ga0105242_10313575 | Ga0105242_103135752 | 153 |
| 528 | 3300009176 | Ga0105242_10472799 | Ga0105242_104727993 | 153 |
| 529 | 3300009177 | Ga0105248_10998688 | Ga0105248_109986881 | 153 |
| 530 | 3300010375 | Ga0105239_10010122 | Ga0105239_100101227 | 153 |
| 531 | 3300013104 | Ga0157370_10468680 | Ga0157370_104686802 | 153 |
| 532 | 3300013105 | Ga0157369_10005932 | Ga0157369_100059326 | 153 |
| 533 | 3300013306 | Ga0163162_12384606 | Ga0163162_123846061 | 153 |
| 534 | 3300013308 | Ga0157375_10239587 | Ga0157375_102395873 | 153 |
| 535 | 3300014325 | Ga0163163_10772530 | Ga0163163_107725302 | 153 |
| 536 | 3300014969 | Ga0157376_11067171 | Ga0157376_110671711 | 153 |
| 537 | 3300017792 | Ga0163161_10339933 | Ga0163161_103399332 | 153 |
| 538 | 3300021320 | Ga0214544_1000009 | Ga0214544_1000009249 | 153 |
| 539 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002691 | 153 |
| 540 | 3300021324 | Ga0214545_1000002 | Ga0214545_100000229 | 153 |
| 541 | 3300021327 | Ga0214543_1000013 | Ga0214543_1000013293 | 153 |
| 542 | 3300025261 | Ga0209233_1016754 | Ga0209233_10167542 | 153 |
| 543 | 3300025297 | Ga0209758_1016348 | Ga0209758_10163483 | 153 |
| 544 | 3300025302 | Ga0207426_1001352 | Ga0207426_10013527 | 153 |
| 545 | 3300025302 | Ga0207426_1035887 | Ga0207426_10358872 | 153 |
| 546 | 3300025304 | Ga0209257_1071995 | Ga0209257_10719952 | 153 |
| 547 | 3300025315 | Ga0207697_10035429 | Ga0207697_100354292 | 153 |
| 548 | 3300025901 | Ga0207688_10009650 | Ga0207688_100096502 | 153 |
| 549 | 3300025903 | Ga0207680_10742839 | Ga0207680_107428392 | 153 |
| 550 | 3300025909 | Ga0207705_10136113 | Ga0207705_101361132 | 153 |
| 551 | 3300025912 | Ga0207707_10992937 | Ga0207707_109929372 | 153 |
| 552 | 3300025913 | Ga0207695_10052552 | Ga0207695_100525523 | 153 |
| 553 | 3300025914 | Ga0207671_10321495 | Ga0207671_103214952 | 153 |
| 554 | 3300025917 | Ga0207660_10149059 | Ga0207660_101490592 | 153 |
| 555 | 3300025920 | Ga0207649_10209964 | Ga0207649_102099641 | 153 |
| 556 | 3300025921 | Ga0207652_10139022 | Ga0207652_101390223 | 153 |
| 557 | 3300025932 | Ga0207690_10078188 | Ga0207690_100781882 | 153 |
| 558 | 3300025932 | Ga0207690_10589659 | Ga0207690_105896592 | 153 |
| 559 | 3300025934 | Ga0207686_10725983 | Ga0207686_107259832 | 153 |
| 560 | 3300025934 | Ga0207686_10766790 | Ga0207686_107667901 | 153 |
| 561 | 3300025935 | Ga0207709_10009200 | Ga0207709_100092008 | 153 |
| 562 | 3300025936 | Ga0207670_10157026 | Ga0207670_101570263 | 153 |
| 563 | 3300025942 | Ga0207689_11175991 | Ga0207689_111759911 | 153 |
| 564 | 3300025949 | Ga0207667_10147307 | Ga0207667_101473072 | 153 |
| 565 | 3300025949 | Ga0207667_11615261 | Ga0207667_116152611 | 153 |
| 566 | 3300025961 | Ga0207712_10012307 | Ga0207712_100123072 | 153 |
| 567 | 3300025986 | Ga0207658_10063431 | Ga0207658_100634314 | 153 |
| 568 | 3300026023 | Ga0207677_10536595 | Ga0207677_105365952 | 153 |
| 569 | 3300026041 | Ga0207639_11182835 | Ga0207639_111828352 | 153 |
| 570 | 3300026067 | Ga0207678_10037726 | Ga0207678_100377263 | 153 |
| 571 | 3300026067 | Ga0207678_10057840 | Ga0207678_100578402 | 153 |
| 572 | 3300026067 | Ga0207678_10067602 | Ga0207678_100676022 | 153 |
| 573 | 3300026067 | Ga0207678_10074338 | Ga0207678_100743383 | 153 |
| 574 | 3300026067 | Ga0207678_10343446 | Ga0207678_103434462 | 153 |
| 575 | 3300026075 | Ga0207708_10173851 | Ga0207708_101738513 | 153 |
| 576 | 3300026075 | Ga0207708_10309833 | Ga0207708_103098332 | 153 |
| 577 | 3300026089 | Ga0207648_10086382 | Ga0207648_100863822 | 153 |
| 578 | 3300026116 | Ga0207674_10446969 | Ga0207674_104469692 | 153 |
| 579 | 3300026121 | Ga0207683_10205747 | Ga0207683_102057472 | 153 |
| 580 | 3300026121 | Ga0207683_10417232 | Ga0207683_104172322 | 153 |
| 581 | 3300027296 | Ga0209389_1000117 | Ga0209389_100011731 | 153 |
| 582 | 3300027361 | Ga0209489_102405 | Ga0209489_10240510 | 153 |
| 583 | 3300027363 | Ga0209700_100021 | Ga0209700_10002131 | 153 |
| 584 | 3300027866 | Ga0209813_10105763 | Ga0209813_101057632 | 153 |
| 585 | 3300028380 | Ga0268265_10220021 | Ga0268265_102200212 | 153 |
| 586 | 3300031456 | Ga0307513_10276049 | Ga0307513_102760492 | 153 |
| 587 | 3300031507 | Ga0307509_10032602 | Ga0307509_100326023 | 153 |
| 588 | 3300031852 | Ga0307410_11703053 | Ga0307410_117030531 | 153 |
| 589 | 3300032002 | Ga0307416_101121835 | Ga0307416_1011218352 | 153 |
| 590 | 3300032126 | Ga0307415_100092914 | Ga0307415_1000929143 | 153 |
| 591 | 3300033180 | Ga0307510_10064539 | Ga0307510_100645393 | 153 |
| 592 | 3300041411 | Ga0439466_0138311 | Ga0439466_0138311_78_545 | 153 |
| 593 | 3300041443 | Ga0451789_0744550 | Ga0451789_0744550_631_1098 | 153 |
| 594 | 3300041451 | Ga0451791_1567305 | Ga0451791_1567305_147_614 | 153 |
| 595 | 3300041460 | Ga0451802_0456888 | Ga0451802_0456888_26_487 | 153 |
| 596 | 3300041496 | Ga0451839_1130307 | Ga0451839_1130307_972_1439 | 153 |
| 597 | 3300041997 | Ga0439431_0092733 | Ga0439431_0092733_137_604 | 153 |
| 598 | 3300044656 | Ga0466969_0009042 | Ga0466969_0009042_1737_2198 | 153 |
| 599 | 3300044656 | Ga0466969_0012357 | Ga0466969_0012357_2352_2813 | 153 |
| 600 | 3300044656 | Ga0466969_0086269 | Ga0466969_0086269_457_918 | 153 |
| 601 | 3300044683 | Ga0466965_0002917 | Ga0466965_0002917_1757_2218 | 153 |
| 602 | 3300044683 | Ga0466965_0085356 | Ga0466965_0085356_469_930 | 153 |
| 603 | 3300044684 | Ga0466966_0012747 | Ga0466966_0012747_1797_2258 | 153 |
| 604 | 3300044684 | Ga0466966_0015365 | Ga0466966_0015365_524_985 | 153 |
| 605 | 3300044684 | Ga0466966_0027652 | Ga0466966_0027652_1047_1508 | 153 |
| 606 | 3300044693 | Ga0466961_0008083 | Ga0466961_0008083_6103_6564 | 153 |
| 607 | 3300044693 | Ga0466961_0190679 | Ga0466961_0190679_54_515 | 153 |
| 608 | 3300044694 | Ga0466963_0906651 | Ga0466963_0906651_21_482 | 153 |
| 609 | 3300044735 | Ga0466968_0137551 | Ga0466968_0137551_325_786 | 153 |
| 610 | 3300044765 | Ga0466970_0059479 | Ga0466970_0059479_439_900 | 153 |
| 611 | 3300044842 | Ga0466957_0039939 | Ga0466957_0039939_755_1216 | 153 |
| 612 | 3300045049 | Ga0466959_0005778 | Ga0466959_0005778_6184_6645 | 153 |
| 613 | 3300045049 | Ga0466959_0008526 | Ga0466959_0008526_3270_3731 | 153 |
| 614 | 3300045049 | Ga0466959_0100592 | Ga0466959_0100592_914_1375 | 153 |
| 615 | 3300045836 | Ga0466958_0005296 | Ga0466958_0005296_6009_6470 | 153 |
| 616 | 3300046452 | Ga0495617_003222 | Ga0495617_003222_4308_4769 | 153 |
| 617 | 3300046455 | Ga0495603_0046262 | Ga0495603_0046262_1272_1733 | 153 |
| 618 | 3300046457 | Ga0495590_0080086 | Ga0495590_0080086_244_705 | 153 |
| 619 | 3300046460 | Ga0495638_0011589 | Ga0495638_0011589_306_773 | 153 |
| 620 | 3300046460 | Ga0495638_0435671 | Ga0495638_0435671_104_565 | 153 |
| 621 | 3300046471 | Ga0495650_0018771 | Ga0495650_0018771_88_549 | 153 |
| 622 | 3300046474 | Ga0495605_0172835 | Ga0495605_0172835_270_731 | 153 |
| 623 | 3300046499 | Ga0495594_0805226 | Ga0495594_0805226_52_513 | 153 |
| 624 | 3300046500 | Ga0495596_0404284 | Ga0495596_0404284_48_509 | 153 |
| 625 | 3300046507 | Ga0495606_0128253 | Ga0495606_0128253_452_913 | 153 |
| 626 | 3300046522 | Ga0495643_0328357 | Ga0495643_0328357_80_547 | 153 |
| 627 | 3300046523 | Ga0495644_0102722 | Ga0495644_0102722_532_993 | 153 |
| 628 | 3300046524 | Ga0495648_0056053 | Ga0495648_0056053_484_945 | 153 |
| 629 | 3300046525 | Ga0495663_0144045 | Ga0495663_0144045_81_548 | 153 |
| 630 | 3300046528 | Ga0495642_0129201 | Ga0495642_0129201_270_731 | 153 |
| 631 | 3300046538 | Ga0495609_0014953 | Ga0495609_0014953_3141_3602 | 153 |
| 632 | 3300046542 | Ga0495597_0218746 | Ga0495597_0218746_238_699 | 153 |
| 633 | 3300046557 | Ga0495622_0156788 | Ga0495622_0156788_51_512 | 153 |
| 634 | 3300046558 | Ga0495633_0392788 | Ga0495633_0392788_82_543 | 153 |
| 635 | 3300046615 | Ga0495656_0110402 | Ga0495656_0110402_230_697 | 153 |
| 636 | 3300046615 | Ga0495656_0417213 | Ga0495656_0417213_83_544 | 153 |
| 637 | 3300046616 | Ga0495668_0213174 | Ga0495668_0213174_302_763 | 153 |
| 638 | 3300046616 | Ga0495668_0770872 | Ga0495668_0770872_44_505 | 153 |
| 639 | 3300046660 | Ga0495625_0043325 | Ga0495625_0043325_1298_1759 | 153 |
| 640 | 3300046660 | Ga0495625_0131372 | Ga0495625_0131372_966_1427 | 153 |
| 641 | 3300046665 | Ga0495661_0220140 | Ga0495661_0220140_70_537 | 153 |
| 642 | 3300046684 | Ga0495669_0011283 | Ga0495669_0011283_274_741 | 153 |
| 643 | 3300046694 | Ga0495649_0041294 | Ga0495649_0041294_1994_2455 | 153 |
| 644 | 3300046810 | Ga0495660_0211114 | Ga0495660_0211114_348_809 | 153 |
| 645 | 3300047323 | Ga0495683_0341033 | Ga0495683_0341033_150_617 | 153 |
| 646 | 3300048091 | Ga0495626_0297573 | Ga0495626_0297573_18_479 | 153 |
| 647 | 3300048903 | Ga0496100_0516761 | Ga0496100_0516761_152_619 | 153 |
| 648 | 3300048904 | Ga0496101_0047565 | Ga0496101_0047565_500_967 | 153 |
| 649 | 3300048905 | Ga0496102_0329157 | Ga0496102_0329157_323_790 | 153 |
| 650 | 3300048910 | Ga0496107_0194645 | Ga0496107_0194645_433_900 | 153 |
| 651 | 3300048918 | Ga0496115_0258584 | Ga0496115_0258584_813_1274 | 153 |
| 652 | 3300048918 | Ga0496115_0315331 | Ga0496115_0315331_386_853 | 153 |
| 653 | 3300048924 | Ga0496121_0017429 | Ga0496121_0017429_433_894 | 153 |
| 654 | 3300048924 | Ga0496121_0029157 | Ga0496121_0029157_545_1006 | 153 |
| 655 | 3300048927 | Ga0496124_0334716 | Ga0496124_0334716_325_786 | 153 |
| 656 | 3300048928 | Ga0496125_0171819 | Ga0496125_0171819_228_689 | 153 |
| 657 | 3300048929 | Ga0496126_0020176 | Ga0496126_0020176_5072_5533 | 153 |
| 658 | 3300048929 | Ga0496126_0068978 | Ga0496126_0068978_2389_2850 | 153 |
| 659 | 3300048929 | Ga0496126_0308387 | Ga0496126_0308387_588_1055 | 153 |
| 660 | 3300048929 | Ga0496126_0312928 | Ga0496126_0312928_674_1135 | 153 |
| 661 | 3300048929 | Ga0496126_0319806 | Ga0496126_0319806_150_611 | 153 |
| 662 | 3300049570 | Ga0501033_0473097 | Ga0501033_0473097_36_497 | 153 |
| 663 | 3300049572 | Ga0501036_0778379 | Ga0501036_0778379_96_557 | 153 |
| 664 | 3300049581 | Ga0501047_0111567 | Ga0501047_0111567_232_693 | 153 |
| 665 | 3300049589 | Ga0501073_0547789 | Ga0501073_0547789_66_527 | 153 |
| 666 | 3300049590 | Ga0501074_0228927 | Ga0501074_0228927_357_818 | 153 |
| 667 | 3300049742 | Ga0501080_0144322 | Ga0501080_0144322_1542_2003 | 153 |
| 668 | 3300049823 | Ga0501044_0021138 | Ga0501044_0021138_4058_4519 | 153 |
| 669 | 3300050489 | nmdc:mga03683_175186_c1 | nmdc:mga03683_175186_c1_384_851 | 153 |
| 670 | 3300050490 | nmdc:mga03n38_273943_c1 | nmdc:mga03n38_273943_c1_383_844 | 153 |
| 671 | 3300050492 | nmdc:mga0yw44_37622_c1 | nmdc:mga0yw44_37622_c1_1182_1643 | 153 |
| 672 | 3300050492 | nmdc:mga0yw44_70692_c1 | nmdc:mga0yw44_70692_c1_201_668 | 153 |
| 673 | 3300050493 | nmdc:mga0k408_117902_c1 | nmdc:mga0k408_117902_c1_860_1321 | 153 |
| 674 | 3300050494 | nmdc:mga06z11_58849_c1 | nmdc:mga06z11_58849_c1_1017_1478 | 153 |
| 675 | 3300050495 | nmdc:mga04h51_17050_c1 | nmdc:mga04h51_17050_c1_859_1320 | 153 |
| 676 | 3300050516 | nmdc:mga0sz30_101080_c2 | nmdc:mga0sz30_101080_c2_181_642 | 153 |
| 677 | 3300050516 | nmdc:mga0sz30_67386_c1 | nmdc:mga0sz30_67386_c1_533_1000 | 153 |
| 678 | 3300053083 | Ga0495655_0083124 | Ga0495655_0083124_439_900 | 153 |
| 679 | 3300053087 | Ga0500643_165727 | Ga0500643_165727_106_567 | 153 |
| 680 | 3300053088 | Ga0500644_0478910 | Ga0500644_0478910_44_505 | 153 |
| 681 | 3300053103 | Ga0500555_042115 | Ga0500555_042115_525_986 | 153 |
| 682 | 3300053129 | Ga0500628_136059 | Ga0500628_136059_133_663 | 153 |
| 683 | 3300053130 | Ga0500642_0071449 | Ga0500642_0071449_312_773 | 153 |
| 684 | 3300053133 | Ga0500655_117467 | Ga0500655_117467_50_511 | 153 |
| 685 | 3300053142 | Ga0500577_0131826 | Ga0500577_0131826_411_872 | 153 |
| 686 | 3300053730 | Ga0500645_015755 | Ga0500645_015755_390_851 | 153 |
| 687 | iso_pu_bacteria | 2874590934 | 2874597416 | 153 |
| 688 | iso_pu_bacteria | 2874645413 | 2874648492 | 153 |
| 689 | iso_pu_bacteria | 2876771140 | 2876777787 | 153 |
| 690 | iso_pu_bacteria | 2876818435 | 2876822454 | 153 |
| 691 | iso_pu_bacteria | 2879074833 | 2879078195 | 153 |
| 692 | iso_pu_bacteria | 2879127579 | 2879134464 | 153 |
| 693 | iso_pu_bacteria | 2879142872 | 2879150001 | 153 |
| 694 | 3300005539 | Ga0068853_101928495 | Ga0068853_1019284951 | 154 |
| 695 | 3300005937 | Ga0081455_10062419 | Ga0081455_100624193 | 154 |
| 696 | 3300013296 | Ga0157374_10544571 | Ga0157374_105445711 | 154 |
| 697 | 3300013875 | Ga0157515_156067 | Ga0157515_1560672 | 154 |
| 698 | 3300025923 | Ga0207681_10199018 | Ga0207681_101990182 | 154 |
| 699 | 3300026041 | Ga0207639_11385021 | Ga0207639_113850211 | 154 |
| 700 | 3300028379 | Ga0268266_10001892 | Ga0268266_1000189213 | 154 |
| 701 | 3300037471 | Ga0395905_0015261 | Ga0395905_0015261_2355_2822 | 154 |
| 702 | 3300037471 | Ga0395905_0408981 | Ga0395905_0408981_62_535 | 154 |
| 703 | 3300041498 | Ga0451841_0068232 | Ga0451841_0068232_175_645 | 154 |
| 704 | 3300041505 | Ga0451849_1320375 | Ga0451849_1320375_767_1237 | 154 |
| 705 | 3300048922 | Ga0496119_0101956 | Ga0496119_0101956_721_1185 | 154 |
| 706 | 3300048927 | Ga0496124_0786627 | Ga0496124_0786627_64_528 | 154 |
| 707 | 3300049581 | Ga0501047_0456801 | Ga0501047_0456801_471_998 | 154 |
| 708 | 3300049581 | Ga0501047_0596781 | Ga0501047_0596781_72_599 | 154 |
| 709 | 3300049823 | Ga0501044_0270015 | Ga0501044_0270015_374_901 | 154 |
| 710 | 3300050492 | nmdc:mga0yw44_27867_c1 | nmdc:mga0yw44_27867_c1_38_502 | 154 |
| 711 | iso_pu_bacteria | 2935608549 | 2935611805 | 154 |
| 712 | iso_pu_bacteria | 2935819856 | 2935821283 | 154 |
| 713 | iso_pu_bacteria | 2935847175 | 2935850456 | 154 |
| 714 | 3300002075 | JGI24738J21930_10012390 | JGI24738J21930_100123904 | 155 |
| 715 | 3300005578 | Ga0068854_100084200 | Ga0068854_1000842001 | 155 |
| 716 | 3300009551 | Ga0105238_10650453 | Ga0105238_106504532 | 155 |
| 717 | 3300025924 | Ga0207694_10183403 | Ga0207694_101834032 | 155 |
| 718 | 3300025981 | Ga0207640_10014710 | Ga0207640_100147103 | 155 |
| 719 | 3300026116 | Ga0207674_10064324 | Ga0207674_100643245 | 155 |
| 720 | 3300031548 | Ga0307408_100171429 | Ga0307408_1001714292 | 155 |
| 721 | 3300031731 | Ga0307405_10069466 | Ga0307405_100694663 | 155 |
| 722 | 3300031901 | Ga0307406_10018932 | Ga0307406_100189321 | 155 |
| 723 | 3300031911 | Ga0307412_10003244 | Ga0307412_100032448 | 155 |
| 724 | 3300031995 | Ga0307409_100095290 | Ga0307409_1000952901 | 155 |
| 725 | 3300032002 | Ga0307416_100022587 | Ga0307416_1000225875 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9747 | 11 | 140 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9682 | 1 | 145 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.963 | 2 | 145 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9552 | 1 | 145 |
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9391 | 11 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9666 | 2 | 145 | 1.20.1290.10 |
| 2ijcF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9656 | 2 | 139 | 1.20.1290.10 |
| 2o4dA00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9602 | 2 | 145 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9525 | 6 | 143 | 1.20.1290.10 |
| 2o4dA00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9469 | 2 | 145 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P7L6S2-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 1 | 4 | 152 |
GO:0051920
|
| AF-I2B5E8-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 1 | 1 | 149 |
GO:0051920
|
| AF-A0A506VCW6-F1-model_v4 | Carboxymuconolactone decarboxylase family protein | 0.9995 | 1 | 153 |
GO:0051920
|
| AF-A0A4Q7RCA5-F1-model_v4 | AhpD family alkylhydroperoxidase | 0.9992 | 4 | 145 |
GO:0051920
|
| AF-A0A1V2H0A2-F1-model_v4 | Alkylhydroperoxidase | 0.9972 | 2 | 148 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar