F477650

General Info

Members Datasets Scaffolds Average Seq Length
725 417 682 280

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876813382
Length 295
Sequence RPLSDIIAYAILTLGIFIVAFPVYLALIASTHDAATVVGGNMPLSPGSQTLENYYRAVFVGGSRTSREPVGHMLMNSFISAIGIALGKIFISMLSAYAVVYFRFPFRKTAFWIIFVTLMLPVEVRIYPTYKVVADLKMLDTYAGLILPLIASATGTLLFRQFFMTVPEELLEASRIDGAGPFRFFWDTLLPLSVTTIAALFVIQFIYGWNQYLWPLLITTQDSMQTIVTGIKKMLXXXXXXXXXXXXXXXXXXXXXXXXXXQLAMATAILAMLPPVAVVIFMQRLFVRGLVETEK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
7 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
8 2643221580 Devosia sp. Root635 Isolate Unclassified
9 2643221591 Devosia sp. Root685 Isolate Unclassified
10 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
11 2643221674 Devosia sp. Root436 Isolate Unclassified
12 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
13 2738541293 Rhizobium sp. GV031 Isolate Unclassified
14 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
15 2773857925 Microvirga vignae BR3299 Isolate Unclassified
16 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
17 2791355199
18 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
19 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
20 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
21 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
22 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
23 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
24 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
25 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
26 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
27 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
28 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
29 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
30 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
31 2909042592 Labrys sp. LIt4 Isolate Nodule
32 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
33 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
34 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
35 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
36 2932401849 Devosia sp. 2618 Isolate Rhizosphere
37 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
38 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
39 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
40 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
41 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
58 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
62 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
89 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
115 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
136 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
203 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
256 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
260 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
272 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
334 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
335 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
384 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
387 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
388 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
389 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
390 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
391 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
392 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
393 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
394 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
395 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
396 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
397 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
401 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
402 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
403 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
406 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
407 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
408 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
409 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
410 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
414 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
415 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
416 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
417 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 0
Isolates 5.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.34
Nodule 1.79
Rhizoplane 6.48
Rhizosphere 61.79
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002682 3300000549 Bacteria 2453
2 JGI24742J22300_10012830 3300002244 Bacteria 1400
3 JGI25152J39213_1003864 3300002773 Bacteria 4931
4 JGI25152J39213_1004994 3300002773 Bacteria 4007
5 JGI25150J39212_1000064 3300002774 Bacteria 64002
6 JGI25151J46595_10000242 3300003187 Bacteria 64028
7 JGI25406J46586_10000544 3300003203 Bacteria 17662
8 JGI25153J46596_10007551 3300003215 Bacteria 5326
9 JGI25153J46596_10041996 3300003215 Bacteria 1400
10 rootH2_10027291 3300003320 Bacteria 4322
11 JGI25160J50197_1005691 3300003354 Bacteria 5149
12 JGI25404J52841_10006208 3300003659 Bacteria 2492
13 Ga0055526_1005564 3300003771 Bacteria 7195
14 Ga0055526_1007731 3300003771 Bacteria 5517
15 Ga0055524_1012575 3300003775 Bacteria 3241
16 Ga0055536_1009917 3300003781 Bacteria 3863
17 Ga0055528_1001254 3300003790 Bacteria 16112
18 Ga0055530_10011607 3300003791 Bacteria 3147
19 Ga0055540_1003251 3300003792 Bacteria 7961
20 Ga0055531_10001575 3300003794 Bacteria 16679
21 Ga0055543_1012893 3300004625 Bacteria 1667
22 Ga0065707_10239209 3300005295 Bacteria 1161
23 Ga0070658_10002931 3300005327 Bacteria 14146
24 Ga0070658_10337405 3300005327 Bacteria 1289
25 Ga0070658_10385260 3300005327 Bacteria 1203
26 Ga0070676_10335280 3300005328 Bacteria 1035
27 Ga0070670_100251903 3300005331 Bacteria 1538
28 Ga0068869_100058330 3300005334 Bacteria 2822
29 Ga0068869_100249692 3300005334 Bacteria 1416
30 Ga0070680_100120516 3300005336 Bacteria 2190
31 Ga0070682_100075952 3300005337 Bacteria 2162
32 Ga0068868_100010934 3300005338 Bacteria 6589
33 Ga0068868_100049069 3300005338 Bacteria 3313
34 Ga0068868_100091013 3300005338 Bacteria 2457
35 Ga0070689_100084924 3300005340 Bacteria 2488
36 Ga0070689_100129764 3300005340 Bacteria 2021
37 Ga0070661_100133517 3300005344 Bacteria 1866
38 Ga0070661_100333652 3300005344 Bacteria 1186
39 Ga0070661_100467254 3300005344 Bacteria 1006
40 Ga0070675_100123235 3300005354 Bacteria 2204
41 Ga0070671_100117137 3300005355 Bacteria 2240
42 Ga0070671_100328061 3300005355 Bacteria 1304
43 Ga0070671_100409543 3300005355 Bacteria 1160
44 Ga0070674_100042951 3300005356 Bacteria 3073
45 Ga0070673_100199553 3300005364 Bacteria 1722
46 Ga0070673_100236139 3300005364 Bacteria 1588
47 Ga0070701_10165671 3300005438 Bacteria 1283
48 Ga0070694_100339016 3300005444 Bacteria 1162
49 Ga0070708_100184522 3300005445 Bacteria 1951
50 Ga0070663_100004161 3300005455 Bacteria 8454
51 Ga0070663_100127368 3300005455 Bacteria 1930
52 Ga0070663_100179179 3300005455 Bacteria 1643
53 Ga0070663_100385175 3300005455 Bacteria 1143
54 Ga0070678_100010694 3300005456 Bacteria 5619
55 Ga0070678_100081981 3300005456 Bacteria 2447
56 Ga0070678_100209195 3300005456 Bacteria 1615
57 Ga0070681_10009227 3300005458 Bacteria 9695
58 Ga0070698_100011606 3300005471 Bacteria 9348
59 Ga0070698_100392582 3300005471 Bacteria 1321
60 Ga0070684_100113580 3300005535 Bacteria 2431
61 Ga0068853_100059188 3300005539 Bacteria 3309
62 Ga0068853_100066285 3300005539 Bacteria 3135
63 Ga0068853_100067103 3300005539 Bacteria 3116
64 Ga0068853_100119381 3300005539 Bacteria 2350
65 Ga0068853_100154723 3300005539 Bacteria 2066
66 Ga0068853_100295543 3300005539 Bacteria 1496
67 Ga0070672_100562740 3300005543 Bacteria 991
68 Ga0070686_100234201 3300005544 Bacteria 1334
69 Ga0070665_100026809 3300005548 Bacteria 5804
70 Ga0070665_100080978 3300005548 Bacteria 3252
71 Ga0070665_100098823 3300005548 Bacteria 2923
72 Ga0070665_100242346 3300005548 Bacteria 1803
73 Ga0068855_100006458 3300005563 Bacteria 14272
74 Ga0068855_100015167 3300005563 Bacteria 9281
75 Ga0068855_100147186 3300005563 Bacteria 2680
76 Ga0070664_100010417 3300005564 Bacteria 7539
77 Ga0070664_100297039 3300005564 Bacteria 1459
78 Ga0068857_100220345 3300005577 Bacteria 1733
79 Ga0068854_100021113 3300005578 Bacteria 4416
80 Ga0068856_100020278 3300005614 Bacteria 6456
81 Ga0068856_100131080 3300005614 Bacteria 2511
82 Ga0070702_100009494 3300005615 Bacteria 4764
83 Ga0068852_100005809 3300005616 Bacteria 8859
84 Ga0068852_100105090 3300005616 Bacteria 2557
85 Ga0068852_100118252 3300005616 Bacteria 2421
86 Ga0068859_100063039 3300005617 Bacteria 3737
87 Ga0068864_100019747 3300005618 Bacteria 5635
88 Ga0068864_100607650 3300005618 Bacteria 1062
89 Ga0068861_100222998 3300005719 Bacteria 1594
90 Ga0068858_100163808 3300005842 Bacteria 2094
91 Ga0068858_100280847 3300005842 Bacteria 1585
92 Ga0068860_100001772 3300005843 Bacteria 22993
93 Ga0068860_100146136 3300005843 Bacteria 2275
94 Ga0068860_100312341 3300005843 Bacteria 1541
95 Ga0068862_100038755 3300005844 Bacteria 4044
96 Ga0081455_10004061 3300005937 Bacteria 16579
97 Ga0081455_10026871 3300005937 Bacteria 5285
98 Ga0081455_10033821 3300005937 Bacteria 4588
99 Ga0081455_10047934 3300005937 Bacteria 3696
100 Ga0081455_10298168 3300005937 Bacteria 1158
101 Ga0081455_10360327 3300005937 Bacteria 1023
102 Ga0081538_10039589 3300005981 Bacteria 3021
103 Ga0081540_1004539 3300005983 Bacteria 10527
104 Ga0081540_1028335 3300005983 Bacteria 3148
105 Ga0081539_10000064 3300005985 Bacteria 247020
106 Ga0081539_10026402 3300005985 Bacteria 3706
107 Ga0081539_10124496 3300005985 Bacteria 1275
108 Ga0075365_10006253 3300006038 Bacteria 6531
109 Ga0075365_10016939 3300006038 Bacteria 4448
110 Ga0075365_10421550 3300006038 Bacteria 942
111 Ga0075363_100014688 3300006048 Bacteria 3834
112 Ga0075363_100033094 3300006048 Bacteria 2690
113 Ga0075363_100054616 3300006048 Bacteria 2137
114 Ga0075364_10004957 3300006051 Bacteria 7714
115 Ga0075364_10064628 3300006051 Bacteria 2402
116 Ga0075362_10032637 3300006177 Bacteria 2261
117 Ga0075362_10052949 3300006177 Bacteria 1820
118 Ga0075367_10009368 3300006178 Bacteria 5115
119 Ga0075367_10107091 3300006178 Bacteria 1713
120 Ga0075369_10045723 3300006186 Bacteria 1883
121 Ga0075366_10103812 3300006195 Bacteria 1707
122 Ga0075366_10146587 3300006195 Bacteria 1428
123 Ga0075366_10260016 3300006195 Bacteria 1059
124 Ga0097621_100424522 3300006237 Bacteria 1194
125 Ga0075370_10016320 3300006353 Bacteria 3994
126 Ga0075370_10273209 3300006353 Bacteria 1003
127 Ga0068871_100412391 3300006358 Bacteria 1205
128 Ga0075428_100108508 3300006844 Bacteria 3025
129 Ga0068865_100117664 3300006881 Bacteria 1970
130 Ga0097620_100063044 3300006931 Bacteria 3737
131 Ga0099794_10049503 3300007265 Bacteria 2020
132 Ga0099795_10042586 3300007788 Bacteria 1621
133 Ga0105240_10045150 3300009093 Bacteria 5593
134 Ga0105240_10048903 3300009093 Bacteria 5342
135 Ga0105240_10649289 3300009093 Bacteria 1157
136 Ga0111539_10405287 3300009094 Bacteria 1588
137 Ga0105245_10005676 3300009098 Bacteria 10968
138 Ga0105247_10200550 3300009101 Bacteria 1340
139 Ga0114129_10369560 3300009147 Bacteria 1896
140 Ga0105241_10027549 3300009174 Bacteria 4232
141 Ga0105241_10438262 3300009174 Bacteria 1153
142 Ga0105242_10387777 3300009176 Bacteria 1300
143 Ga0105242_10403675 3300009176 Bacteria 1276
144 Ga0105248_10460539 3300009177 Bacteria 1433
145 Ga0105248_10787236 3300009177 Bacteria 1073
146 Ga0105237_10026719 3300009545 Bacteria 5899
147 Ga0105237_10306202 3300009545 Bacteria 1592
148 Ga0105238_10006101 3300009551 Bacteria 11953
149 Ga0105238_10059190 3300009551 Bacteria 3838
150 Ga0105238_10386833 3300009551 Bacteria 1391
151 Ga0105239_10063997 3300010375 Bacteria 4038
152 Ga0157371_10277564 3300013102 Bacteria 1210
153 Ga0157371_10291922 3300013102 Bacteria 1179
154 Ga0157370_10031995 3300013104 Bacteria 5140
155 Ga0157370_10056603 3300013104 Bacteria 3732
156 Ga0157370_10143024 3300013104 Bacteria 2228
157 Ga0157369_10062094 3300013105 Bacteria 4027
158 Ga0157369_10211955 3300013105 Bacteria 2030
159 Ga0157374_10013103 3300013296 Bacteria 7232
160 Ga0157378_10017239 3300013297 Bacteria 6333
161 Ga0157378_10294318 3300013297 Bacteria 1569
162 Ga0163162_10012800 3300013306 Bacteria 8196
163 Ga0163162_10421435 3300013306 Bacteria 1467
164 Ga0157372_10141630 3300013307 Bacteria 2771
165 Ga0157372_10483861 3300013307 Bacteria 1443
166 Ga0163163_10006051 3300014325 Bacteria 10524
167 Ga0163163_10012803 3300014325 Bacteria 7654
168 Ga0157379_10178557 3300014968 Bacteria 1918
169 Ga0157379_10335659 3300014968 Bacteria 1382
170 Ga0157379_10394803 3300014968 Bacteria 1271
171 Ga0157376_10040219 3300014969 Bacteria 3820
172 Ga0213875_10070149 3300021388 Bacteria 1636
173 Ga0213875_10158525 3300021388 Bacteria 1061
174 Ga0207425_1000139 3300025245 Bacteria 64086
175 Ga0209129_1000066 3300025258 Bacteria 226820
176 Ga0209129_1000223 3300025258 Bacteria 64086
177 Ga0209673_1000024 3300025273 Bacteria 409632
178 Ga0209673_1003641 3300025273 Bacteria 8909
179 Ga0209130_1007506 3300025284 Bacteria 3354
180 Ga0209676_1016844 3300025292 Bacteria 2617
181 Ga0209676_1018937 3300025292 Bacteria 2383
182 Ga0209025_1000557 3300025294 Bacteria 69226
183 Ga0209025_1000612 3300025294 Bacteria 64088
184 Ga0209025_1005811 3300025294 Bacteria 9886
185 Ga0209564_1010204 3300025295 Bacteria 4360
186 Ga0209564_1023997 3300025295 Bacteria 2098
187 Ga0209758_1000170 3300025297 Bacteria 149476
188 Ga0209758_1000495 3300025297 Bacteria 64088
189 Ga0209758_1007502 3300025297 Bacteria 7397
190 Ga0209758_1017939 3300025297 Bacteria 3494
191 Ga0209758_1049921 3300025297 Bacteria 1472
192 Ga0209050_1004141 3300025298 Bacteria 10053
193 Ga0209256_1001386 3300025299 Bacteria 25312
194 Ga0209256_1021118 3300025299 Bacteria 2010
195 Ga0207426_1008914 3300025302 Bacteria 4007
196 Ga0209051_1004249 3300025303 Bacteria 8923
197 Ga0209051_1031330 3300025303 Bacteria 2049
198 Ga0209257_1001313 3300025304 Bacteria 30254
199 Ga0209257_1034975 3300025304 Bacteria 1559
200 Ga0207697_10014103 3300025315 Bacteria 3325
201 Ga0207710_10088174 3300025900 Bacteria 1449
202 Ga0207688_10054243 3300025901 Bacteria 2249
203 Ga0207680_10377981 3300025903 Bacteria 998
204 Ga0207643_10075494 3300025908 Bacteria 1945
205 Ga0207705_10158286 3300025909 Bacteria 1700
206 Ga0207654_10083973 3300025911 Bacteria 1924
207 Ga0207654_10213610 3300025911 Bacteria 1276
208 Ga0207707_10072016 3300025912 Bacteria 3012
209 Ga0207695_10049745 3300025913 Bacteria 4415
210 Ga0207695_10055190 3300025913 Bacteria 4142
211 Ga0207695_10423326 3300025913 Bacteria 1216
212 Ga0207671_10212220 3300025914 Bacteria 1515
213 Ga0207662_10034108 3300025918 Bacteria 2970
214 Ga0207657_10157707 3300025919 Bacteria 1845
215 Ga0207652_10087179 3300025921 Bacteria 2738
216 Ga0207652_10396118 3300025921 Bacteria 1246
217 Ga0207694_10023027 3300025924 Bacteria 4727
218 Ga0207659_10083424 3300025926 Bacteria 2369
219 Ga0207687_10022996 3300025927 Bacteria 4151
220 Ga0207644_10152836 3300025931 Bacteria 1787
221 Ga0207709_10034769 3300025935 Bacteria 2974
222 Ga0207670_10467094 3300025936 Bacteria 1020
223 Ga0207669_10005204 3300025937 Bacteria 5811
224 Ga0207691_10202880 3300025940 Bacteria 1725
225 Ga0207691_10409514 3300025940 Bacteria 1156
226 Ga0207711_10148928 3300025941 Bacteria 2111
227 Ga0207711_10484241 3300025941 Bacteria 1153
228 Ga0207689_10023247 3300025942 Bacteria 5205
229 Ga0207689_10324719 3300025942 Bacteria 1277
230 Ga0207679_10022818 3300025945 Bacteria 4267
231 Ga0207679_10328611 3300025945 Bacteria 1326
232 Ga0207679_10421657 3300025945 Bacteria 1178
233 Ga0207667_10022439 3300025949 Bacteria 6974
234 Ga0207667_10033609 3300025949 Bacteria 5512
235 Ga0207667_10058772 3300025949 Bacteria 4031
236 Ga0207667_10453942 3300025949 Bacteria 1302
237 Ga0207651_10124159 3300025960 Bacteria 1964
238 Ga0207668_10193322 3300025972 Bacteria 1614
239 Ga0207668_10340104 3300025972 Bacteria 1251
240 Ga0207640_10026126 3300025981 Bacteria 3542
241 Ga0207640_10254653 3300025981 Bacteria 1364
242 Ga0207677_10050484 3300026023 Bacteria 2814
243 Ga0207677_10066698 3300026023 Bacteria 2517
244 Ga0207703_10220249 3300026035 Bacteria 1696
245 Ga0207639_10044046 3300026041 Bacteria 3354
246 Ga0207639_10377146 3300026041 Bacteria 1273
247 Ga0207678_10001940 3300026067 Bacteria 18878
248 Ga0207678_10024458 3300026067 Bacteria 5275
249 Ga0207678_10037244 3300026067 Bacteria 4232
250 Ga0207678_10049285 3300026067 Bacteria 3640
251 Ga0207678_10084355 3300026067 Bacteria 2717
252 Ga0207678_10388433 3300026067 Bacteria 1207
253 Ga0207678_10539372 3300026067 Bacteria 1020
254 Ga0207708_10235871 3300026075 Bacteria 1470
255 Ga0207702_10003356 3300026078 Bacteria 14683
256 Ga0207702_10033935 3300026078 Bacteria 4264
257 Ga0207702_10094416 3300026078 Bacteria 2626
258 Ga0207702_10558100 3300026078 Bacteria 1121
259 Ga0207676_10207299 3300026095 Bacteria 1736
260 Ga0207674_10069402 3300026116 Bacteria 3545
261 Ga0207674_10356954 3300026116 Bacteria 1413
262 Ga0207675_100123921 3300026118 Bacteria 2447
263 Ga0207683_10075692 3300026121 Bacteria 2980
264 Ga0207683_10134620 3300026121 Bacteria 2224
265 Ga0207683_10214473 3300026121 Bacteria 1753
266 Ga0207698_10061660 3300026142 Bacteria 2924
267 Ga0207698_10087879 3300026142 Bacteria 2533
268 Ga0207698_10281577 3300026142 Bacteria 1538
269 Ga0209588_1030991 3300027671 Bacteria 1710
270 Ga0209813_10112615 3300027866 Bacteria 939
271 Ga0209974_10044132 3300027876 Bacteria 1486
272 Ga0268266_10004300 3300028379 Bacteria 13711
273 Ga0268266_10090488 3300028379 Bacteria 2682
274 Ga0268265_10037061 3300028380 Bacteria 3575
275 Ga0268264_10000157 3300028381 Bacteria 155163
276 Ga0265334_10019220 3300028573 Bacteria 2814
277 Ga0307517_10000563 3300028786 Bacteria 63467
278 Ga0307515_10051455 3300028794 Bacteria 6140
279 Ga0307515_10097972 3300028794 Bacteria 3576
280 Ga0307515_10285074 3300028794 Bacteria 1354
281 Ga0307511_10156389 3300030521 Bacteria 1293
282 Ga0307513_10075026 3300031456 Bacteria 3514
283 Ga0307408_100105215 3300031548 Bacteria 2157
284 Ga0307408_100494584 3300031548 Bacteria 1069
285 Ga0307508_10084260 3300031616 Bacteria 2761
286 Ga0307516_10075321 3300031730 Bacteria 3229
287 Ga0307516_10206971 3300031730 Bacteria 1678
288 Ga0307405_10003590 3300031731 Bacteria 7162
289 Ga0307405_10021947 3300031731 Bacteria 3600
290 Ga0307405_10097536 3300031731 Bacteria 1963
291 Ga0307413_10081300 3300031824 Bacteria 2077
292 Ga0307413_10236275 3300031824 Bacteria 1346
293 Ga0307407_10096993 3300031903 Bacteria 1821
294 Ga0307412_10004798 3300031911 Bacteria 7543
295 Ga0307412_10409713 3300031911 Bacteria 1106
296 Ga0307409_100120532 3300031995 Bacteria 2220
297 Ga0307416_100524016 3300032002 Bacteria 1254
298 Ga0307416_100582896 3300032002 Bacteria 1196
299 Ga0307414_10030964 3300032004 Bacteria 3502
300 Ga0307411_10150379 3300032005 Bacteria 1729
301 Ga0307415_100017294 3300032126 Bacteria 4321
302 Ga0307415_100129245 3300032126 Bacteria 1909
303 Ga0307415_100161505 3300032126 Bacteria 1737
304 Ga0307507_10218076 3300033179 Bacteria 1288
305 Ga0307510_10003322 3300033180 Bacteria 18742
306 Ga0373923_0115012 3300035111 Bacteria 1198
307 Ga0373932_0140385 3300035112 Bacteria 821
308 Ga0373945_0021487 3300035116 Bacteria 2218
309 Ga0373943_0004586 3300035170 Bacteria 6242
310 Ga0373943_0031617 3300035170 Bacteria 2512
311 Ga0373946_0003778 3300035171 Bacteria 5371
312 Ga0373924_0049940 3300035410 Bacteria 1732
313 Ga0373931_0001536 3300035691 Bacteria 9952
314 Ga0373931_0037121 3300035691 Bacteria 2543
315 Ga0373931_0039608 3300035691 Bacteria 2469
316 Ga0373935_0003462 3300035692 Bacteria 9171
317 Ga0373935_0147060 3300035692 Bacteria 1596
318 Ga0373927_0003270 3300035695 Bacteria 11653
319 Ga0373927_0046561 3300035695 Bacteria 2806
320 Ga0373927_0048000 3300035695 Bacteria 2761
321 Ga0373933_0000118 3300035724 Bacteria 51316
322 Ga0373947_0000402 3300035725 Bacteria 24400
323 Ga0373947_0083197 3300035725 Bacteria 1984
324 Ga0373947_0305189 3300035725 Bacteria 1062
325 Ga0373937_0017978 3300036401 Bacteria 6307
326 Ga0373937_0061382 3300036401 Bacteria 3455
327 Ga0373925_0005137 3300037068 Bacteria 9807
328 Ga0373925_0387402 3300037068 Bacteria 1139
329 Ga0395900_0392517 3300037418 Bacteria 1353
330 Ga0395905_0042788 3300037471 Bacteria 4249
331 Ga0395905_0248249 3300037471 Bacteria 1663
332 Ga0436364_0022219 3300037853 Bacteria 6632
333 Ga0436364_1025898 3300037853 Bacteria 2714
334 Ga0395901_0106311 3300038443 Bacteria 2946
335 Ga0395901_0385638 3300038443 Bacteria 1441
336 Ga0436362_0916838 3300039453 Bacteria 813
337 Ga0451843_0952665 3300041509 Bacteria 1163
338 Ga0451853_0699412 3300041512 Bacteria 2309
339 Ga0439449_0095604 3300042007 Bacteria 1098
340 Ga0466960_0030825 3300044901 Bacteria 2471
341 Ga0466960_0130267 3300044901 Bacteria 1327
342 Ga0466967_1113015 3300045976 Bacteria 787
343 Ga0495617_020423 3300046452 Bacteria 2239
344 Ga0495627_036172 3300046453 Bacteria 1536
345 Ga0495592_0056633 3300046454 Bacteria 2896
346 Ga0495603_0000826 3300046455 Bacteria 17795
347 Ga0495603_0023711 3300046455 Bacteria 3712
348 Ga0495603_0066420 3300046455 Bacteria 2124
349 Ga0495603_0075578 3300046455 Bacteria 1977
350 Ga0495629_0000587 3300046459 Bacteria 29538
351 Ga0495629_0190864 3300046459 Bacteria 1418
352 Ga0495638_0000833 3300046460 Bacteria 32378
353 Ga0495638_0012048 3300046460 Bacteria 5941
354 Ga0495638_0208682 3300046460 Bacteria 1098
355 Ga0495641_0019439 3300046461 Bacteria 3474
356 Ga0495580_0002634 3300046472 Bacteria 15585
357 Ga0495580_0128338 3300046472 Bacteria 1760
358 Ga0495582_0000018 3300046473 Bacteria 93753
359 Ga0495582_0179846 3300046473 Bacteria 1205
360 Ga0495605_0002954 3300046474 Bacteria 10294
361 Ga0495639_0000272 3300046475 Bacteria 25666
362 Ga0495664_0054267 3300046477 Bacteria 2383
363 Ga0495585_0010998 3300046492 Bacteria 5374
364 Ga0495585_0053442 3300046492 Bacteria 2235
365 Ga0495585_0226400 3300046492 Bacteria 941
366 Ga0495594_0000155 3300046499 Bacteria 32688
367 Ga0495594_0201232 3300046499 Bacteria 1135
368 Ga0495607_0048719 3300046501 Bacteria 2476
369 Ga0495607_0053211 3300046501 Bacteria 2341
370 Ga0495583_0016172 3300046506 Bacteria 4021
371 Ga0495606_0214763 3300046507 Bacteria 1087
372 Ga0495610_0007227 3300046512 Bacteria 7449
373 Ga0495610_0138702 3300046512 Bacteria 1049
374 Ga0495616_0018020 3300046513 Bacteria 3888
375 Ga0495616_0067090 3300046513 Bacteria 1745
376 Ga0495618_0007273 3300046514 Bacteria 6699
377 Ga0495620_0025262 3300046515 Bacteria 2813
378 Ga0495628_0225301 3300046516 Bacteria 1407
379 Ga0495630_0034444 3300046517 Bacteria 3781
380 Ga0495631_0005687 3300046518 Bacteria 6505
381 Ga0495631_0066771 3300046518 Bacteria 1556
382 Ga0495632_0012036 3300046519 Bacteria 5011
383 Ga0495632_0115494 3300046519 Bacteria 1257
384 Ga0495637_0067400 3300046520 Bacteria 1453
385 Ga0495643_0160169 3300046522 Bacteria 1108
386 Ga0495643_0193549 3300046522 Bacteria 980
387 Ga0495643_0214360 3300046522 Bacteria 917
388 Ga0495644_0014165 3300046523 Bacteria 3055
389 Ga0495666_0006572 3300046526 Bacteria 5850
390 Ga0495666_0167334 3300046526 Bacteria 1018
391 Ga0495652_0037042 3300046529 Bacteria 4235
392 Ga0495654_0000070 3300046530 Bacteria 117357
393 Ga0495640_0007630 3300046533 Bacteria 8504
394 Ga0495587_0239528 3300046536 Bacteria 1021
395 Ga0495609_0044048 3300046538 Bacteria 2002
396 Ga0495609_0131690 3300046538 Bacteria 1070
397 Ga0495597_0102832 3300046542 Bacteria 1203
398 Ga0495645_0210350 3300046543 Bacteria 1314
399 Ga0495622_0063255 3300046557 Bacteria 1712
400 Ga0495667_0101034 3300046559 Bacteria 1866
401 Ga0495656_0010222 3300046615 Bacteria 3404
402 Ga0495656_0042684 3300046615 Bacteria 1900
403 Ga0495668_0008208 3300046616 Bacteria 6556
404 Ga0495634_0005787 3300046642 Bacteria 9439
405 Ga0495611_0013344 3300046648 Bacteria 3497
406 Ga0495611_0106773 3300046648 Bacteria 1302
407 Ga0495625_0007996 3300046660 Bacteria 9082
408 Ga0495625_0062133 3300046660 Bacteria 2641
409 Ga0495625_0149406 3300046660 Bacteria 1571
410 Ga0495625_0260514 3300046660 Bacteria 1122
411 Ga0495635_0001867 3300046663 Bacteria 14261
412 Ga0495659_0158973 3300046664 Bacteria 911
413 Ga0495661_0125139 3300046665 Bacteria 1415
414 Ga0495588_0002125 3300046674 Bacteria 8499
415 Ga0495588_0050176 3300046674 Bacteria 2147
416 Ga0495599_0126438 3300046678 Bacteria 1589
417 Ga0495646_0049449 3300046680 Bacteria 2552
418 Ga0495647_0001870 3300046681 Bacteria 6539
419 Ga0495658_0002067 3300046683 Bacteria 10172
420 Ga0495658_0290200 3300046683 Bacteria 1033
421 Ga0495669_0084519 3300046684 Bacteria 1459
422 Ga0495613_0027117 3300046689 Bacteria 4263
423 Ga0495613_0317874 3300046689 Bacteria 1075
424 Ga0495624_0001316 3300046690 Bacteria 19466
425 Ga0495670_0010896 3300046691 Bacteria 4467
426 Ga0495670_0127528 3300046691 Bacteria 1325
427 Ga0495600_0261693 3300046809 Bacteria 1099
428 Ga0495660_0008560 3300046810 Bacteria 5990
429 Ga0495581_0001084 3300047315 Bacteria 14807
430 Ga0495581_0012982 3300047315 Bacteria 4829
431 Ga0495581_0024937 3300047315 Bacteria 3465
432 Ga0495636_0019473 3300047318 Bacteria 2729
433 Ga0495674_0003842 3300047319 Bacteria 14589
434 Ga0495674_0202125 3300047319 Bacteria 1648
435 Ga0495672_0006265 3300047320 Bacteria 9267
436 Ga0495672_0025520 3300047320 Bacteria 3780
437 Ga0495676_0014924 3300047321 Bacteria 6936
438 Ga0495687_021545 3300047443 Bacteria 3115
439 Ga0495684_0045699 3300047471 Bacteria 3351
440 Ga0495686_0023341 3300047472 Bacteria 4081
441 Ga0495686_0031787 3300047472 Bacteria 3419
442 Ga0495593_0000419 3300047673 Bacteria 23659
443 Ga0495615_0054306 3300048090 Bacteria 1040
444 Ga0495626_0027839 3300048091 Bacteria 2745
445 Ga0496100_0020076 3300048903 Bacteria 4000
446 Ga0496100_0228476 3300048903 Bacteria 1368
447 Ga0496101_0240659 3300048904 Bacteria 1408
448 Ga0496102_0002704 3300048905 Bacteria 15082
449 Ga0496102_0175439 3300048905 Bacteria 2018
450 Ga0496102_0217481 3300048905 Bacteria 1801
451 Ga0496102_0240401 3300048905 Bacteria 1707
452 Ga0496103_0091609 3300048906 Bacteria 1918
453 Ga0496104_0001082 3300048907 Bacteria 23263
454 Ga0496104_0016511 3300048907 Bacteria 6707
455 Ga0496105_0001148 3300048908 Bacteria 18448
456 Ga0496105_0003117 3300048908 Bacteria 12200
457 Ga0496105_0063670 3300048908 Bacteria 3042
458 Ga0496106_0000246 3300048909 Bacteria 37806
459 Ga0496106_0007049 3300048909 Bacteria 8300
460 Ga0496107_0015565 3300048910 Bacteria 5332
461 Ga0496108_0001659 3300048911 Bacteria 17640
462 Ga0496108_0022922 3300048911 Bacteria 5137
463 Ga0496108_0028959 3300048911 Bacteria 4582
464 Ga0496109_0002048 3300048912 Bacteria 16714
465 Ga0496109_0013738 3300048912 Bacteria 7035
466 Ga0496110_0008384 3300048913 Bacteria 8314
467 Ga0496110_0029898 3300048913 Bacteria 4694
468 Ga0496110_0061035 3300048913 Bacteria 3326
469 Ga0496110_0130949 3300048913 Bacteria 2265
470 Ga0496111_0012718 3300048914 Bacteria 5706
471 Ga0496111_0045079 3300048914 Bacteria 3172
472 Ga0496111_0062177 3300048914 Bacteria 2707
473 Ga0496111_0073060 3300048914 Bacteria 2497
474 Ga0496112_0000020 3300048915 Bacteria 169373
475 Ga0496112_0000896 3300048915 Bacteria 21449
476 Ga0496112_0029729 3300048915 Bacteria 5285
477 Ga0496112_0052787 3300048915 Bacteria 3991
478 Ga0496112_0054174 3300048915 Bacteria 3941
479 Ga0496112_0123913 3300048915 Bacteria 2555
480 Ga0496112_0146675 3300048915 Bacteria 2328
481 Ga0496113_0000418 3300048916 Bacteria 20649
482 Ga0496113_0005880 3300048916 Bacteria 7699
483 Ga0496113_0008522 3300048916 Bacteria 6684
484 Ga0496113_0142445 3300048916 Bacteria 1887
485 Ga0496113_0288980 3300048916 Bacteria 1311
486 Ga0496114_0018754 3300048917 Bacteria 5599
487 Ga0496115_0001613 3300048918 Bacteria 16216
488 Ga0496115_0001912 3300048918 Bacteria 14866
489 Ga0496115_0074897 3300048918 Bacteria 2749
490 Ga0496115_0144881 3300048918 Bacteria 1960
491 Ga0496116_0003347 3300048919 Bacteria 15910
492 Ga0496116_0013325 3300048919 Bacteria 6638
493 Ga0496116_0031866 3300048919 Bacteria 3765
494 Ga0496117_0018057 3300048920 Bacteria 5865
495 Ga0496117_0020727 3300048920 Bacteria 5349
496 Ga0496117_0022800 3300048920 Bacteria 5014
497 Ga0496117_0248607 3300048920 Bacteria 971
498 Ga0496118_0043406 3300048921 Bacteria 3535
499 Ga0496118_0065233 3300048921 Bacteria 2665
500 Ga0496118_0094446 3300048921 Bacteria 2045
501 Ga0496118_0102794 3300048921 Bacteria 1925
502 Ga0496119_0200833 3300048922 Bacteria 1032
503 Ga0496120_0088234 3300048923 Bacteria 1663
504 Ga0496120_0118508 3300048923 Bacteria 1372
505 Ga0496120_0155762 3300048923 Bacteria 1144
506 Ga0496121_0000270 3300048924 Bacteria 108787
507 Ga0496121_0000423 3300048924 Bacteria 83271
508 Ga0496121_0038910 3300048924 Bacteria 4201
509 Ga0496121_0042847 3300048924 Bacteria 3929
510 Ga0496121_0054223 3300048924 Bacteria 3352
511 Ga0496121_0093632 3300048924 Bacteria 2338
512 Ga0496122_0035434 3300048925 Bacteria 4059
513 Ga0496122_0045607 3300048925 Bacteria 3405
514 Ga0496123_0043809 3300048926 Bacteria 3069
515 Ga0496124_0000235 3300048927 Bacteria 107983
516 Ga0496124_0008518 3300048927 Bacteria 10706
517 Ga0496124_0055170 3300048927 Bacteria 3359
518 Ga0496124_0057434 3300048927 Bacteria 3279
519 Ga0496124_0141340 3300048927 Bacteria 1899
520 Ga0496124_0168123 3300048927 Bacteria 1702
521 Ga0496125_0000136 3300048928 Bacteria 160544
522 Ga0496125_0010670 3300048928 Bacteria 9274
523 Ga0496125_0016001 3300048928 Bacteria 7222
524 Ga0496125_0019278 3300048928 Bacteria 6441
525 Ga0496125_0066023 3300048928 Bacteria 2862
526 Ga0496125_0099040 3300048928 Bacteria 2155
527 Ga0496125_0126245 3300048928 Bacteria 1812
528 Ga0496125_0145003 3300048928 Bacteria 1643
529 Ga0496126_0022756 3300048929 Bacteria 6087
530 Ga0496126_0028765 3300048929 Bacteria 5290
531 Ga0496126_0041530 3300048929 Bacteria 4255
532 Ga0496126_0173703 3300048929 Bacteria 1834
533 Ga0496126_0193117 3300048929 Bacteria 1723
534 Ga0496126_0211409 3300048929 Bacteria 1633
535 Ga0496126_0227673 3300048929 Bacteria 1563
536 Ga0496126_0461126 3300048929 Bacteria 1021
537 Ga0495678_031113 3300049459 Bacteria 2228
538 Ga0495678_081863 3300049459 Bacteria 1157
539 Ga0495682_0018813 3300049460 Bacteria 2601
540 Ga0501031_0013783 3300049568 Bacteria 5269
541 Ga0501031_0029347 3300049568 Bacteria 3588
542 Ga0501032_0104593 3300049569 Bacteria 1875
543 Ga0501033_0159679 3300049570 Bacteria 1623
544 Ga0501034_0000243 3300049571 Bacteria 100637
545 Ga0501034_0203547 3300049571 Bacteria 1937
546 Ga0501034_0223324 3300049571 Bacteria 1835
547 Ga0501036_0002580 3300049572 Bacteria 14248
548 Ga0501037_0013834 3300049573 Bacteria 5946
549 Ga0501038_0054282 3300049574 Bacteria 3446
550 Ga0501038_0076488 3300049574 Bacteria 2827
551 Ga0501038_0156099 3300049574 Bacteria 1858
552 Ga0501039_0043067 3300049575 Bacteria 3488
553 Ga0501039_0068344 3300049575 Bacteria 2759
554 Ga0501039_0090688 3300049575 Bacteria 2382
555 Ga0501040_0010259 3300049576 Bacteria 6126
556 Ga0501040_0156031 3300049576 Bacteria 1612
557 Ga0501041_0000389 3300049577 Bacteria 22050
558 Ga0501041_0028442 3300049577 Bacteria 3372
559 Ga0501041_0056361 3300049577 Bacteria 2401
560 Ga0501042_0000299 3300049578 Bacteria 24677
561 Ga0501042_0135063 3300049578 Bacteria 1778
562 Ga0501043_0026939 3300049579 Bacteria 4510
563 Ga0501046_0022939 3300049580 Bacteria 5139
564 Ga0501046_0063933 3300049580 Bacteria 2873
565 Ga0501046_0124426 3300049580 Bacteria 1960
566 Ga0501047_0021011 3300049581 Bacteria 6270
567 Ga0501048_0008163 3300049582 Bacteria 7919
568 Ga0501067_0215816 3300049583 Bacteria 1068
569 Ga0501068_0029725 3300049584 Bacteria 3238
570 Ga0501068_0201881 3300049584 Bacteria 1261
571 Ga0501070_0040406 3300049586 Bacteria 3889
572 Ga0501070_0096978 3300049586 Bacteria 2439
573 Ga0501071_0001011 3300049587 Bacteria 15479
574 Ga0501071_0087529 3300049587 Bacteria 2285
575 Ga0501072_0000560 3300049588 Bacteria 26770
576 Ga0501072_0004805 3300049588 Bacteria 10290
577 Ga0501074_0026065 3300049590 Bacteria 4240
578 Ga0501074_0047456 3300049590 Bacteria 3104
579 Ga0501074_0141964 3300049590 Bacteria 1718
580 Ga0501075_0000020 3300049591 Bacteria 67432
581 Ga0501075_0000035 3300049591 Bacteria 55355
582 Ga0501075_0010105 3300049591 Bacteria 6623
583 Ga0501076_0000074 3300049592 Bacteria 50353
584 Ga0501076_0000860 3300049592 Bacteria 19712
585 Ga0501077_0000534 3300049593 Bacteria 23065
586 Ga0501238_001035 3300049671 Bacteria 3168
587 Ga0501079_0001380 3300049741 Bacteria 17098
588 Ga0501079_0132293 3300049741 Bacteria 1941
589 Ga0501080_0020125 3300049742 Bacteria 6176
590 Ga0501080_0050507 3300049742 Bacteria 3870
591 Ga0501081_0002552 3300049743 Bacteria 11491
592 Ga0501081_0004988 3300049743 Bacteria 8546
593 Ga0501081_0009657 3300049743 Bacteria 6291
594 Ga0501035_0030102 3300049822 Bacteria 4949
595 Ga0501035_0388234 3300049822 Bacteria 1163
596 Ga0501044_0178495 3300049823 Bacteria 2091
597 Ga0501045_0001426 3300049824 Bacteria 15934
598 nmdc:mga03683_1977_c2 3300050489 Bacteria 2356
599 nmdc:mga03683_25662_c1 3300050489 Bacteria 2318
600 nmdc:mga03n38_27549_c1 3300050490 Bacteria 2359
601 nmdc:mga03n38_6856_c1 3300050490 Bacteria 3992
602 nmdc:mga00v17_179472_c1 3300050491 Bacteria 1366
603 nmdc:mga00v17_26_c4 3300050491 Bacteria 47279
604 nmdc:mga0yw44_12063_c1 3300050492 Bacteria 4489
605 nmdc:mga0yw44_1304_c1 3300050492 Bacteria 9849
606 nmdc:mga0yw44_42184_c1 3300050492 Bacteria 2720
607 nmdc:mga0yw44_5703_c1 3300050492 Bacteria 5929
608 nmdc:mga0yw44_71610_c1 3300050492 Bacteria 2153
609 nmdc:mga0k408_107162_c1 3300050493 Bacteria 1651
610 nmdc:mga06z11_169871_c1 3300050494 Bacteria 1251
611 nmdc:mga06z11_174938_c1 3300050494 Bacteria 1235
612 nmdc:mga06z11_60847_c1 3300050494 Bacteria 1967
613 nmdc:mga06z11_6341_c1 3300050494 Bacteria 4803
614 nmdc:mga06z11_83338_c1 3300050494 Bacteria 1721
615 nmdc:mga04h51_120054_c1 3300050495 Bacteria 978
616 nmdc:mga04h51_41871_c1 3300050495 Bacteria 1499
617 nmdc:mga07m45_57971_c1 3300050496 Bacteria 2191
618 nmdc:mga07m45_9507_c1 3300050496 Bacteria 5045
619 nmdc:mga05p37_117318_c1 3300050507 Bacteria 3271
620 nmdc:mga08y16_289005_c1 3300050511 Bacteria 1690
621 nmdc:mga0sz30_29166_c1 3300050516 Bacteria 2273
622 nmdc:mga0sz30_51173_c1 3300050516 Bacteria 1752
623 Ga0495601_0243834 3300053077 Bacteria 1173
624 Ga0500610_0018728 3300053079 Bacteria 3354
625 Ga0500610_0192037 3300053079 Bacteria 991
626 Ga0495619_0050354 3300053085 Bacteria 2749
627 Ga0500643_032290 3300053087 Bacteria 1591
628 Ga0500581_015132 3300053089 Bacteria 3847
629 Ga0500646_0069005 3300053090 Bacteria 1056
630 Ga0500583_0105392 3300053092 Bacteria 1384
631 Ga0500566_0007835 3300053094 Bacteria 6327
632 Ga0500566_0044722 3300053094 Bacteria 2550
633 Ga0500566_0212438 3300053094 Bacteria 968
634 Ga0500641_0001799 3300053096 Bacteria 7600
635 Ga0500650_0001027 3300053098 Bacteria 7959
636 Ga0500556_0000006 3300053104 Bacteria 453982
637 Ga0500556_0079668 3300053104 Bacteria 1236
638 Ga0500557_001701 3300053105 Bacteria 3733
639 Ga0500562_011821 3300053108 Bacteria 2217
640 Ga0500593_011818 3300053117 Bacteria 3690
641 Ga0500594_0006622 3300053118 Bacteria 2608
642 Ga0500595_001180 3300053119 Bacteria 14424
643 Ga0500608_000937 3300053122 Bacteria 10442
644 Ga0500618_000096 3300053125 Bacteria 72003
645 Ga0500618_000415 3300053125 Bacteria 28810
646 Ga0500618_003908 3300053125 Bacteria 4958
647 Ga0500642_0000004 3300053130 Bacteria 433122
648 Ga0500642_0056491 3300053130 Bacteria 1749
649 Ga0500652_001163 3300053131 Bacteria 8395
650 Ga0500655_009861 3300053133 Bacteria 1724
651 Ga0500658_0065981 3300053134 Bacteria 1517
652 Ga0500559_0000276 3300053136 Bacteria 39738
653 Ga0500559_0081072 3300053136 Bacteria 1475
654 Ga0500568_0001000 3300053139 Bacteria 19361
655 Ga0500568_0002024 3300053139 Bacteria 12357
656 Ga0500586_000530 3300053145 Bacteria 7683
657 Ga0500588_0054521 3300053146 Bacteria 1259
658 Ga0500603_000275 3300053150 Bacteria 13576
659 Ga0500616_0000022 3300053153 Bacteria 460463
660 Ga0500616_0000170 3300053153 Bacteria 108126
661 Ga0500616_0000903 3300053153 Bacteria 32556
662 Ga0500622_0009939 3300053156 Bacteria 5247
663 Ga0500622_0101899 3300053156 Bacteria 1412
664 Ga0500634_0000006 3300053161 Bacteria 171639
665 Ga0500634_0047729 3300053161 Bacteria 2311
666 Ga0500638_100255 3300053162 Bacteria 1352
667 Ga0500636_0003529 3300053177 Bacteria 8800
668 Ga0500636_0173937 3300053177 Bacteria 1162
669 Ga0500637_0000247 3300053178 Bacteria 20090
670 Ga0500637_0003800 3300053178 Bacteria 7022
671 Ga0500637_0043652 3300053178 Bacteria 2539
672 Ga0500637_0091394 3300053178 Bacteria 1763
673 Ga0500645_006911 3300053730 Bacteria 4004
674 Ga0501084_0000639 3300054114 Bacteria 26652
675 Ga0501084_0045225 3300054114 Bacteria 3686
676 Ga0501082_0001342 3300060353 Bacteria 21602
677 Ga0501082_0026780 3300060353 Bacteria 4969
678 Ga0501082_0047480 3300060353 Bacteria 3700
679 Ga0530510_0000163 3300061734 Bacteria 40170
680 Ga0530510_0003145 3300061734 Bacteria 11338
681 Ga0530510_0005965 3300061734 Bacteria 8451
682 Ga0530510_0060902 3300061734 Bacteria 2732

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0214360 Ga0495643_0214360_31_720 229
2 3300046522 Ga0495643_0193549 Ga0495643_0193549_245_958 237
3 3300046542 Ga0495597_0102832 Ga0495597_0102832_453_1181 242
4 3300045976 Ga0466967_1113015 Ga0466967_1113015_20_772 250
5 3300035112 Ga0373932_0140385 Ga0373932_0140385_38_805 253
6 3300026116 Ga0207674_10069402 Ga0207674_100694023 254
7 3300039453 Ga0436362_0916838 Ga0436362_0916838_24_788 254
8 3300002773 JGI25152J39213_1004994 JGI25152J39213_10049944 258
9 3300025258 Ga0209129_1000066 Ga0209129_100006646 258
10 3300025284 Ga0209130_1007506 Ga0209130_10075063 258
11 3300025294 Ga0209025_1000557 Ga0209025_100055748 258
12 3300025303 Ga0209051_1031330 Ga0209051_10313302 258
13 3300048928 Ga0496125_0016001 Ga0496125_0016001_3073_3921 258
14 3300048928 Ga0496125_0099040 Ga0496125_0099040_436_1284 258
15 3300025299 Ga0209256_1021118 Ga0209256_10211181 259
16 3300046691 Ga0495670_0010896 Ga0495670_0010896_3660_4439 259
17 3300005937 Ga0081455_10004061 Ga0081455_100040617 262
18 3300006038 Ga0075365_10006253 Ga0075365_100062533 264
19 3300025297 Ga0209758_1049921 Ga0209758_10499212 264
20 3300048929 Ga0496126_0461126 Ga0496126_0461126_64_912 264
21 3300049570 Ga0501033_0159679 Ga0501033_0159679_97_945 264
22 3300049580 Ga0501046_0022939 Ga0501046_0022939_1488_2336 264
23 3300049586 Ga0501070_0096978 Ga0501070_0096978_1515_2363 264
24 3300049822 Ga0501035_0388234 Ga0501035_0388234_97_945 264
25 3300050492 nmdc:mga0yw44_1304_c1 nmdc:mga0yw44_1304_c1_7136_7984 264
26 3300014968 Ga0157379_10335659 Ga0157379_103356592 265
27 3300046689 Ga0495613_0317874 Ga0495613_0317874_19_864 266
28 3300005327 Ga0070658_10002931 Ga0070658_1000293113 267
29 3300005344 Ga0070661_100333652 Ga0070661_1003336522 267
30 3300005455 Ga0070663_100385175 Ga0070663_1003851752 267
31 3300005539 Ga0068853_100059188 Ga0068853_1000591882 267
32 3300005539 Ga0068853_100067103 Ga0068853_1000671033 267
33 3300005563 Ga0068855_100006458 Ga0068855_1000064586 267
34 3300005578 Ga0068854_100021113 Ga0068854_1000211133 267
35 3300005614 Ga0068856_100131080 Ga0068856_1001310802 267
36 3300005616 Ga0068852_100005809 Ga0068852_1000058092 267
37 3300009093 Ga0105240_10045150 Ga0105240_100451503 267
38 3300009174 Ga0105241_10027549 Ga0105241_100275493 267
39 3300009551 Ga0105238_10059190 Ga0105238_100591902 267
40 3300013102 Ga0157371_10277564 Ga0157371_102775642 267
41 3300013104 Ga0157370_10031995 Ga0157370_100319952 267
42 3300013104 Ga0157370_10056603 Ga0157370_100566032 267
43 3300013105 Ga0157369_10062094 Ga0157369_100620943 267
44 3300013105 Ga0157369_10211955 Ga0157369_102119553 267
45 3300013307 Ga0157372_10141630 Ga0157372_101416303 267
46 3300013307 Ga0157372_10483861 Ga0157372_104838612 267
47 3300025909 Ga0207705_10158286 Ga0207705_101582861 267
48 3300025911 Ga0207654_10213610 Ga0207654_102136102 267
49 3300025913 Ga0207695_10049745 Ga0207695_100497452 267
50 3300025919 Ga0207657_10157707 Ga0207657_101577072 267
51 3300025949 Ga0207667_10022439 Ga0207667_100224397 267
52 3300025949 Ga0207667_10058772 Ga0207667_100587723 267
53 3300025981 Ga0207640_10026126 Ga0207640_100261263 267
54 3300025981 Ga0207640_10254653 Ga0207640_102546531 267
55 3300026041 Ga0207639_10044046 Ga0207639_100440463 267
56 3300026067 Ga0207678_10388433 Ga0207678_103884332 267
57 3300026078 Ga0207702_10003356 Ga0207702_1000335611 267
58 3300026142 Ga0207698_10061660 Ga0207698_100616602 267
59 3300026142 Ga0207698_10281577 Ga0207698_102815771 267
60 3300037418 Ga0395900_0392517 Ga0395900_0392517_494_1342 267
61 3300038443 Ga0395901_0385638 Ga0395901_0385638_162_1010 267
62 3300025304 Ga0209257_1034975 Ga0209257_10349752 270
63 3300032004 Ga0307414_10030964 Ga0307414_100309643 271
64 3300047319 Ga0495674_0202125 Ga0495674_0202125_604_1452 271
65 3300050511 nmdc:mga08y16_289005_c1 nmdc:mga08y16_289005_c1_306_1121 271
66 3300005340 Ga0070689_100129764 Ga0070689_1001297642 273
67 3300009176 Ga0105242_10387777 Ga0105242_103877771 273
68 3300025936 Ga0207670_10467094 Ga0207670_104670941 273
69 iso_pu_bacteria 2937843397 2937845105 273
70 3300042007 Ga0439449_0095604 Ga0439449_0095604_78_962 275
71 3300049574 Ga0501038_0156099 Ga0501038_0156099_251_1096 275
72 3300049575 Ga0501039_0043067 Ga0501039_0043067_2209_3054 275
73 3300049577 Ga0501041_0056361 Ga0501041_0056361_967_1812 275
74 3300049580 Ga0501046_0063933 Ga0501046_0063933_1140_1985 275
75 3300049590 Ga0501074_0141964 Ga0501074_0141964_398_1243 275
76 3300049591 Ga0501075_0010105 Ga0501075_0010105_3458_4303 275
77 3300049741 Ga0501079_0132293 Ga0501079_0132293_509_1354 275
78 3300049743 Ga0501081_0009657 Ga0501081_0009657_1239_2084 275
79 3300060353 Ga0501082_0047480 Ga0501082_0047480_818_1663 275
80 3300061734 Ga0530510_0060902 Ga0530510_0060902_917_1762 275
81 iso_pu_bacteria 2508501050 2508731492 277
82 iso_pu_bacteria 2773857925 2774868428 277
83 iso_pu_bacteria 2775506901 2776262638 277
84 iso_pu_bacteria 2882456835 2882459224 277
85 iso_pu_bacteria 2894232714 2894233002 277
86 iso_pu_bacteria 2510917026 2511172461 278
87 iso_pu_bacteria 2513237101 2513694298 278
88 iso_pu_bacteria 2513237144 2513911183 278
89 iso_pu_bacteria 2523231067 2523467511 278
90 iso_pu_bacteria 2585427594 2585843836 278
91 iso_pu_bacteria 2602042107 2603858412 278
92 iso_pu_bacteria 2643221580 2643913053 278
93 iso_pu_bacteria 2643221591 2643964870 278
94 iso_pu_bacteria 2643221643 2644237549 278
95 iso_pu_bacteria 2643221674 2644411493 278
96 iso_pu_bacteria 2721755755 2723841539 278
97 iso_pu_bacteria 2738541293 2738800912 278
98 iso_pu_bacteria 2738543031 2739347952 278
99 iso_pu_bacteria 2791355199 2793079229 278
100 iso_pu_bacteria 2818991461 2819685926 278
101 iso_pu_bacteria 2837678835 2837680206 278
102 iso_pu_bacteria 2857524615 2857526491 278
103 iso_pu_bacteria 2874604998 2874608166 278
104 iso_pu_bacteria 2876808645 2876813382 278
105 iso_pu_bacteria 2879110137 2879113065 278
106 iso_pu_bacteria 2884298095 2884298699 278
107 iso_pu_bacteria 2889033259 2889035615 278
108 iso_pu_bacteria 2889790730 2889794572 278
109 iso_pu_bacteria 2889914905 2889919340 278
110 iso_pu_bacteria 2893066018 2893067261 278
111 iso_pu_bacteria 2909042592 2909047006 278
112 iso_pu_bacteria 2919073203 2919073694 278
113 iso_pu_bacteria 2919171160 2919172363 278
114 iso_pu_bacteria 2922361189 2922364095 278
115 iso_pu_bacteria 2922386360 2922392670 278
116 iso_pu_bacteria 2932401849 2932404296 278
117 iso_pu_bacteria 3000017691 3000018675 278
118 iso_pu_bacteria 3005409236 3005410744 278
119 iso_pu_bacteria 8006964411 8006969261 278
120 iso_pu_bacteria 8006984368 8006990818 278
121 iso_pu_bacteria 8006994254 8006996691 278
122 iso_pu_bacteria 8056673599 8056675638 278
123 3300049576 Ga0501040_0156031 Ga0501040_0156031_49_891 280
124 3300005340 Ga0070689_100084924 Ga0070689_1000849243 281
125 3300005354 Ga0070675_100123235 Ga0070675_1001232351 281
126 3300005364 Ga0070673_100236139 Ga0070673_1002361391 281
127 3300005445 Ga0070708_100184522 Ga0070708_1001845222 281
128 3300005471 Ga0070698_100011606 Ga0070698_10001160610 281
129 3300005543 Ga0070672_100562740 Ga0070672_1005627402 281
130 3300005937 Ga0081455_10047934 Ga0081455_100479342 281
131 3300009094 Ga0111539_10405287 Ga0111539_104052872 281
132 3300009551 Ga0105238_10006101 Ga0105238_1000610112 281
133 3300014968 Ga0157379_10178557 Ga0157379_101785572 281
134 3300025924 Ga0207694_10023027 Ga0207694_100230273 281
135 3300025926 Ga0207659_10083424 Ga0207659_100834241 281
136 3300025935 Ga0207709_10034769 Ga0207709_100347693 281
137 3300025940 Ga0207691_10409514 Ga0207691_104095142 281
138 3300025960 Ga0207651_10124159 Ga0207651_101241592 281
139 3300026075 Ga0207708_10235871 Ga0207708_102358712 281
140 3300027876 Ga0209974_10044132 Ga0209974_100441322 281
141 3300028573 Ga0265334_10019220 Ga0265334_100192202 281
142 3300031548 Ga0307408_100105215 Ga0307408_1001052152 281
143 3300031731 Ga0307405_10021947 Ga0307405_100219472 281
144 3300031911 Ga0307412_10409713 Ga0307412_104097131 281
145 3300031995 Ga0307409_100120532 Ga0307409_1001205322 281
146 3300035691 Ga0373931_0039608 Ga0373931_0039608_1290_2141 281
147 3300035692 Ga0373935_0147060 Ga0373935_0147060_214_1065 281
148 3300036401 Ga0373937_0017978 Ga0373937_0017978_3601_4452 281
149 3300044901 Ga0466960_0130267 Ga0466960_0130267_270_1115 281
150 3300049568 Ga0501031_0013783 Ga0501031_0013783_3046_3891 281
151 3300049572 Ga0501036_0002580 Ga0501036_0002580_1174_2019 281
152 3300049574 Ga0501038_0054282 Ga0501038_0054282_1495_2340 281
153 3300049575 Ga0501039_0068344 Ga0501039_0068344_1119_1964 281
154 3300049575 Ga0501039_0090688 Ga0501039_0090688_239_1084 281
155 3300049576 Ga0501040_0010259 Ga0501040_0010259_224_1069 281
156 3300049577 Ga0501041_0000389 Ga0501041_0000389_969_1814 281
157 3300049577 Ga0501041_0028442 Ga0501041_0028442_2010_2855 281
158 3300049578 Ga0501042_0000299 Ga0501042_0000299_1451_2296 281
159 3300049578 Ga0501042_0135063 Ga0501042_0135063_749_1594 281
160 3300049580 Ga0501046_0124426 Ga0501046_0124426_913_1758 281
161 3300049582 Ga0501048_0008163 Ga0501048_0008163_6379_7224 281
162 3300049584 Ga0501068_0029725 Ga0501068_0029725_1348_2193 281
163 3300049584 Ga0501068_0201881 Ga0501068_0201881_33_878 281
164 3300049586 Ga0501070_0040406 Ga0501070_0040406_288_1133 281
165 3300049587 Ga0501071_0001011 Ga0501071_0001011_6044_6889 281
166 3300049587 Ga0501071_0087529 Ga0501071_0087529_628_1473 281
167 3300049588 Ga0501072_0000560 Ga0501072_0000560_24_869 281
168 3300049588 Ga0501072_0004805 Ga0501072_0004805_947_1792 281
169 3300049590 Ga0501074_0026065 Ga0501074_0026065_876_1721 281
170 3300049590 Ga0501074_0047456 Ga0501074_0047456_766_1611 281
171 3300049591 Ga0501075_0000020 Ga0501075_0000020_36125_36970 281
172 3300049591 Ga0501075_0000035 Ga0501075_0000035_15420_16265 281
173 3300049592 Ga0501076_0000074 Ga0501076_0000074_13384_14229 281
174 3300049592 Ga0501076_0000860 Ga0501076_0000860_5815_6660 281
175 3300049593 Ga0501077_0000534 Ga0501077_0000534_12098_12943 281
176 3300049671 Ga0501238_001035 Ga0501238_001035_1414_2259 281
177 3300049741 Ga0501079_0001380 Ga0501079_0001380_11278_12123 281
178 3300049742 Ga0501080_0020125 Ga0501080_0020125_1145_1990 281
179 3300049742 Ga0501080_0050507 Ga0501080_0050507_2824_3669 281
180 3300049743 Ga0501081_0002552 Ga0501081_0002552_9715_10560 281
181 3300049743 Ga0501081_0004988 Ga0501081_0004988_2155_3000 281
182 3300049824 Ga0501045_0001426 Ga0501045_0001426_12166_13011 281
183 3300053096 Ga0500641_0001799 Ga0500641_0001799_1073_1924 281
184 3300054114 Ga0501084_0000639 Ga0501084_0000639_936_1781 281
185 3300054114 Ga0501084_0045225 Ga0501084_0045225_1348_2193 281
186 3300060353 Ga0501082_0001342 Ga0501082_0001342_8787_9632 281
187 3300060353 Ga0501082_0026780 Ga0501082_0026780_3730_4575 281
188 3300061734 Ga0530510_0000163 Ga0530510_0000163_36125_36970 281
189 3300061734 Ga0530510_0003145 Ga0530510_0003145_1446_2291 281
190 3300061734 Ga0530510_0005965 Ga0530510_0005965_5104_5949 281
191 3300000549 LJQas_1002682 LJQas_10026823 282
192 3300002244 JGI24742J22300_10012830 JGI24742J22300_100128302 282
193 3300002773 JGI25152J39213_1003864 JGI25152J39213_10038642 282
194 3300002774 JGI25150J39212_1000064 JGI25150J39212_10000644 282
195 3300003187 JGI25151J46595_10000242 JGI25151J46595_1000024269 282
196 3300003203 JGI25406J46586_10000544 JGI25406J46586_100005445 282
197 3300003215 JGI25153J46596_10007551 JGI25153J46596_100075514 282
198 3300003215 JGI25153J46596_10041996 JGI25153J46596_100419961 282
199 3300003320 rootH2_10027291 rootH2_100272912 282
200 3300003354 JGI25160J50197_1005691 JGI25160J50197_10056913 282
201 3300003659 JGI25404J52841_10006208 JGI25404J52841_100062082 282
202 3300003771 Ga0055526_1005564 Ga0055526_10055644 282
203 3300003771 Ga0055526_1007731 Ga0055526_10077313 282
204 3300003775 Ga0055524_1012575 Ga0055524_10125752 282
205 3300003781 Ga0055536_1009917 Ga0055536_10099172 282
206 3300003790 Ga0055528_1001254 Ga0055528_100125417 282
207 3300003791 Ga0055530_10011607 Ga0055530_100116072 282
208 3300003792 Ga0055540_1003251 Ga0055540_10032511 282
209 3300003794 Ga0055531_10001575 Ga0055531_1000157517 282
210 3300004625 Ga0055543_1012893 Ga0055543_10128932 282
211 3300005295 Ga0065707_10239209 Ga0065707_102392091 282
212 3300005327 Ga0070658_10337405 Ga0070658_103374052 282
213 3300005327 Ga0070658_10385260 Ga0070658_103852602 282
214 3300005328 Ga0070676_10335280 Ga0070676_103352801 282
215 3300005331 Ga0070670_100251903 Ga0070670_1002519032 282
216 3300005334 Ga0068869_100058330 Ga0068869_1000583302 282
217 3300005334 Ga0068869_100249692 Ga0068869_1002496922 282
218 3300005336 Ga0070680_100120516 Ga0070680_1001205162 282
219 3300005337 Ga0070682_100075952 Ga0070682_1000759522 282
220 3300005338 Ga0068868_100010934 Ga0068868_1000109343 282
221 3300005338 Ga0068868_100049069 Ga0068868_1000490693 282
222 3300005338 Ga0068868_100091013 Ga0068868_1000910132 282
223 3300005344 Ga0070661_100133517 Ga0070661_1001335172 282
224 3300005344 Ga0070661_100467254 Ga0070661_1004672541 282
225 3300005355 Ga0070671_100117137 Ga0070671_1001171373 282
226 3300005355 Ga0070671_100328061 Ga0070671_1003280612 282
227 3300005355 Ga0070671_100409543 Ga0070671_1004095432 282
228 3300005356 Ga0070674_100042951 Ga0070674_1000429511 282
229 3300005364 Ga0070673_100199553 Ga0070673_1001995531 282
230 3300005438 Ga0070701_10165671 Ga0070701_101656712 282
231 3300005444 Ga0070694_100339016 Ga0070694_1003390162 282
232 3300005455 Ga0070663_100004161 Ga0070663_10000416111 282
233 3300005455 Ga0070663_100127368 Ga0070663_1001273682 282
234 3300005455 Ga0070663_100179179 Ga0070663_1001791792 282
235 3300005456 Ga0070678_100010694 Ga0070678_1000106942 282
236 3300005456 Ga0070678_100081981 Ga0070678_1000819812 282
237 3300005456 Ga0070678_100209195 Ga0070678_1002091952 282
238 3300005458 Ga0070681_10009227 Ga0070681_1000922711 282
239 3300005471 Ga0070698_100392582 Ga0070698_1003925821 282
240 3300005535 Ga0070684_100113580 Ga0070684_1001135802 282
241 3300005539 Ga0068853_100066285 Ga0068853_1000662852 282
242 3300005539 Ga0068853_100119381 Ga0068853_1001193812 282
243 3300005539 Ga0068853_100154723 Ga0068853_1001547232 282
244 3300005539 Ga0068853_100295543 Ga0068853_1002955432 282
245 3300005544 Ga0070686_100234201 Ga0070686_1002342012 282
246 3300005548 Ga0070665_100026809 Ga0070665_1000268092 282
247 3300005548 Ga0070665_100080978 Ga0070665_1000809782 282
248 3300005548 Ga0070665_100098823 Ga0070665_1000988232 282
249 3300005548 Ga0070665_100242346 Ga0070665_1002423462 282
250 3300005563 Ga0068855_100015167 Ga0068855_1000151672 282
251 3300005563 Ga0068855_100147186 Ga0068855_1001471862 282
252 3300005564 Ga0070664_100010417 Ga0070664_1000104178 282
253 3300005564 Ga0070664_100297039 Ga0070664_1002970392 282
254 3300005577 Ga0068857_100220345 Ga0068857_1002203452 282
255 3300005614 Ga0068856_100020278 Ga0068856_1000202784 282
256 3300005615 Ga0070702_100009494 Ga0070702_1000094942 282
257 3300005616 Ga0068852_100105090 Ga0068852_1001050903 282
258 3300005616 Ga0068852_100118252 Ga0068852_1001182522 282
259 3300005617 Ga0068859_100063039 Ga0068859_1000630393 282
260 3300005618 Ga0068864_100019747 Ga0068864_1000197472 282
261 3300005618 Ga0068864_100607650 Ga0068864_1006076502 282
262 3300005719 Ga0068861_100222998 Ga0068861_1002229982 282
263 3300005842 Ga0068858_100163808 Ga0068858_1001638082 282
264 3300005842 Ga0068858_100280847 Ga0068858_1002808471 282
265 3300005843 Ga0068860_100001772 Ga0068860_1000017722 282
266 3300005843 Ga0068860_100146136 Ga0068860_1001461362 282
267 3300005843 Ga0068860_100312341 Ga0068860_1003123412 282
268 3300005844 Ga0068862_100038755 Ga0068862_1000387552 282
269 3300005937 Ga0081455_10026871 Ga0081455_100268714 282
270 3300005937 Ga0081455_10033821 Ga0081455_100338211 282
271 3300005937 Ga0081455_10298168 Ga0081455_102981682 282
272 3300005937 Ga0081455_10360327 Ga0081455_103603271 282
273 3300005981 Ga0081538_10039589 Ga0081538_100395892 282
274 3300005983 Ga0081540_1004539 Ga0081540_10045391 282
275 3300005983 Ga0081540_1028335 Ga0081540_10283353 282
276 3300005985 Ga0081539_10000064 Ga0081539_10000064148 282
277 3300005985 Ga0081539_10026402 Ga0081539_100264023 282
278 3300005985 Ga0081539_10124496 Ga0081539_101244962 282
279 3300006038 Ga0075365_10016939 Ga0075365_100169393 282
280 3300006038 Ga0075365_10421550 Ga0075365_104215501 282
281 3300006048 Ga0075363_100014688 Ga0075363_1000146882 282
282 3300006048 Ga0075363_100033094 Ga0075363_1000330942 282
283 3300006048 Ga0075363_100054616 Ga0075363_1000546162 282
284 3300006051 Ga0075364_10004957 Ga0075364_100049577 282
285 3300006051 Ga0075364_10064628 Ga0075364_100646282 282
286 3300006177 Ga0075362_10032637 Ga0075362_100326372 282
287 3300006177 Ga0075362_10052949 Ga0075362_100529492 282
288 3300006178 Ga0075367_10009368 Ga0075367_100093682 282
289 3300006178 Ga0075367_10107091 Ga0075367_101070912 282
290 3300006186 Ga0075369_10045723 Ga0075369_100457232 282
291 3300006195 Ga0075366_10103812 Ga0075366_101038122 282
292 3300006195 Ga0075366_10146587 Ga0075366_101465872 282
293 3300006195 Ga0075366_10260016 Ga0075366_102600162 282
294 3300006237 Ga0097621_100424522 Ga0097621_1004245222 282
295 3300006353 Ga0075370_10016320 Ga0075370_100163202 282
296 3300006353 Ga0075370_10273209 Ga0075370_102732091 282
297 3300006358 Ga0068871_100412391 Ga0068871_1004123912 282
298 3300006844 Ga0075428_100108508 Ga0075428_1001085083 282
299 3300006881 Ga0068865_100117664 Ga0068865_1001176642 282
300 3300006931 Ga0097620_100063044 Ga0097620_1000630443 282
301 3300007265 Ga0099794_10049503 Ga0099794_100495032 282
302 3300007788 Ga0099795_10042586 Ga0099795_100425862 282
303 3300009093 Ga0105240_10048903 Ga0105240_100489033 282
304 3300009093 Ga0105240_10649289 Ga0105240_106492892 282
305 3300009098 Ga0105245_10005676 Ga0105245_1000567610 282
306 3300009101 Ga0105247_10200550 Ga0105247_102005502 282
307 3300009147 Ga0114129_10369560 Ga0114129_103695601 282
308 3300009174 Ga0105241_10438262 Ga0105241_104382622 282
309 3300009176 Ga0105242_10403675 Ga0105242_104036752 282
310 3300009177 Ga0105248_10460539 Ga0105248_104605392 282
311 3300009177 Ga0105248_10787236 Ga0105248_107872362 282
312 3300009545 Ga0105237_10026719 Ga0105237_100267192 282
313 3300009545 Ga0105237_10306202 Ga0105237_103062022 282
314 3300009551 Ga0105238_10386833 Ga0105238_103868332 282
315 3300010375 Ga0105239_10063997 Ga0105239_100639972 282
316 3300013102 Ga0157371_10291922 Ga0157371_102919221 282
317 3300013104 Ga0157370_10143024 Ga0157370_101430242 282
318 3300013296 Ga0157374_10013103 Ga0157374_100131033 282
319 3300013297 Ga0157378_10017239 Ga0157378_100172393 282
320 3300013297 Ga0157378_10294318 Ga0157378_102943182 282
321 3300013306 Ga0163162_10012800 Ga0163162_100128009 282
322 3300013306 Ga0163162_10421435 Ga0163162_104214352 282
323 3300014325 Ga0163163_10006051 Ga0163163_100060514 282
324 3300014325 Ga0163163_10012803 Ga0163163_100128032 282
325 3300014968 Ga0157379_10394803 Ga0157379_103948032 282
326 3300014969 Ga0157376_10040219 Ga0157376_100402193 282
327 3300021388 Ga0213875_10070149 Ga0213875_100701492 282
328 3300021388 Ga0213875_10158525 Ga0213875_101585251 282
329 3300025245 Ga0207425_1000139 Ga0207425_100013970 282
330 3300025258 Ga0209129_1000223 Ga0209129_10002235 282
331 3300025273 Ga0209673_1000024 Ga0209673_1000024217 282
332 3300025273 Ga0209673_1003641 Ga0209673_10036414 282
333 3300025292 Ga0209676_1016844 Ga0209676_10168442 282
334 3300025292 Ga0209676_1018937 Ga0209676_10189373 282
335 3300025294 Ga0209025_1000612 Ga0209025_10006125 282
336 3300025294 Ga0209025_1005811 Ga0209025_100581112 282
337 3300025295 Ga0209564_1010204 Ga0209564_10102043 282
338 3300025295 Ga0209564_1023997 Ga0209564_10239972 282
339 3300025297 Ga0209758_1000170 Ga0209758_1000170144 282
340 3300025297 Ga0209758_1000495 Ga0209758_10004955 282
341 3300025297 Ga0209758_1007502 Ga0209758_10075022 282
342 3300025297 Ga0209758_1017939 Ga0209758_10179392 282
343 3300025298 Ga0209050_1004141 Ga0209050_10041417 282
344 3300025299 Ga0209256_1001386 Ga0209256_10013866 282
345 3300025302 Ga0207426_1008914 Ga0207426_10089143 282
346 3300025303 Ga0209051_1004249 Ga0209051_10042493 282
347 3300025304 Ga0209257_1001313 Ga0209257_10013135 282
348 3300025315 Ga0207697_10014103 Ga0207697_100141033 282
349 3300025900 Ga0207710_10088174 Ga0207710_100881742 282
350 3300025901 Ga0207688_10054243 Ga0207688_100542433 282
351 3300025903 Ga0207680_10377981 Ga0207680_103779812 282
352 3300025908 Ga0207643_10075494 Ga0207643_100754942 282
353 3300025911 Ga0207654_10083973 Ga0207654_100839732 282
354 3300025912 Ga0207707_10072016 Ga0207707_100720162 282
355 3300025913 Ga0207695_10055190 Ga0207695_100551904 282
356 3300025913 Ga0207695_10423326 Ga0207695_104233262 282
357 3300025914 Ga0207671_10212220 Ga0207671_102122202 282
358 3300025918 Ga0207662_10034108 Ga0207662_100341082 282
359 3300025921 Ga0207652_10087179 Ga0207652_100871793 282
360 3300025921 Ga0207652_10396118 Ga0207652_103961181 282
361 3300025927 Ga0207687_10022996 Ga0207687_100229962 282
362 3300025931 Ga0207644_10152836 Ga0207644_101528362 282
363 3300025937 Ga0207669_10005204 Ga0207669_100052044 282
364 3300025940 Ga0207691_10202880 Ga0207691_102028802 282
365 3300025941 Ga0207711_10148928 Ga0207711_101489282 282
366 3300025941 Ga0207711_10484241 Ga0207711_104842412 282
367 3300025942 Ga0207689_10023247 Ga0207689_100232472 282
368 3300025942 Ga0207689_10324719 Ga0207689_103247192 282
369 3300025945 Ga0207679_10022818 Ga0207679_100228186 282
370 3300025945 Ga0207679_10328611 Ga0207679_103286112 282
371 3300025945 Ga0207679_10421657 Ga0207679_104216572 282
372 3300025949 Ga0207667_10033609 Ga0207667_100336092 282
373 3300025949 Ga0207667_10453942 Ga0207667_104539421 282
374 3300025972 Ga0207668_10193322 Ga0207668_101933222 282
375 3300025972 Ga0207668_10340104 Ga0207668_103401042 282
376 3300026023 Ga0207677_10050484 Ga0207677_100504842 282
377 3300026023 Ga0207677_10066698 Ga0207677_100666982 282
378 3300026035 Ga0207703_10220249 Ga0207703_102202492 282
379 3300026041 Ga0207639_10377146 Ga0207639_103771462 282
380 3300026067 Ga0207678_10001940 Ga0207678_100019408 282
381 3300026067 Ga0207678_10024458 Ga0207678_100244584 282
382 3300026067 Ga0207678_10037244 Ga0207678_100372442 282
383 3300026067 Ga0207678_10049285 Ga0207678_100492853 282
384 3300026067 Ga0207678_10084355 Ga0207678_100843552 282
385 3300026067 Ga0207678_10539372 Ga0207678_105393722 282
386 3300026078 Ga0207702_10033935 Ga0207702_100339356 282
387 3300026078 Ga0207702_10094416 Ga0207702_100944162 282
388 3300026078 Ga0207702_10558100 Ga0207702_105581002 282
389 3300026095 Ga0207676_10207299 Ga0207676_102072992 282
390 3300026116 Ga0207674_10356954 Ga0207674_103569542 282
391 3300026118 Ga0207675_100123921 Ga0207675_1001239212 282
392 3300026121 Ga0207683_10075692 Ga0207683_100756923 282
393 3300026121 Ga0207683_10134620 Ga0207683_101346202 282
394 3300026121 Ga0207683_10214473 Ga0207683_102144732 282
395 3300026142 Ga0207698_10087879 Ga0207698_100878794 282
396 3300027671 Ga0209588_1030991 Ga0209588_10309912 282
397 3300027866 Ga0209813_10112615 Ga0209813_101126151 282
398 3300028379 Ga0268266_10004300 Ga0268266_1000430015 282
399 3300028379 Ga0268266_10090488 Ga0268266_100904882 282
400 3300028380 Ga0268265_10037061 Ga0268265_100370613 282
401 3300028381 Ga0268264_10000157 Ga0268264_1000015740 282
402 3300028786 Ga0307517_10000563 Ga0307517_1000056325 282
403 3300028794 Ga0307515_10051455 Ga0307515_100514556 282
404 3300028794 Ga0307515_10097972 Ga0307515_100979721 282
405 3300028794 Ga0307515_10285074 Ga0307515_102850742 282
406 3300030521 Ga0307511_10156389 Ga0307511_101563892 282
407 3300031456 Ga0307513_10075026 Ga0307513_100750263 282
408 3300031548 Ga0307408_100494584 Ga0307408_1004945842 282
409 3300031616 Ga0307508_10084260 Ga0307508_100842602 282
410 3300031730 Ga0307516_10075321 Ga0307516_100753214 282
411 3300031730 Ga0307516_10206971 Ga0307516_102069712 282
412 3300031731 Ga0307405_10003590 Ga0307405_100035904 282
413 3300031731 Ga0307405_10097536 Ga0307405_100975362 282
414 3300031824 Ga0307413_10081300 Ga0307413_100813002 282
415 3300031824 Ga0307413_10236275 Ga0307413_102362752 282
416 3300031903 Ga0307407_10096993 Ga0307407_100969932 282
417 3300031911 Ga0307412_10004798 Ga0307412_100047982 282
418 3300032002 Ga0307416_100524016 Ga0307416_1005240161 282
419 3300032002 Ga0307416_100582896 Ga0307416_1005828962 282
420 3300032005 Ga0307411_10150379 Ga0307411_101503792 282
421 3300032126 Ga0307415_100017294 Ga0307415_1000172944 282
422 3300032126 Ga0307415_100129245 Ga0307415_1001292452 282
423 3300032126 Ga0307415_100161505 Ga0307415_1001615052 282
424 3300033179 Ga0307507_10218076 Ga0307507_102180762 282
425 3300033180 Ga0307510_10003322 Ga0307510_100033229 282
426 3300035111 Ga0373923_0115012 Ga0373923_0115012_262_1110 282
427 3300035116 Ga0373945_0021487 Ga0373945_0021487_431_1279 282
428 3300035170 Ga0373943_0004586 Ga0373943_0004586_267_1115 282
429 3300035170 Ga0373943_0031617 Ga0373943_0031617_75_923 282
430 3300035171 Ga0373946_0003778 Ga0373946_0003778_4032_4880 282
431 3300035410 Ga0373924_0049940 Ga0373924_0049940_275_1123 282
432 3300035691 Ga0373931_0001536 Ga0373931_0001536_1448_2296 282
433 3300035691 Ga0373931_0037121 Ga0373931_0037121_808_1656 282
434 3300035692 Ga0373935_0003462 Ga0373935_0003462_6369_7217 282
435 3300035695 Ga0373927_0003270 Ga0373927_0003270_81_929 282
436 3300035695 Ga0373927_0046561 Ga0373927_0046561_333_1181 282
437 3300035695 Ga0373927_0048000 Ga0373927_0048000_1544_2392 282
438 3300035724 Ga0373933_0000118 Ga0373933_0000118_17541_18389 282
439 3300035725 Ga0373947_0000402 Ga0373947_0000402_15680_16528 282
440 3300035725 Ga0373947_0083197 Ga0373947_0083197_732_1580 282
441 3300035725 Ga0373947_0305189 Ga0373947_0305189_58_906 282
442 3300036401 Ga0373937_0061382 Ga0373937_0061382_466_1314 282
443 3300037068 Ga0373925_0005137 Ga0373925_0005137_4318_5166 282
444 3300037068 Ga0373925_0387402 Ga0373925_0387402_156_1004 282
445 3300037471 Ga0395905_0042788 Ga0395905_0042788_1348_2196 282
446 3300037471 Ga0395905_0248249 Ga0395905_0248249_388_1236 282
447 3300037853 Ga0436364_0022219 Ga0436364_0022219_5656_6504 282
448 3300037853 Ga0436364_1025898 Ga0436364_1025898_1416_2264 282
449 3300038443 Ga0395901_0106311 Ga0395901_0106311_486_1334 282
450 3300041509 Ga0451843_0952665 Ga0451843_0952665_145_993 282
451 3300041512 Ga0451853_0699412 Ga0451853_0699412_163_1011 282
452 3300044901 Ga0466960_0030825 Ga0466960_0030825_1573_2421 282
453 3300046452 Ga0495617_020423 Ga0495617_020423_69_917 282
454 3300046453 Ga0495627_036172 Ga0495627_036172_73_921 282
455 3300046454 Ga0495592_0056633 Ga0495592_0056633_211_1059 282
456 3300046455 Ga0495603_0000826 Ga0495603_0000826_12864_13712 282
457 3300046455 Ga0495603_0023711 Ga0495603_0023711_1829_2677 282
458 3300046455 Ga0495603_0066420 Ga0495603_0066420_1163_2011 282
459 3300046455 Ga0495603_0075578 Ga0495603_0075578_840_1688 282
460 3300046459 Ga0495629_0000587 Ga0495629_0000587_12815_13663 282
461 3300046459 Ga0495629_0190864 Ga0495629_0190864_290_1138 282
462 3300046460 Ga0495638_0000833 Ga0495638_0000833_28346_29194 282
463 3300046460 Ga0495638_0012048 Ga0495638_0012048_4348_5196 282
464 3300046460 Ga0495638_0208682 Ga0495638_0208682_32_880 282
465 3300046461 Ga0495641_0019439 Ga0495641_0019439_1292_2140 282
466 3300046472 Ga0495580_0002634 Ga0495580_0002634_7676_8524 282
467 3300046472 Ga0495580_0128338 Ga0495580_0128338_595_1443 282
468 3300046473 Ga0495582_0000018 Ga0495582_0000018_74880_75728 282
469 3300046473 Ga0495582_0179846 Ga0495582_0179846_76_924 282
470 3300046474 Ga0495605_0002954 Ga0495605_0002954_2742_3590 282
471 3300046475 Ga0495639_0000272 Ga0495639_0000272_6921_7769 282
472 3300046477 Ga0495664_0054267 Ga0495664_0054267_1101_1949 282
473 3300046492 Ga0495585_0010998 Ga0495585_0010998_1051_1899 282
474 3300046492 Ga0495585_0053442 Ga0495585_0053442_1274_2122 282
475 3300046492 Ga0495585_0226400 Ga0495585_0226400_12_860 282
476 3300046499 Ga0495594_0000155 Ga0495594_0000155_18977_19825 282
477 3300046499 Ga0495594_0201232 Ga0495594_0201232_274_1122 282
478 3300046501 Ga0495607_0048719 Ga0495607_0048719_519_1367 282
479 3300046501 Ga0495607_0053211 Ga0495607_0053211_749_1597 282
480 3300046506 Ga0495583_0016172 Ga0495583_0016172_991_1839 282
481 3300046507 Ga0495606_0214763 Ga0495606_0214763_52_900 282
482 3300046512 Ga0495610_0007227 Ga0495610_0007227_4388_5236 282
483 3300046512 Ga0495610_0138702 Ga0495610_0138702_156_1004 282
484 3300046513 Ga0495616_0018020 Ga0495616_0018020_608_1456 282
485 3300046513 Ga0495616_0067090 Ga0495616_0067090_640_1488 282
486 3300046514 Ga0495618_0007273 Ga0495618_0007273_3106_3954 282
487 3300046515 Ga0495620_0025262 Ga0495620_0025262_1499_2347 282
488 3300046516 Ga0495628_0225301 Ga0495628_0225301_288_1136 282
489 3300046517 Ga0495630_0034444 Ga0495630_0034444_914_1762 282
490 3300046518 Ga0495631_0005687 Ga0495631_0005687_2916_3764 282
491 3300046518 Ga0495631_0066771 Ga0495631_0066771_119_967 282
492 3300046519 Ga0495632_0012036 Ga0495632_0012036_3311_4159 282
493 3300046519 Ga0495632_0115494 Ga0495632_0115494_226_1074 282
494 3300046520 Ga0495637_0067400 Ga0495637_0067400_409_1257 282
495 3300046522 Ga0495643_0160169 Ga0495643_0160169_180_1028 282
496 3300046523 Ga0495644_0014165 Ga0495644_0014165_1532_2380 282
497 3300046526 Ga0495666_0006572 Ga0495666_0006572_3885_4733 282
498 3300046526 Ga0495666_0167334 Ga0495666_0167334_160_1008 282
499 3300046529 Ga0495652_0037042 Ga0495652_0037042_2356_3204 282
500 3300046530 Ga0495654_0000070 Ga0495654_0000070_52450_53298 282
501 3300046533 Ga0495640_0007630 Ga0495640_0007630_1834_2682 282
502 3300046536 Ga0495587_0239528 Ga0495587_0239528_149_997 282
503 3300046538 Ga0495609_0044048 Ga0495609_0044048_1089_1937 282
504 3300046538 Ga0495609_0131690 Ga0495609_0131690_97_945 282
505 3300046543 Ga0495645_0210350 Ga0495645_0210350_430_1278 282
506 3300046557 Ga0495622_0063255 Ga0495622_0063255_738_1586 282
507 3300046559 Ga0495667_0101034 Ga0495667_0101034_15_863 282
508 3300046615 Ga0495656_0010222 Ga0495656_0010222_641_1489 282
509 3300046615 Ga0495656_0042684 Ga0495656_0042684_267_1115 282
510 3300046616 Ga0495668_0008208 Ga0495668_0008208_2428_3276 282
511 3300046642 Ga0495634_0005787 Ga0495634_0005787_7497_8345 282
512 3300046648 Ga0495611_0013344 Ga0495611_0013344_2434_3282 282
513 3300046648 Ga0495611_0106773 Ga0495611_0106773_110_958 282
514 3300046660 Ga0495625_0007996 Ga0495625_0007996_1085_1933 282
515 3300046660 Ga0495625_0062133 Ga0495625_0062133_1249_2097 282
516 3300046660 Ga0495625_0149406 Ga0495625_0149406_456_1304 282
517 3300046660 Ga0495625_0260514 Ga0495625_0260514_80_928 282
518 3300046663 Ga0495635_0001867 Ga0495635_0001867_5707_6555 282
519 3300046664 Ga0495659_0158973 Ga0495659_0158973_40_888 282
520 3300046665 Ga0495661_0125139 Ga0495661_0125139_133_981 282
521 3300046674 Ga0495588_0002125 Ga0495588_0002125_5439_6287 282
522 3300046674 Ga0495588_0050176 Ga0495588_0050176_331_1179 282
523 3300046678 Ga0495599_0126438 Ga0495599_0126438_672_1520 282
524 3300046680 Ga0495646_0049449 Ga0495646_0049449_1247_2095 282
525 3300046681 Ga0495647_0001870 Ga0495647_0001870_5607_6455 282
526 3300046683 Ga0495658_0002067 Ga0495658_0002067_208_1056 282
527 3300046683 Ga0495658_0290200 Ga0495658_0290200_171_1019 282
528 3300046684 Ga0495669_0084519 Ga0495669_0084519_515_1363 282
529 3300046689 Ga0495613_0027117 Ga0495613_0027117_1048_1896 282
530 3300046690 Ga0495624_0001316 Ga0495624_0001316_5808_6656 282
531 3300046691 Ga0495670_0127528 Ga0495670_0127528_354_1202 282
532 3300046809 Ga0495600_0261693 Ga0495600_0261693_134_982 282
533 3300046810 Ga0495660_0008560 Ga0495660_0008560_2476_3324 282
534 3300047315 Ga0495581_0001084 Ga0495581_0001084_1089_1937 282
535 3300047315 Ga0495581_0012982 Ga0495581_0012982_2550_3398 282
536 3300047315 Ga0495581_0024937 Ga0495581_0024937_2407_3255 282
537 3300047318 Ga0495636_0019473 Ga0495636_0019473_1345_2193 282
538 3300047319 Ga0495674_0003842 Ga0495674_0003842_933_1781 282
539 3300047320 Ga0495672_0006265 Ga0495672_0006265_1945_2793 282
540 3300047320 Ga0495672_0025520 Ga0495672_0025520_71_919 282
541 3300047321 Ga0495676_0014924 Ga0495676_0014924_3321_4169 282
542 3300047443 Ga0495687_021545 Ga0495687_021545_1500_2348 282
543 3300047471 Ga0495684_0045699 Ga0495684_0045699_1625_2473 282
544 3300047472 Ga0495686_0023341 Ga0495686_0023341_1660_2508 282
545 3300047472 Ga0495686_0031787 Ga0495686_0031787_408_1256 282
546 3300047673 Ga0495593_0000419 Ga0495593_0000419_12864_13712 282
547 3300048090 Ga0495615_0054306 Ga0495615_0054306_95_943 282
548 3300048091 Ga0495626_0027839 Ga0495626_0027839_1126_1974 282
549 3300048903 Ga0496100_0020076 Ga0496100_0020076_1675_2523 282
550 3300048903 Ga0496100_0228476 Ga0496100_0228476_401_1249 282
551 3300048904 Ga0496101_0240659 Ga0496101_0240659_154_1002 282
552 3300048905 Ga0496102_0002704 Ga0496102_0002704_6062_6910 282
553 3300048905 Ga0496102_0175439 Ga0496102_0175439_844_1692 282
554 3300048905 Ga0496102_0217481 Ga0496102_0217481_787_1635 282
555 3300048905 Ga0496102_0240401 Ga0496102_0240401_250_1098 282
556 3300048906 Ga0496103_0091609 Ga0496103_0091609_205_1053 282
557 3300048907 Ga0496104_0001082 Ga0496104_0001082_8817_9665 282
558 3300048907 Ga0496104_0016511 Ga0496104_0016511_1242_2090 282
559 3300048908 Ga0496105_0001148 Ga0496105_0001148_4047_4895 282
560 3300048908 Ga0496105_0003117 Ga0496105_0003117_4653_5501 282
561 3300048908 Ga0496105_0063670 Ga0496105_0063670_1594_2442 282
562 3300048909 Ga0496106_0000246 Ga0496106_0000246_35383_36231 282
563 3300048909 Ga0496106_0007049 Ga0496106_0007049_3132_3980 282
564 3300048910 Ga0496107_0015565 Ga0496107_0015565_1221_2069 282
565 3300048911 Ga0496108_0001659 Ga0496108_0001659_16211_17059 282
566 3300048911 Ga0496108_0022922 Ga0496108_0022922_684_1532 282
567 3300048911 Ga0496108_0028959 Ga0496108_0028959_1199_2047 282
568 3300048912 Ga0496109_0002048 Ga0496109_0002048_13599_14447 282
569 3300048912 Ga0496109_0013738 Ga0496109_0013738_5617_6465 282
570 3300048913 Ga0496110_0008384 Ga0496110_0008384_1383_2231 282
571 3300048913 Ga0496110_0029898 Ga0496110_0029898_2714_3562 282
572 3300048913 Ga0496110_0061035 Ga0496110_0061035_280_1128 282
573 3300048913 Ga0496110_0130949 Ga0496110_0130949_791_1639 282
574 3300048914 Ga0496111_0012718 Ga0496111_0012718_349_1197 282
575 3300048914 Ga0496111_0045079 Ga0496111_0045079_1602_2450 282
576 3300048914 Ga0496111_0062177 Ga0496111_0062177_1218_2066 282
577 3300048914 Ga0496111_0073060 Ga0496111_0073060_1431_2279 282
578 3300048915 Ga0496112_0000020 Ga0496112_0000020_158197_159045 282
579 3300048915 Ga0496112_0000896 Ga0496112_0000896_7131_7979 282
580 3300048915 Ga0496112_0029729 Ga0496112_0029729_1836_2684 282
581 3300048915 Ga0496112_0052787 Ga0496112_0052787_2807_3655 282
582 3300048915 Ga0496112_0054174 Ga0496112_0054174_2848_3696 282
583 3300048915 Ga0496112_0123913 Ga0496112_0123913_497_1345 282
584 3300048915 Ga0496112_0146675 Ga0496112_0146675_935_1783 282
585 3300048916 Ga0496113_0000418 Ga0496113_0000418_13321_14169 282
586 3300048916 Ga0496113_0005880 Ga0496113_0005880_899_1747 282
587 3300048916 Ga0496113_0008522 Ga0496113_0008522_5531_6379 282
588 3300048916 Ga0496113_0142445 Ga0496113_0142445_929_1777 282
589 3300048916 Ga0496113_0288980 Ga0496113_0288980_151_999 282
590 3300048917 Ga0496114_0018754 Ga0496114_0018754_2487_3335 282
591 3300048918 Ga0496115_0001613 Ga0496115_0001613_996_1844 282
592 3300048918 Ga0496115_0001912 Ga0496115_0001912_4219_5067 282
593 3300048918 Ga0496115_0074897 Ga0496115_0074897_1217_2065 282
594 3300048918 Ga0496115_0144881 Ga0496115_0144881_489_1337 282
595 3300048919 Ga0496116_0003347 Ga0496116_0003347_6380_7228 282
596 3300048919 Ga0496116_0013325 Ga0496116_0013325_3847_4695 282
597 3300048919 Ga0496116_0031866 Ga0496116_0031866_1016_1864 282
598 3300048920 Ga0496117_0018057 Ga0496117_0018057_707_1555 282
599 3300048920 Ga0496117_0020727 Ga0496117_0020727_3185_4033 282
600 3300048920 Ga0496117_0022800 Ga0496117_0022800_3960_4808 282
601 3300048920 Ga0496117_0248607 Ga0496117_0248607_54_902 282
602 3300048921 Ga0496118_0043406 Ga0496118_0043406_2009_2857 282
603 3300048921 Ga0496118_0065233 Ga0496118_0065233_547_1395 282
604 3300048921 Ga0496118_0094446 Ga0496118_0094446_952_1800 282
605 3300048921 Ga0496118_0102794 Ga0496118_0102794_620_1468 282
606 3300048922 Ga0496119_0200833 Ga0496119_0200833_97_945 282
607 3300048923 Ga0496120_0088234 Ga0496120_0088234_262_1110 282
608 3300048923 Ga0496120_0118508 Ga0496120_0118508_346_1194 282
609 3300048923 Ga0496120_0155762 Ga0496120_0155762_176_1024 282
610 3300048924 Ga0496121_0000270 Ga0496121_0000270_100693_101541 282
611 3300048924 Ga0496121_0000423 Ga0496121_0000423_10093_10941 282
612 3300048924 Ga0496121_0038910 Ga0496121_0038910_560_1408 282
613 3300048924 Ga0496121_0042847 Ga0496121_0042847_2318_3166 282
614 3300048924 Ga0496121_0054223 Ga0496121_0054223_1242_2090 282
615 3300048924 Ga0496121_0093632 Ga0496121_0093632_225_1073 282
616 3300048925 Ga0496122_0035434 Ga0496122_0035434_2448_3296 282
617 3300048925 Ga0496122_0045607 Ga0496122_0045607_386_1234 282
618 3300048926 Ga0496123_0043809 Ga0496123_0043809_285_1133 282
619 3300048927 Ga0496124_0000235 Ga0496124_0000235_96214_97062 282
620 3300048927 Ga0496124_0008518 Ga0496124_0008518_6199_7047 282
621 3300048927 Ga0496124_0055170 Ga0496124_0055170_2459_3307 282
622 3300048927 Ga0496124_0057434 Ga0496124_0057434_934_1782 282
623 3300048927 Ga0496124_0141340 Ga0496124_0141340_274_1122 282
624 3300048927 Ga0496124_0168123 Ga0496124_0168123_287_1135 282
625 3300048928 Ga0496125_0000136 Ga0496125_0000136_55919_56767 282
626 3300048928 Ga0496125_0010670 Ga0496125_0010670_830_1678 282
627 3300048928 Ga0496125_0019278 Ga0496125_0019278_485_1333 282
628 3300048928 Ga0496125_0066023 Ga0496125_0066023_716_1564 282
629 3300048928 Ga0496125_0126245 Ga0496125_0126245_452_1300 282
630 3300048928 Ga0496125_0145003 Ga0496125_0145003_480_1328 282
631 3300048929 Ga0496126_0022756 Ga0496126_0022756_3827_4675 282
632 3300048929 Ga0496126_0028765 Ga0496126_0028765_1315_2163 282
633 3300048929 Ga0496126_0041530 Ga0496126_0041530_1433_2281 282
634 3300048929 Ga0496126_0173703 Ga0496126_0173703_348_1196 282
635 3300048929 Ga0496126_0193117 Ga0496126_0193117_34_882 282
636 3300048929 Ga0496126_0211409 Ga0496126_0211409_327_1175 282
637 3300048929 Ga0496126_0227673 Ga0496126_0227673_223_1071 282
638 3300049459 Ga0495678_031113 Ga0495678_031113_840_1688 282
639 3300049459 Ga0495678_081863 Ga0495678_081863_229_1077 282
640 3300049460 Ga0495682_0018813 Ga0495682_0018813_1662_2510 282
641 3300049568 Ga0501031_0029347 Ga0501031_0029347_864_1712 282
642 3300049569 Ga0501032_0104593 Ga0501032_0104593_472_1320 282
643 3300049571 Ga0501034_0000243 Ga0501034_0000243_24422_25270 282
644 3300049571 Ga0501034_0203547 Ga0501034_0203547_809_1657 282
645 3300049571 Ga0501034_0223324 Ga0501034_0223324_903_1751 282
646 3300049573 Ga0501037_0013834 Ga0501037_0013834_528_1376 282
647 3300049574 Ga0501038_0076488 Ga0501038_0076488_762_1610 282
648 3300049579 Ga0501043_0026939 Ga0501043_0026939_491_1339 282
649 3300049581 Ga0501047_0021011 Ga0501047_0021011_4869_5717 282
650 3300049583 Ga0501067_0215816 Ga0501067_0215816_112_960 282
651 3300049822 Ga0501035_0030102 Ga0501035_0030102_3188_4036 282
652 3300049823 Ga0501044_0178495 Ga0501044_0178495_111_959 282
653 3300050489 nmdc:mga03683_1977_c2 nmdc:mga03683_1977_c2_1063_1911 282
654 3300050489 nmdc:mga03683_25662_c1 nmdc:mga03683_25662_c1_558_1406 282
655 3300050490 nmdc:mga03n38_27549_c1 nmdc:mga03n38_27549_c1_1064_1912 282
656 3300050490 nmdc:mga03n38_6856_c1 nmdc:mga03n38_6856_c1_1254_2102 282
657 3300050491 nmdc:mga00v17_179472_c1 nmdc:mga00v17_179472_c1_377_1225 282
658 3300050491 nmdc:mga00v17_26_c4 nmdc:mga00v17_26_c4_23222_24070 282
659 3300050492 nmdc:mga0yw44_12063_c1 nmdc:mga0yw44_12063_c1_250_1098 282
660 3300050492 nmdc:mga0yw44_42184_c1 nmdc:mga0yw44_42184_c1_78_926 282
661 3300050492 nmdc:mga0yw44_5703_c1 nmdc:mga0yw44_5703_c1_2786_3634 282
662 3300050492 nmdc:mga0yw44_71610_c1 nmdc:mga0yw44_71610_c1_1134_1982 282
663 3300050493 nmdc:mga0k408_107162_c1 nmdc:mga0k408_107162_c1_390_1238 282
664 3300050494 nmdc:mga06z11_169871_c1 nmdc:mga06z11_169871_c1_361_1209 282
665 3300050494 nmdc:mga06z11_174938_c1 nmdc:mga06z11_174938_c1_75_923 282
666 3300050494 nmdc:mga06z11_60847_c1 nmdc:mga06z11_60847_c1_448_1296 282
667 3300050494 nmdc:mga06z11_6341_c1 nmdc:mga06z11_6341_c1_2878_3726 282
668 3300050494 nmdc:mga06z11_83338_c1 nmdc:mga06z11_83338_c1_39_887 282
669 3300050495 nmdc:mga04h51_120054_c1 nmdc:mga04h51_120054_c1_49_897 282
670 3300050495 nmdc:mga04h51_41871_c1 nmdc:mga04h51_41871_c1_336_1184 282
671 3300050496 nmdc:mga07m45_57971_c1 nmdc:mga07m45_57971_c1_1218_2066 282
672 3300050496 nmdc:mga07m45_9507_c1 nmdc:mga07m45_9507_c1_2762_3610 282
673 3300050507 nmdc:mga05p37_117318_c1 nmdc:mga05p37_117318_c1_1562_2410 282
674 3300050516 nmdc:mga0sz30_29166_c1 nmdc:mga0sz30_29166_c1_479_1327 282
675 3300050516 nmdc:mga0sz30_51173_c1 nmdc:mga0sz30_51173_c1_672_1520 282
676 3300053077 Ga0495601_0243834 Ga0495601_0243834_288_1136 282
677 3300053079 Ga0500610_0018728 Ga0500610_0018728_1817_2665 282
678 3300053079 Ga0500610_0192037 Ga0500610_0192037_132_980 282
679 3300053085 Ga0495619_0050354 Ga0495619_0050354_604_1452 282
680 3300053087 Ga0500643_032290 Ga0500643_032290_163_1011 282
681 3300053089 Ga0500581_015132 Ga0500581_015132_49_897 282
682 3300053090 Ga0500646_0069005 Ga0500646_0069005_24_872 282
683 3300053092 Ga0500583_0105392 Ga0500583_0105392_228_1076 282
684 3300053094 Ga0500566_0007835 Ga0500566_0007835_4403_5251 282
685 3300053094 Ga0500566_0044722 Ga0500566_0044722_1526_2374 282
686 3300053094 Ga0500566_0212438 Ga0500566_0212438_110_958 282
687 3300053098 Ga0500650_0001027 Ga0500650_0001027_5803_6651 282
688 3300053104 Ga0500556_0000006 Ga0500556_0000006_435197_436045 282
689 3300053104 Ga0500556_0079668 Ga0500556_0079668_187_1035 282
690 3300053105 Ga0500557_001701 Ga0500557_001701_2001_2849 282
691 3300053108 Ga0500562_011821 Ga0500562_011821_163_1011 282
692 3300053117 Ga0500593_011818 Ga0500593_011818_129_977 282
693 3300053118 Ga0500594_0006622 Ga0500594_0006622_980_1828 282
694 3300053119 Ga0500595_001180 Ga0500595_001180_4235_5083 282
695 3300053122 Ga0500608_000937 Ga0500608_000937_7644_8492 282
696 3300053125 Ga0500618_000096 Ga0500618_000096_66554_67402 282
697 3300053125 Ga0500618_000415 Ga0500618_000415_19756_20604 282
698 3300053125 Ga0500618_003908 Ga0500618_003908_775_1623 282
699 3300053130 Ga0500642_0000004 Ga0500642_0000004_17940_18788 282
700 3300053130 Ga0500642_0056491 Ga0500642_0056491_40_888 282
701 3300053131 Ga0500652_001163 Ga0500652_001163_1731_2579 282
702 3300053133 Ga0500655_009861 Ga0500655_009861_858_1706 282
703 3300053134 Ga0500658_0065981 Ga0500658_0065981_84_932 282
704 3300053136 Ga0500559_0000276 Ga0500559_0000276_33225_34073 282
705 3300053136 Ga0500559_0081072 Ga0500559_0081072_108_956 282
706 3300053139 Ga0500568_0001000 Ga0500568_0001000_6645_7493 282
707 3300053139 Ga0500568_0002024 Ga0500568_0002024_3806_4654 282
708 3300053145 Ga0500586_000530 Ga0500586_000530_514_1362 282
709 3300053146 Ga0500588_0054521 Ga0500588_0054521_293_1141 282
710 3300053150 Ga0500603_000275 Ga0500603_000275_3530_4378 282
711 3300053153 Ga0500616_0000022 Ga0500616_0000022_441642_442490 282
712 3300053153 Ga0500616_0000170 Ga0500616_0000170_47172_48020 282
713 3300053153 Ga0500616_0000903 Ga0500616_0000903_16893_17741 282
714 3300053156 Ga0500622_0009939 Ga0500622_0009939_2087_2935 282
715 3300053156 Ga0500622_0101899 Ga0500622_0101899_164_1012 282
716 3300053161 Ga0500634_0000006 Ga0500634_0000006_124846_125694 282
717 3300053161 Ga0500634_0047729 Ga0500634_0047729_589_1437 282
718 3300053162 Ga0500638_100255 Ga0500638_100255_340_1188 282
719 3300053177 Ga0500636_0003529 Ga0500636_0003529_6246_7094 282
720 3300053177 Ga0500636_0173937 Ga0500636_0173937_198_1046 282
721 3300053178 Ga0500637_0000247 Ga0500637_0000247_12676_13524 282
722 3300053178 Ga0500637_0003800 Ga0500637_0003800_4397_5245 282
723 3300053178 Ga0500637_0043652 Ga0500637_0043652_367_1215 282
724 3300053178 Ga0500637_0091394 Ga0500637_0091394_746_1594 282
725 3300053730 Ga0500645_006911 Ga0500645_006911_1382_2230 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

88

292

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8003 1 274
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7915 1 271
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.7776 1 274
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7616 1 271
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.7545 1 268
ID Description Score Start End Superfamily
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9027 2 274 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8965 2 274 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.871 6 271 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8662 5 270 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8523 1 274 1.10.3720.10
ID Description Score Start End GO Terms
AF-I4YSZ6-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9165 1 282 GO:0005886
GO:0055085
AF-A0A0W0X023-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9165 5 277 GO:0005886
GO:0055085
AF-A0A0W0VN93-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9158 5 276 GO:0005886
GO:0055085
AF-A0A4Q3HYC3-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9155 1 264 GO:0005886
GO:0055085
AF-I4YSZ6-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9134 1 282 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
74.98 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map