F477650
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 725 | 417 | 682 | 280 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2876808645|2876813382 |
| Length | 295 |
| Sequence | RPLSDIIAYAILTLGIFIVAFPVYLALIASTHDAATVVGGNMPLSPGSQTLENYYRAVFVGGSRTSREPVGHMLMNSFISAIGIALGKIFISMLSAYAVVYFRFPFRKTAFWIIFVTLMLPVEVRIYPTYKVVADLKMLDTYAGLILPLIASATGTLLFRQFFMTVPEELLEASRIDGAGPFRFFWDTLLPLSVTTIAALFVIQFIYGWNQYLWPLLITTQDSMQTIVTGIKKMLXXXXXXXXXXXXXXXXXXXXXXXXXXQLAMATAILAMLPPVAVVIFMQRLFVRGLVETEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 5 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 6 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 7 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 8 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 9 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 10 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 11 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 12 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 13 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 14 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 15 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 16 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 17 | 2791355199 | |||
| 18 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 19 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 20 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 21 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 22 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 23 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 24 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 25 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 26 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 27 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 28 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 29 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 30 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 31 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 32 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 33 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 34 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 35 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 36 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 37 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 38 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 39 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 40 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 41 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 42 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 43 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 47 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 48 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 63 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 89 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 115 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 203 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 326 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 327 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 328 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 329 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 330 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 331 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 383 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 384 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 387 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 389 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 390 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 391 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 392 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 393 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 396 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 397 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 401 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 402 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 403 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 404 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 406 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 407 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 410 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 414 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 415 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 416 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 417 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.2 |
| Metatranscriptomes | 0 |
| Isolates | 5.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.34 |
| Nodule | 1.79 |
| Rhizoplane | 6.48 |
| Rhizosphere | 61.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002682 | 3300000549 | Bacteria | 2453 |
| 2 | JGI24742J22300_10012830 | 3300002244 | Bacteria | 1400 |
| 3 | JGI25152J39213_1003864 | 3300002773 | Bacteria | 4931 |
| 4 | JGI25152J39213_1004994 | 3300002773 | Bacteria | 4007 |
| 5 | JGI25150J39212_1000064 | 3300002774 | Bacteria | 64002 |
| 6 | JGI25151J46595_10000242 | 3300003187 | Bacteria | 64028 |
| 7 | JGI25406J46586_10000544 | 3300003203 | Bacteria | 17662 |
| 8 | JGI25153J46596_10007551 | 3300003215 | Bacteria | 5326 |
| 9 | JGI25153J46596_10041996 | 3300003215 | Bacteria | 1400 |
| 10 | rootH2_10027291 | 3300003320 | Bacteria | 4322 |
| 11 | JGI25160J50197_1005691 | 3300003354 | Bacteria | 5149 |
| 12 | JGI25404J52841_10006208 | 3300003659 | Bacteria | 2492 |
| 13 | Ga0055526_1005564 | 3300003771 | Bacteria | 7195 |
| 14 | Ga0055526_1007731 | 3300003771 | Bacteria | 5517 |
| 15 | Ga0055524_1012575 | 3300003775 | Bacteria | 3241 |
| 16 | Ga0055536_1009917 | 3300003781 | Bacteria | 3863 |
| 17 | Ga0055528_1001254 | 3300003790 | Bacteria | 16112 |
| 18 | Ga0055530_10011607 | 3300003791 | Bacteria | 3147 |
| 19 | Ga0055540_1003251 | 3300003792 | Bacteria | 7961 |
| 20 | Ga0055531_10001575 | 3300003794 | Bacteria | 16679 |
| 21 | Ga0055543_1012893 | 3300004625 | Bacteria | 1667 |
| 22 | Ga0065707_10239209 | 3300005295 | Bacteria | 1161 |
| 23 | Ga0070658_10002931 | 3300005327 | Bacteria | 14146 |
| 24 | Ga0070658_10337405 | 3300005327 | Bacteria | 1289 |
| 25 | Ga0070658_10385260 | 3300005327 | Bacteria | 1203 |
| 26 | Ga0070676_10335280 | 3300005328 | Bacteria | 1035 |
| 27 | Ga0070670_100251903 | 3300005331 | Bacteria | 1538 |
| 28 | Ga0068869_100058330 | 3300005334 | Bacteria | 2822 |
| 29 | Ga0068869_100249692 | 3300005334 | Bacteria | 1416 |
| 30 | Ga0070680_100120516 | 3300005336 | Bacteria | 2190 |
| 31 | Ga0070682_100075952 | 3300005337 | Bacteria | 2162 |
| 32 | Ga0068868_100010934 | 3300005338 | Bacteria | 6589 |
| 33 | Ga0068868_100049069 | 3300005338 | Bacteria | 3313 |
| 34 | Ga0068868_100091013 | 3300005338 | Bacteria | 2457 |
| 35 | Ga0070689_100084924 | 3300005340 | Bacteria | 2488 |
| 36 | Ga0070689_100129764 | 3300005340 | Bacteria | 2021 |
| 37 | Ga0070661_100133517 | 3300005344 | Bacteria | 1866 |
| 38 | Ga0070661_100333652 | 3300005344 | Bacteria | 1186 |
| 39 | Ga0070661_100467254 | 3300005344 | Bacteria | 1006 |
| 40 | Ga0070675_100123235 | 3300005354 | Bacteria | 2204 |
| 41 | Ga0070671_100117137 | 3300005355 | Bacteria | 2240 |
| 42 | Ga0070671_100328061 | 3300005355 | Bacteria | 1304 |
| 43 | Ga0070671_100409543 | 3300005355 | Bacteria | 1160 |
| 44 | Ga0070674_100042951 | 3300005356 | Bacteria | 3073 |
| 45 | Ga0070673_100199553 | 3300005364 | Bacteria | 1722 |
| 46 | Ga0070673_100236139 | 3300005364 | Bacteria | 1588 |
| 47 | Ga0070701_10165671 | 3300005438 | Bacteria | 1283 |
| 48 | Ga0070694_100339016 | 3300005444 | Bacteria | 1162 |
| 49 | Ga0070708_100184522 | 3300005445 | Bacteria | 1951 |
| 50 | Ga0070663_100004161 | 3300005455 | Bacteria | 8454 |
| 51 | Ga0070663_100127368 | 3300005455 | Bacteria | 1930 |
| 52 | Ga0070663_100179179 | 3300005455 | Bacteria | 1643 |
| 53 | Ga0070663_100385175 | 3300005455 | Bacteria | 1143 |
| 54 | Ga0070678_100010694 | 3300005456 | Bacteria | 5619 |
| 55 | Ga0070678_100081981 | 3300005456 | Bacteria | 2447 |
| 56 | Ga0070678_100209195 | 3300005456 | Bacteria | 1615 |
| 57 | Ga0070681_10009227 | 3300005458 | Bacteria | 9695 |
| 58 | Ga0070698_100011606 | 3300005471 | Bacteria | 9348 |
| 59 | Ga0070698_100392582 | 3300005471 | Bacteria | 1321 |
| 60 | Ga0070684_100113580 | 3300005535 | Bacteria | 2431 |
| 61 | Ga0068853_100059188 | 3300005539 | Bacteria | 3309 |
| 62 | Ga0068853_100066285 | 3300005539 | Bacteria | 3135 |
| 63 | Ga0068853_100067103 | 3300005539 | Bacteria | 3116 |
| 64 | Ga0068853_100119381 | 3300005539 | Bacteria | 2350 |
| 65 | Ga0068853_100154723 | 3300005539 | Bacteria | 2066 |
| 66 | Ga0068853_100295543 | 3300005539 | Bacteria | 1496 |
| 67 | Ga0070672_100562740 | 3300005543 | Bacteria | 991 |
| 68 | Ga0070686_100234201 | 3300005544 | Bacteria | 1334 |
| 69 | Ga0070665_100026809 | 3300005548 | Bacteria | 5804 |
| 70 | Ga0070665_100080978 | 3300005548 | Bacteria | 3252 |
| 71 | Ga0070665_100098823 | 3300005548 | Bacteria | 2923 |
| 72 | Ga0070665_100242346 | 3300005548 | Bacteria | 1803 |
| 73 | Ga0068855_100006458 | 3300005563 | Bacteria | 14272 |
| 74 | Ga0068855_100015167 | 3300005563 | Bacteria | 9281 |
| 75 | Ga0068855_100147186 | 3300005563 | Bacteria | 2680 |
| 76 | Ga0070664_100010417 | 3300005564 | Bacteria | 7539 |
| 77 | Ga0070664_100297039 | 3300005564 | Bacteria | 1459 |
| 78 | Ga0068857_100220345 | 3300005577 | Bacteria | 1733 |
| 79 | Ga0068854_100021113 | 3300005578 | Bacteria | 4416 |
| 80 | Ga0068856_100020278 | 3300005614 | Bacteria | 6456 |
| 81 | Ga0068856_100131080 | 3300005614 | Bacteria | 2511 |
| 82 | Ga0070702_100009494 | 3300005615 | Bacteria | 4764 |
| 83 | Ga0068852_100005809 | 3300005616 | Bacteria | 8859 |
| 84 | Ga0068852_100105090 | 3300005616 | Bacteria | 2557 |
| 85 | Ga0068852_100118252 | 3300005616 | Bacteria | 2421 |
| 86 | Ga0068859_100063039 | 3300005617 | Bacteria | 3737 |
| 87 | Ga0068864_100019747 | 3300005618 | Bacteria | 5635 |
| 88 | Ga0068864_100607650 | 3300005618 | Bacteria | 1062 |
| 89 | Ga0068861_100222998 | 3300005719 | Bacteria | 1594 |
| 90 | Ga0068858_100163808 | 3300005842 | Bacteria | 2094 |
| 91 | Ga0068858_100280847 | 3300005842 | Bacteria | 1585 |
| 92 | Ga0068860_100001772 | 3300005843 | Bacteria | 22993 |
| 93 | Ga0068860_100146136 | 3300005843 | Bacteria | 2275 |
| 94 | Ga0068860_100312341 | 3300005843 | Bacteria | 1541 |
| 95 | Ga0068862_100038755 | 3300005844 | Bacteria | 4044 |
| 96 | Ga0081455_10004061 | 3300005937 | Bacteria | 16579 |
| 97 | Ga0081455_10026871 | 3300005937 | Bacteria | 5285 |
| 98 | Ga0081455_10033821 | 3300005937 | Bacteria | 4588 |
| 99 | Ga0081455_10047934 | 3300005937 | Bacteria | 3696 |
| 100 | Ga0081455_10298168 | 3300005937 | Bacteria | 1158 |
| 101 | Ga0081455_10360327 | 3300005937 | Bacteria | 1023 |
| 102 | Ga0081538_10039589 | 3300005981 | Bacteria | 3021 |
| 103 | Ga0081540_1004539 | 3300005983 | Bacteria | 10527 |
| 104 | Ga0081540_1028335 | 3300005983 | Bacteria | 3148 |
| 105 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 106 | Ga0081539_10026402 | 3300005985 | Bacteria | 3706 |
| 107 | Ga0081539_10124496 | 3300005985 | Bacteria | 1275 |
| 108 | Ga0075365_10006253 | 3300006038 | Bacteria | 6531 |
| 109 | Ga0075365_10016939 | 3300006038 | Bacteria | 4448 |
| 110 | Ga0075365_10421550 | 3300006038 | Bacteria | 942 |
| 111 | Ga0075363_100014688 | 3300006048 | Bacteria | 3834 |
| 112 | Ga0075363_100033094 | 3300006048 | Bacteria | 2690 |
| 113 | Ga0075363_100054616 | 3300006048 | Bacteria | 2137 |
| 114 | Ga0075364_10004957 | 3300006051 | Bacteria | 7714 |
| 115 | Ga0075364_10064628 | 3300006051 | Bacteria | 2402 |
| 116 | Ga0075362_10032637 | 3300006177 | Bacteria | 2261 |
| 117 | Ga0075362_10052949 | 3300006177 | Bacteria | 1820 |
| 118 | Ga0075367_10009368 | 3300006178 | Bacteria | 5115 |
| 119 | Ga0075367_10107091 | 3300006178 | Bacteria | 1713 |
| 120 | Ga0075369_10045723 | 3300006186 | Bacteria | 1883 |
| 121 | Ga0075366_10103812 | 3300006195 | Bacteria | 1707 |
| 122 | Ga0075366_10146587 | 3300006195 | Bacteria | 1428 |
| 123 | Ga0075366_10260016 | 3300006195 | Bacteria | 1059 |
| 124 | Ga0097621_100424522 | 3300006237 | Bacteria | 1194 |
| 125 | Ga0075370_10016320 | 3300006353 | Bacteria | 3994 |
| 126 | Ga0075370_10273209 | 3300006353 | Bacteria | 1003 |
| 127 | Ga0068871_100412391 | 3300006358 | Bacteria | 1205 |
| 128 | Ga0075428_100108508 | 3300006844 | Bacteria | 3025 |
| 129 | Ga0068865_100117664 | 3300006881 | Bacteria | 1970 |
| 130 | Ga0097620_100063044 | 3300006931 | Bacteria | 3737 |
| 131 | Ga0099794_10049503 | 3300007265 | Bacteria | 2020 |
| 132 | Ga0099795_10042586 | 3300007788 | Bacteria | 1621 |
| 133 | Ga0105240_10045150 | 3300009093 | Bacteria | 5593 |
| 134 | Ga0105240_10048903 | 3300009093 | Bacteria | 5342 |
| 135 | Ga0105240_10649289 | 3300009093 | Bacteria | 1157 |
| 136 | Ga0111539_10405287 | 3300009094 | Bacteria | 1588 |
| 137 | Ga0105245_10005676 | 3300009098 | Bacteria | 10968 |
| 138 | Ga0105247_10200550 | 3300009101 | Bacteria | 1340 |
| 139 | Ga0114129_10369560 | 3300009147 | Bacteria | 1896 |
| 140 | Ga0105241_10027549 | 3300009174 | Bacteria | 4232 |
| 141 | Ga0105241_10438262 | 3300009174 | Bacteria | 1153 |
| 142 | Ga0105242_10387777 | 3300009176 | Bacteria | 1300 |
| 143 | Ga0105242_10403675 | 3300009176 | Bacteria | 1276 |
| 144 | Ga0105248_10460539 | 3300009177 | Bacteria | 1433 |
| 145 | Ga0105248_10787236 | 3300009177 | Bacteria | 1073 |
| 146 | Ga0105237_10026719 | 3300009545 | Bacteria | 5899 |
| 147 | Ga0105237_10306202 | 3300009545 | Bacteria | 1592 |
| 148 | Ga0105238_10006101 | 3300009551 | Bacteria | 11953 |
| 149 | Ga0105238_10059190 | 3300009551 | Bacteria | 3838 |
| 150 | Ga0105238_10386833 | 3300009551 | Bacteria | 1391 |
| 151 | Ga0105239_10063997 | 3300010375 | Bacteria | 4038 |
| 152 | Ga0157371_10277564 | 3300013102 | Bacteria | 1210 |
| 153 | Ga0157371_10291922 | 3300013102 | Bacteria | 1179 |
| 154 | Ga0157370_10031995 | 3300013104 | Bacteria | 5140 |
| 155 | Ga0157370_10056603 | 3300013104 | Bacteria | 3732 |
| 156 | Ga0157370_10143024 | 3300013104 | Bacteria | 2228 |
| 157 | Ga0157369_10062094 | 3300013105 | Bacteria | 4027 |
| 158 | Ga0157369_10211955 | 3300013105 | Bacteria | 2030 |
| 159 | Ga0157374_10013103 | 3300013296 | Bacteria | 7232 |
| 160 | Ga0157378_10017239 | 3300013297 | Bacteria | 6333 |
| 161 | Ga0157378_10294318 | 3300013297 | Bacteria | 1569 |
| 162 | Ga0163162_10012800 | 3300013306 | Bacteria | 8196 |
| 163 | Ga0163162_10421435 | 3300013306 | Bacteria | 1467 |
| 164 | Ga0157372_10141630 | 3300013307 | Bacteria | 2771 |
| 165 | Ga0157372_10483861 | 3300013307 | Bacteria | 1443 |
| 166 | Ga0163163_10006051 | 3300014325 | Bacteria | 10524 |
| 167 | Ga0163163_10012803 | 3300014325 | Bacteria | 7654 |
| 168 | Ga0157379_10178557 | 3300014968 | Bacteria | 1918 |
| 169 | Ga0157379_10335659 | 3300014968 | Bacteria | 1382 |
| 170 | Ga0157379_10394803 | 3300014968 | Bacteria | 1271 |
| 171 | Ga0157376_10040219 | 3300014969 | Bacteria | 3820 |
| 172 | Ga0213875_10070149 | 3300021388 | Bacteria | 1636 |
| 173 | Ga0213875_10158525 | 3300021388 | Bacteria | 1061 |
| 174 | Ga0207425_1000139 | 3300025245 | Bacteria | 64086 |
| 175 | Ga0209129_1000066 | 3300025258 | Bacteria | 226820 |
| 176 | Ga0209129_1000223 | 3300025258 | Bacteria | 64086 |
| 177 | Ga0209673_1000024 | 3300025273 | Bacteria | 409632 |
| 178 | Ga0209673_1003641 | 3300025273 | Bacteria | 8909 |
| 179 | Ga0209130_1007506 | 3300025284 | Bacteria | 3354 |
| 180 | Ga0209676_1016844 | 3300025292 | Bacteria | 2617 |
| 181 | Ga0209676_1018937 | 3300025292 | Bacteria | 2383 |
| 182 | Ga0209025_1000557 | 3300025294 | Bacteria | 69226 |
| 183 | Ga0209025_1000612 | 3300025294 | Bacteria | 64088 |
| 184 | Ga0209025_1005811 | 3300025294 | Bacteria | 9886 |
| 185 | Ga0209564_1010204 | 3300025295 | Bacteria | 4360 |
| 186 | Ga0209564_1023997 | 3300025295 | Bacteria | 2098 |
| 187 | Ga0209758_1000170 | 3300025297 | Bacteria | 149476 |
| 188 | Ga0209758_1000495 | 3300025297 | Bacteria | 64088 |
| 189 | Ga0209758_1007502 | 3300025297 | Bacteria | 7397 |
| 190 | Ga0209758_1017939 | 3300025297 | Bacteria | 3494 |
| 191 | Ga0209758_1049921 | 3300025297 | Bacteria | 1472 |
| 192 | Ga0209050_1004141 | 3300025298 | Bacteria | 10053 |
| 193 | Ga0209256_1001386 | 3300025299 | Bacteria | 25312 |
| 194 | Ga0209256_1021118 | 3300025299 | Bacteria | 2010 |
| 195 | Ga0207426_1008914 | 3300025302 | Bacteria | 4007 |
| 196 | Ga0209051_1004249 | 3300025303 | Bacteria | 8923 |
| 197 | Ga0209051_1031330 | 3300025303 | Bacteria | 2049 |
| 198 | Ga0209257_1001313 | 3300025304 | Bacteria | 30254 |
| 199 | Ga0209257_1034975 | 3300025304 | Bacteria | 1559 |
| 200 | Ga0207697_10014103 | 3300025315 | Bacteria | 3325 |
| 201 | Ga0207710_10088174 | 3300025900 | Bacteria | 1449 |
| 202 | Ga0207688_10054243 | 3300025901 | Bacteria | 2249 |
| 203 | Ga0207680_10377981 | 3300025903 | Bacteria | 998 |
| 204 | Ga0207643_10075494 | 3300025908 | Bacteria | 1945 |
| 205 | Ga0207705_10158286 | 3300025909 | Bacteria | 1700 |
| 206 | Ga0207654_10083973 | 3300025911 | Bacteria | 1924 |
| 207 | Ga0207654_10213610 | 3300025911 | Bacteria | 1276 |
| 208 | Ga0207707_10072016 | 3300025912 | Bacteria | 3012 |
| 209 | Ga0207695_10049745 | 3300025913 | Bacteria | 4415 |
| 210 | Ga0207695_10055190 | 3300025913 | Bacteria | 4142 |
| 211 | Ga0207695_10423326 | 3300025913 | Bacteria | 1216 |
| 212 | Ga0207671_10212220 | 3300025914 | Bacteria | 1515 |
| 213 | Ga0207662_10034108 | 3300025918 | Bacteria | 2970 |
| 214 | Ga0207657_10157707 | 3300025919 | Bacteria | 1845 |
| 215 | Ga0207652_10087179 | 3300025921 | Bacteria | 2738 |
| 216 | Ga0207652_10396118 | 3300025921 | Bacteria | 1246 |
| 217 | Ga0207694_10023027 | 3300025924 | Bacteria | 4727 |
| 218 | Ga0207659_10083424 | 3300025926 | Bacteria | 2369 |
| 219 | Ga0207687_10022996 | 3300025927 | Bacteria | 4151 |
| 220 | Ga0207644_10152836 | 3300025931 | Bacteria | 1787 |
| 221 | Ga0207709_10034769 | 3300025935 | Bacteria | 2974 |
| 222 | Ga0207670_10467094 | 3300025936 | Bacteria | 1020 |
| 223 | Ga0207669_10005204 | 3300025937 | Bacteria | 5811 |
| 224 | Ga0207691_10202880 | 3300025940 | Bacteria | 1725 |
| 225 | Ga0207691_10409514 | 3300025940 | Bacteria | 1156 |
| 226 | Ga0207711_10148928 | 3300025941 | Bacteria | 2111 |
| 227 | Ga0207711_10484241 | 3300025941 | Bacteria | 1153 |
| 228 | Ga0207689_10023247 | 3300025942 | Bacteria | 5205 |
| 229 | Ga0207689_10324719 | 3300025942 | Bacteria | 1277 |
| 230 | Ga0207679_10022818 | 3300025945 | Bacteria | 4267 |
| 231 | Ga0207679_10328611 | 3300025945 | Bacteria | 1326 |
| 232 | Ga0207679_10421657 | 3300025945 | Bacteria | 1178 |
| 233 | Ga0207667_10022439 | 3300025949 | Bacteria | 6974 |
| 234 | Ga0207667_10033609 | 3300025949 | Bacteria | 5512 |
| 235 | Ga0207667_10058772 | 3300025949 | Bacteria | 4031 |
| 236 | Ga0207667_10453942 | 3300025949 | Bacteria | 1302 |
| 237 | Ga0207651_10124159 | 3300025960 | Bacteria | 1964 |
| 238 | Ga0207668_10193322 | 3300025972 | Bacteria | 1614 |
| 239 | Ga0207668_10340104 | 3300025972 | Bacteria | 1251 |
| 240 | Ga0207640_10026126 | 3300025981 | Bacteria | 3542 |
| 241 | Ga0207640_10254653 | 3300025981 | Bacteria | 1364 |
| 242 | Ga0207677_10050484 | 3300026023 | Bacteria | 2814 |
| 243 | Ga0207677_10066698 | 3300026023 | Bacteria | 2517 |
| 244 | Ga0207703_10220249 | 3300026035 | Bacteria | 1696 |
| 245 | Ga0207639_10044046 | 3300026041 | Bacteria | 3354 |
| 246 | Ga0207639_10377146 | 3300026041 | Bacteria | 1273 |
| 247 | Ga0207678_10001940 | 3300026067 | Bacteria | 18878 |
| 248 | Ga0207678_10024458 | 3300026067 | Bacteria | 5275 |
| 249 | Ga0207678_10037244 | 3300026067 | Bacteria | 4232 |
| 250 | Ga0207678_10049285 | 3300026067 | Bacteria | 3640 |
| 251 | Ga0207678_10084355 | 3300026067 | Bacteria | 2717 |
| 252 | Ga0207678_10388433 | 3300026067 | Bacteria | 1207 |
| 253 | Ga0207678_10539372 | 3300026067 | Bacteria | 1020 |
| 254 | Ga0207708_10235871 | 3300026075 | Bacteria | 1470 |
| 255 | Ga0207702_10003356 | 3300026078 | Bacteria | 14683 |
| 256 | Ga0207702_10033935 | 3300026078 | Bacteria | 4264 |
| 257 | Ga0207702_10094416 | 3300026078 | Bacteria | 2626 |
| 258 | Ga0207702_10558100 | 3300026078 | Bacteria | 1121 |
| 259 | Ga0207676_10207299 | 3300026095 | Bacteria | 1736 |
| 260 | Ga0207674_10069402 | 3300026116 | Bacteria | 3545 |
| 261 | Ga0207674_10356954 | 3300026116 | Bacteria | 1413 |
| 262 | Ga0207675_100123921 | 3300026118 | Bacteria | 2447 |
| 263 | Ga0207683_10075692 | 3300026121 | Bacteria | 2980 |
| 264 | Ga0207683_10134620 | 3300026121 | Bacteria | 2224 |
| 265 | Ga0207683_10214473 | 3300026121 | Bacteria | 1753 |
| 266 | Ga0207698_10061660 | 3300026142 | Bacteria | 2924 |
| 267 | Ga0207698_10087879 | 3300026142 | Bacteria | 2533 |
| 268 | Ga0207698_10281577 | 3300026142 | Bacteria | 1538 |
| 269 | Ga0209588_1030991 | 3300027671 | Bacteria | 1710 |
| 270 | Ga0209813_10112615 | 3300027866 | Bacteria | 939 |
| 271 | Ga0209974_10044132 | 3300027876 | Bacteria | 1486 |
| 272 | Ga0268266_10004300 | 3300028379 | Bacteria | 13711 |
| 273 | Ga0268266_10090488 | 3300028379 | Bacteria | 2682 |
| 274 | Ga0268265_10037061 | 3300028380 | Bacteria | 3575 |
| 275 | Ga0268264_10000157 | 3300028381 | Bacteria | 155163 |
| 276 | Ga0265334_10019220 | 3300028573 | Bacteria | 2814 |
| 277 | Ga0307517_10000563 | 3300028786 | Bacteria | 63467 |
| 278 | Ga0307515_10051455 | 3300028794 | Bacteria | 6140 |
| 279 | Ga0307515_10097972 | 3300028794 | Bacteria | 3576 |
| 280 | Ga0307515_10285074 | 3300028794 | Bacteria | 1354 |
| 281 | Ga0307511_10156389 | 3300030521 | Bacteria | 1293 |
| 282 | Ga0307513_10075026 | 3300031456 | Bacteria | 3514 |
| 283 | Ga0307408_100105215 | 3300031548 | Bacteria | 2157 |
| 284 | Ga0307408_100494584 | 3300031548 | Bacteria | 1069 |
| 285 | Ga0307508_10084260 | 3300031616 | Bacteria | 2761 |
| 286 | Ga0307516_10075321 | 3300031730 | Bacteria | 3229 |
| 287 | Ga0307516_10206971 | 3300031730 | Bacteria | 1678 |
| 288 | Ga0307405_10003590 | 3300031731 | Bacteria | 7162 |
| 289 | Ga0307405_10021947 | 3300031731 | Bacteria | 3600 |
| 290 | Ga0307405_10097536 | 3300031731 | Bacteria | 1963 |
| 291 | Ga0307413_10081300 | 3300031824 | Bacteria | 2077 |
| 292 | Ga0307413_10236275 | 3300031824 | Bacteria | 1346 |
| 293 | Ga0307407_10096993 | 3300031903 | Bacteria | 1821 |
| 294 | Ga0307412_10004798 | 3300031911 | Bacteria | 7543 |
| 295 | Ga0307412_10409713 | 3300031911 | Bacteria | 1106 |
| 296 | Ga0307409_100120532 | 3300031995 | Bacteria | 2220 |
| 297 | Ga0307416_100524016 | 3300032002 | Bacteria | 1254 |
| 298 | Ga0307416_100582896 | 3300032002 | Bacteria | 1196 |
| 299 | Ga0307414_10030964 | 3300032004 | Bacteria | 3502 |
| 300 | Ga0307411_10150379 | 3300032005 | Bacteria | 1729 |
| 301 | Ga0307415_100017294 | 3300032126 | Bacteria | 4321 |
| 302 | Ga0307415_100129245 | 3300032126 | Bacteria | 1909 |
| 303 | Ga0307415_100161505 | 3300032126 | Bacteria | 1737 |
| 304 | Ga0307507_10218076 | 3300033179 | Bacteria | 1288 |
| 305 | Ga0307510_10003322 | 3300033180 | Bacteria | 18742 |
| 306 | Ga0373923_0115012 | 3300035111 | Bacteria | 1198 |
| 307 | Ga0373932_0140385 | 3300035112 | Bacteria | 821 |
| 308 | Ga0373945_0021487 | 3300035116 | Bacteria | 2218 |
| 309 | Ga0373943_0004586 | 3300035170 | Bacteria | 6242 |
| 310 | Ga0373943_0031617 | 3300035170 | Bacteria | 2512 |
| 311 | Ga0373946_0003778 | 3300035171 | Bacteria | 5371 |
| 312 | Ga0373924_0049940 | 3300035410 | Bacteria | 1732 |
| 313 | Ga0373931_0001536 | 3300035691 | Bacteria | 9952 |
| 314 | Ga0373931_0037121 | 3300035691 | Bacteria | 2543 |
| 315 | Ga0373931_0039608 | 3300035691 | Bacteria | 2469 |
| 316 | Ga0373935_0003462 | 3300035692 | Bacteria | 9171 |
| 317 | Ga0373935_0147060 | 3300035692 | Bacteria | 1596 |
| 318 | Ga0373927_0003270 | 3300035695 | Bacteria | 11653 |
| 319 | Ga0373927_0046561 | 3300035695 | Bacteria | 2806 |
| 320 | Ga0373927_0048000 | 3300035695 | Bacteria | 2761 |
| 321 | Ga0373933_0000118 | 3300035724 | Bacteria | 51316 |
| 322 | Ga0373947_0000402 | 3300035725 | Bacteria | 24400 |
| 323 | Ga0373947_0083197 | 3300035725 | Bacteria | 1984 |
| 324 | Ga0373947_0305189 | 3300035725 | Bacteria | 1062 |
| 325 | Ga0373937_0017978 | 3300036401 | Bacteria | 6307 |
| 326 | Ga0373937_0061382 | 3300036401 | Bacteria | 3455 |
| 327 | Ga0373925_0005137 | 3300037068 | Bacteria | 9807 |
| 328 | Ga0373925_0387402 | 3300037068 | Bacteria | 1139 |
| 329 | Ga0395900_0392517 | 3300037418 | Bacteria | 1353 |
| 330 | Ga0395905_0042788 | 3300037471 | Bacteria | 4249 |
| 331 | Ga0395905_0248249 | 3300037471 | Bacteria | 1663 |
| 332 | Ga0436364_0022219 | 3300037853 | Bacteria | 6632 |
| 333 | Ga0436364_1025898 | 3300037853 | Bacteria | 2714 |
| 334 | Ga0395901_0106311 | 3300038443 | Bacteria | 2946 |
| 335 | Ga0395901_0385638 | 3300038443 | Bacteria | 1441 |
| 336 | Ga0436362_0916838 | 3300039453 | Bacteria | 813 |
| 337 | Ga0451843_0952665 | 3300041509 | Bacteria | 1163 |
| 338 | Ga0451853_0699412 | 3300041512 | Bacteria | 2309 |
| 339 | Ga0439449_0095604 | 3300042007 | Bacteria | 1098 |
| 340 | Ga0466960_0030825 | 3300044901 | Bacteria | 2471 |
| 341 | Ga0466960_0130267 | 3300044901 | Bacteria | 1327 |
| 342 | Ga0466967_1113015 | 3300045976 | Bacteria | 787 |
| 343 | Ga0495617_020423 | 3300046452 | Bacteria | 2239 |
| 344 | Ga0495627_036172 | 3300046453 | Bacteria | 1536 |
| 345 | Ga0495592_0056633 | 3300046454 | Bacteria | 2896 |
| 346 | Ga0495603_0000826 | 3300046455 | Bacteria | 17795 |
| 347 | Ga0495603_0023711 | 3300046455 | Bacteria | 3712 |
| 348 | Ga0495603_0066420 | 3300046455 | Bacteria | 2124 |
| 349 | Ga0495603_0075578 | 3300046455 | Bacteria | 1977 |
| 350 | Ga0495629_0000587 | 3300046459 | Bacteria | 29538 |
| 351 | Ga0495629_0190864 | 3300046459 | Bacteria | 1418 |
| 352 | Ga0495638_0000833 | 3300046460 | Bacteria | 32378 |
| 353 | Ga0495638_0012048 | 3300046460 | Bacteria | 5941 |
| 354 | Ga0495638_0208682 | 3300046460 | Bacteria | 1098 |
| 355 | Ga0495641_0019439 | 3300046461 | Bacteria | 3474 |
| 356 | Ga0495580_0002634 | 3300046472 | Bacteria | 15585 |
| 357 | Ga0495580_0128338 | 3300046472 | Bacteria | 1760 |
| 358 | Ga0495582_0000018 | 3300046473 | Bacteria | 93753 |
| 359 | Ga0495582_0179846 | 3300046473 | Bacteria | 1205 |
| 360 | Ga0495605_0002954 | 3300046474 | Bacteria | 10294 |
| 361 | Ga0495639_0000272 | 3300046475 | Bacteria | 25666 |
| 362 | Ga0495664_0054267 | 3300046477 | Bacteria | 2383 |
| 363 | Ga0495585_0010998 | 3300046492 | Bacteria | 5374 |
| 364 | Ga0495585_0053442 | 3300046492 | Bacteria | 2235 |
| 365 | Ga0495585_0226400 | 3300046492 | Bacteria | 941 |
| 366 | Ga0495594_0000155 | 3300046499 | Bacteria | 32688 |
| 367 | Ga0495594_0201232 | 3300046499 | Bacteria | 1135 |
| 368 | Ga0495607_0048719 | 3300046501 | Bacteria | 2476 |
| 369 | Ga0495607_0053211 | 3300046501 | Bacteria | 2341 |
| 370 | Ga0495583_0016172 | 3300046506 | Bacteria | 4021 |
| 371 | Ga0495606_0214763 | 3300046507 | Bacteria | 1087 |
| 372 | Ga0495610_0007227 | 3300046512 | Bacteria | 7449 |
| 373 | Ga0495610_0138702 | 3300046512 | Bacteria | 1049 |
| 374 | Ga0495616_0018020 | 3300046513 | Bacteria | 3888 |
| 375 | Ga0495616_0067090 | 3300046513 | Bacteria | 1745 |
| 376 | Ga0495618_0007273 | 3300046514 | Bacteria | 6699 |
| 377 | Ga0495620_0025262 | 3300046515 | Bacteria | 2813 |
| 378 | Ga0495628_0225301 | 3300046516 | Bacteria | 1407 |
| 379 | Ga0495630_0034444 | 3300046517 | Bacteria | 3781 |
| 380 | Ga0495631_0005687 | 3300046518 | Bacteria | 6505 |
| 381 | Ga0495631_0066771 | 3300046518 | Bacteria | 1556 |
| 382 | Ga0495632_0012036 | 3300046519 | Bacteria | 5011 |
| 383 | Ga0495632_0115494 | 3300046519 | Bacteria | 1257 |
| 384 | Ga0495637_0067400 | 3300046520 | Bacteria | 1453 |
| 385 | Ga0495643_0160169 | 3300046522 | Bacteria | 1108 |
| 386 | Ga0495643_0193549 | 3300046522 | Bacteria | 980 |
| 387 | Ga0495643_0214360 | 3300046522 | Bacteria | 917 |
| 388 | Ga0495644_0014165 | 3300046523 | Bacteria | 3055 |
| 389 | Ga0495666_0006572 | 3300046526 | Bacteria | 5850 |
| 390 | Ga0495666_0167334 | 3300046526 | Bacteria | 1018 |
| 391 | Ga0495652_0037042 | 3300046529 | Bacteria | 4235 |
| 392 | Ga0495654_0000070 | 3300046530 | Bacteria | 117357 |
| 393 | Ga0495640_0007630 | 3300046533 | Bacteria | 8504 |
| 394 | Ga0495587_0239528 | 3300046536 | Bacteria | 1021 |
| 395 | Ga0495609_0044048 | 3300046538 | Bacteria | 2002 |
| 396 | Ga0495609_0131690 | 3300046538 | Bacteria | 1070 |
| 397 | Ga0495597_0102832 | 3300046542 | Bacteria | 1203 |
| 398 | Ga0495645_0210350 | 3300046543 | Bacteria | 1314 |
| 399 | Ga0495622_0063255 | 3300046557 | Bacteria | 1712 |
| 400 | Ga0495667_0101034 | 3300046559 | Bacteria | 1866 |
| 401 | Ga0495656_0010222 | 3300046615 | Bacteria | 3404 |
| 402 | Ga0495656_0042684 | 3300046615 | Bacteria | 1900 |
| 403 | Ga0495668_0008208 | 3300046616 | Bacteria | 6556 |
| 404 | Ga0495634_0005787 | 3300046642 | Bacteria | 9439 |
| 405 | Ga0495611_0013344 | 3300046648 | Bacteria | 3497 |
| 406 | Ga0495611_0106773 | 3300046648 | Bacteria | 1302 |
| 407 | Ga0495625_0007996 | 3300046660 | Bacteria | 9082 |
| 408 | Ga0495625_0062133 | 3300046660 | Bacteria | 2641 |
| 409 | Ga0495625_0149406 | 3300046660 | Bacteria | 1571 |
| 410 | Ga0495625_0260514 | 3300046660 | Bacteria | 1122 |
| 411 | Ga0495635_0001867 | 3300046663 | Bacteria | 14261 |
| 412 | Ga0495659_0158973 | 3300046664 | Bacteria | 911 |
| 413 | Ga0495661_0125139 | 3300046665 | Bacteria | 1415 |
| 414 | Ga0495588_0002125 | 3300046674 | Bacteria | 8499 |
| 415 | Ga0495588_0050176 | 3300046674 | Bacteria | 2147 |
| 416 | Ga0495599_0126438 | 3300046678 | Bacteria | 1589 |
| 417 | Ga0495646_0049449 | 3300046680 | Bacteria | 2552 |
| 418 | Ga0495647_0001870 | 3300046681 | Bacteria | 6539 |
| 419 | Ga0495658_0002067 | 3300046683 | Bacteria | 10172 |
| 420 | Ga0495658_0290200 | 3300046683 | Bacteria | 1033 |
| 421 | Ga0495669_0084519 | 3300046684 | Bacteria | 1459 |
| 422 | Ga0495613_0027117 | 3300046689 | Bacteria | 4263 |
| 423 | Ga0495613_0317874 | 3300046689 | Bacteria | 1075 |
| 424 | Ga0495624_0001316 | 3300046690 | Bacteria | 19466 |
| 425 | Ga0495670_0010896 | 3300046691 | Bacteria | 4467 |
| 426 | Ga0495670_0127528 | 3300046691 | Bacteria | 1325 |
| 427 | Ga0495600_0261693 | 3300046809 | Bacteria | 1099 |
| 428 | Ga0495660_0008560 | 3300046810 | Bacteria | 5990 |
| 429 | Ga0495581_0001084 | 3300047315 | Bacteria | 14807 |
| 430 | Ga0495581_0012982 | 3300047315 | Bacteria | 4829 |
| 431 | Ga0495581_0024937 | 3300047315 | Bacteria | 3465 |
| 432 | Ga0495636_0019473 | 3300047318 | Bacteria | 2729 |
| 433 | Ga0495674_0003842 | 3300047319 | Bacteria | 14589 |
| 434 | Ga0495674_0202125 | 3300047319 | Bacteria | 1648 |
| 435 | Ga0495672_0006265 | 3300047320 | Bacteria | 9267 |
| 436 | Ga0495672_0025520 | 3300047320 | Bacteria | 3780 |
| 437 | Ga0495676_0014924 | 3300047321 | Bacteria | 6936 |
| 438 | Ga0495687_021545 | 3300047443 | Bacteria | 3115 |
| 439 | Ga0495684_0045699 | 3300047471 | Bacteria | 3351 |
| 440 | Ga0495686_0023341 | 3300047472 | Bacteria | 4081 |
| 441 | Ga0495686_0031787 | 3300047472 | Bacteria | 3419 |
| 442 | Ga0495593_0000419 | 3300047673 | Bacteria | 23659 |
| 443 | Ga0495615_0054306 | 3300048090 | Bacteria | 1040 |
| 444 | Ga0495626_0027839 | 3300048091 | Bacteria | 2745 |
| 445 | Ga0496100_0020076 | 3300048903 | Bacteria | 4000 |
| 446 | Ga0496100_0228476 | 3300048903 | Bacteria | 1368 |
| 447 | Ga0496101_0240659 | 3300048904 | Bacteria | 1408 |
| 448 | Ga0496102_0002704 | 3300048905 | Bacteria | 15082 |
| 449 | Ga0496102_0175439 | 3300048905 | Bacteria | 2018 |
| 450 | Ga0496102_0217481 | 3300048905 | Bacteria | 1801 |
| 451 | Ga0496102_0240401 | 3300048905 | Bacteria | 1707 |
| 452 | Ga0496103_0091609 | 3300048906 | Bacteria | 1918 |
| 453 | Ga0496104_0001082 | 3300048907 | Bacteria | 23263 |
| 454 | Ga0496104_0016511 | 3300048907 | Bacteria | 6707 |
| 455 | Ga0496105_0001148 | 3300048908 | Bacteria | 18448 |
| 456 | Ga0496105_0003117 | 3300048908 | Bacteria | 12200 |
| 457 | Ga0496105_0063670 | 3300048908 | Bacteria | 3042 |
| 458 | Ga0496106_0000246 | 3300048909 | Bacteria | 37806 |
| 459 | Ga0496106_0007049 | 3300048909 | Bacteria | 8300 |
| 460 | Ga0496107_0015565 | 3300048910 | Bacteria | 5332 |
| 461 | Ga0496108_0001659 | 3300048911 | Bacteria | 17640 |
| 462 | Ga0496108_0022922 | 3300048911 | Bacteria | 5137 |
| 463 | Ga0496108_0028959 | 3300048911 | Bacteria | 4582 |
| 464 | Ga0496109_0002048 | 3300048912 | Bacteria | 16714 |
| 465 | Ga0496109_0013738 | 3300048912 | Bacteria | 7035 |
| 466 | Ga0496110_0008384 | 3300048913 | Bacteria | 8314 |
| 467 | Ga0496110_0029898 | 3300048913 | Bacteria | 4694 |
| 468 | Ga0496110_0061035 | 3300048913 | Bacteria | 3326 |
| 469 | Ga0496110_0130949 | 3300048913 | Bacteria | 2265 |
| 470 | Ga0496111_0012718 | 3300048914 | Bacteria | 5706 |
| 471 | Ga0496111_0045079 | 3300048914 | Bacteria | 3172 |
| 472 | Ga0496111_0062177 | 3300048914 | Bacteria | 2707 |
| 473 | Ga0496111_0073060 | 3300048914 | Bacteria | 2497 |
| 474 | Ga0496112_0000020 | 3300048915 | Bacteria | 169373 |
| 475 | Ga0496112_0000896 | 3300048915 | Bacteria | 21449 |
| 476 | Ga0496112_0029729 | 3300048915 | Bacteria | 5285 |
| 477 | Ga0496112_0052787 | 3300048915 | Bacteria | 3991 |
| 478 | Ga0496112_0054174 | 3300048915 | Bacteria | 3941 |
| 479 | Ga0496112_0123913 | 3300048915 | Bacteria | 2555 |
| 480 | Ga0496112_0146675 | 3300048915 | Bacteria | 2328 |
| 481 | Ga0496113_0000418 | 3300048916 | Bacteria | 20649 |
| 482 | Ga0496113_0005880 | 3300048916 | Bacteria | 7699 |
| 483 | Ga0496113_0008522 | 3300048916 | Bacteria | 6684 |
| 484 | Ga0496113_0142445 | 3300048916 | Bacteria | 1887 |
| 485 | Ga0496113_0288980 | 3300048916 | Bacteria | 1311 |
| 486 | Ga0496114_0018754 | 3300048917 | Bacteria | 5599 |
| 487 | Ga0496115_0001613 | 3300048918 | Bacteria | 16216 |
| 488 | Ga0496115_0001912 | 3300048918 | Bacteria | 14866 |
| 489 | Ga0496115_0074897 | 3300048918 | Bacteria | 2749 |
| 490 | Ga0496115_0144881 | 3300048918 | Bacteria | 1960 |
| 491 | Ga0496116_0003347 | 3300048919 | Bacteria | 15910 |
| 492 | Ga0496116_0013325 | 3300048919 | Bacteria | 6638 |
| 493 | Ga0496116_0031866 | 3300048919 | Bacteria | 3765 |
| 494 | Ga0496117_0018057 | 3300048920 | Bacteria | 5865 |
| 495 | Ga0496117_0020727 | 3300048920 | Bacteria | 5349 |
| 496 | Ga0496117_0022800 | 3300048920 | Bacteria | 5014 |
| 497 | Ga0496117_0248607 | 3300048920 | Bacteria | 971 |
| 498 | Ga0496118_0043406 | 3300048921 | Bacteria | 3535 |
| 499 | Ga0496118_0065233 | 3300048921 | Bacteria | 2665 |
| 500 | Ga0496118_0094446 | 3300048921 | Bacteria | 2045 |
| 501 | Ga0496118_0102794 | 3300048921 | Bacteria | 1925 |
| 502 | Ga0496119_0200833 | 3300048922 | Bacteria | 1032 |
| 503 | Ga0496120_0088234 | 3300048923 | Bacteria | 1663 |
| 504 | Ga0496120_0118508 | 3300048923 | Bacteria | 1372 |
| 505 | Ga0496120_0155762 | 3300048923 | Bacteria | 1144 |
| 506 | Ga0496121_0000270 | 3300048924 | Bacteria | 108787 |
| 507 | Ga0496121_0000423 | 3300048924 | Bacteria | 83271 |
| 508 | Ga0496121_0038910 | 3300048924 | Bacteria | 4201 |
| 509 | Ga0496121_0042847 | 3300048924 | Bacteria | 3929 |
| 510 | Ga0496121_0054223 | 3300048924 | Bacteria | 3352 |
| 511 | Ga0496121_0093632 | 3300048924 | Bacteria | 2338 |
| 512 | Ga0496122_0035434 | 3300048925 | Bacteria | 4059 |
| 513 | Ga0496122_0045607 | 3300048925 | Bacteria | 3405 |
| 514 | Ga0496123_0043809 | 3300048926 | Bacteria | 3069 |
| 515 | Ga0496124_0000235 | 3300048927 | Bacteria | 107983 |
| 516 | Ga0496124_0008518 | 3300048927 | Bacteria | 10706 |
| 517 | Ga0496124_0055170 | 3300048927 | Bacteria | 3359 |
| 518 | Ga0496124_0057434 | 3300048927 | Bacteria | 3279 |
| 519 | Ga0496124_0141340 | 3300048927 | Bacteria | 1899 |
| 520 | Ga0496124_0168123 | 3300048927 | Bacteria | 1702 |
| 521 | Ga0496125_0000136 | 3300048928 | Bacteria | 160544 |
| 522 | Ga0496125_0010670 | 3300048928 | Bacteria | 9274 |
| 523 | Ga0496125_0016001 | 3300048928 | Bacteria | 7222 |
| 524 | Ga0496125_0019278 | 3300048928 | Bacteria | 6441 |
| 525 | Ga0496125_0066023 | 3300048928 | Bacteria | 2862 |
| 526 | Ga0496125_0099040 | 3300048928 | Bacteria | 2155 |
| 527 | Ga0496125_0126245 | 3300048928 | Bacteria | 1812 |
| 528 | Ga0496125_0145003 | 3300048928 | Bacteria | 1643 |
| 529 | Ga0496126_0022756 | 3300048929 | Bacteria | 6087 |
| 530 | Ga0496126_0028765 | 3300048929 | Bacteria | 5290 |
| 531 | Ga0496126_0041530 | 3300048929 | Bacteria | 4255 |
| 532 | Ga0496126_0173703 | 3300048929 | Bacteria | 1834 |
| 533 | Ga0496126_0193117 | 3300048929 | Bacteria | 1723 |
| 534 | Ga0496126_0211409 | 3300048929 | Bacteria | 1633 |
| 535 | Ga0496126_0227673 | 3300048929 | Bacteria | 1563 |
| 536 | Ga0496126_0461126 | 3300048929 | Bacteria | 1021 |
| 537 | Ga0495678_031113 | 3300049459 | Bacteria | 2228 |
| 538 | Ga0495678_081863 | 3300049459 | Bacteria | 1157 |
| 539 | Ga0495682_0018813 | 3300049460 | Bacteria | 2601 |
| 540 | Ga0501031_0013783 | 3300049568 | Bacteria | 5269 |
| 541 | Ga0501031_0029347 | 3300049568 | Bacteria | 3588 |
| 542 | Ga0501032_0104593 | 3300049569 | Bacteria | 1875 |
| 543 | Ga0501033_0159679 | 3300049570 | Bacteria | 1623 |
| 544 | Ga0501034_0000243 | 3300049571 | Bacteria | 100637 |
| 545 | Ga0501034_0203547 | 3300049571 | Bacteria | 1937 |
| 546 | Ga0501034_0223324 | 3300049571 | Bacteria | 1835 |
| 547 | Ga0501036_0002580 | 3300049572 | Bacteria | 14248 |
| 548 | Ga0501037_0013834 | 3300049573 | Bacteria | 5946 |
| 549 | Ga0501038_0054282 | 3300049574 | Bacteria | 3446 |
| 550 | Ga0501038_0076488 | 3300049574 | Bacteria | 2827 |
| 551 | Ga0501038_0156099 | 3300049574 | Bacteria | 1858 |
| 552 | Ga0501039_0043067 | 3300049575 | Bacteria | 3488 |
| 553 | Ga0501039_0068344 | 3300049575 | Bacteria | 2759 |
| 554 | Ga0501039_0090688 | 3300049575 | Bacteria | 2382 |
| 555 | Ga0501040_0010259 | 3300049576 | Bacteria | 6126 |
| 556 | Ga0501040_0156031 | 3300049576 | Bacteria | 1612 |
| 557 | Ga0501041_0000389 | 3300049577 | Bacteria | 22050 |
| 558 | Ga0501041_0028442 | 3300049577 | Bacteria | 3372 |
| 559 | Ga0501041_0056361 | 3300049577 | Bacteria | 2401 |
| 560 | Ga0501042_0000299 | 3300049578 | Bacteria | 24677 |
| 561 | Ga0501042_0135063 | 3300049578 | Bacteria | 1778 |
| 562 | Ga0501043_0026939 | 3300049579 | Bacteria | 4510 |
| 563 | Ga0501046_0022939 | 3300049580 | Bacteria | 5139 |
| 564 | Ga0501046_0063933 | 3300049580 | Bacteria | 2873 |
| 565 | Ga0501046_0124426 | 3300049580 | Bacteria | 1960 |
| 566 | Ga0501047_0021011 | 3300049581 | Bacteria | 6270 |
| 567 | Ga0501048_0008163 | 3300049582 | Bacteria | 7919 |
| 568 | Ga0501067_0215816 | 3300049583 | Bacteria | 1068 |
| 569 | Ga0501068_0029725 | 3300049584 | Bacteria | 3238 |
| 570 | Ga0501068_0201881 | 3300049584 | Bacteria | 1261 |
| 571 | Ga0501070_0040406 | 3300049586 | Bacteria | 3889 |
| 572 | Ga0501070_0096978 | 3300049586 | Bacteria | 2439 |
| 573 | Ga0501071_0001011 | 3300049587 | Bacteria | 15479 |
| 574 | Ga0501071_0087529 | 3300049587 | Bacteria | 2285 |
| 575 | Ga0501072_0000560 | 3300049588 | Bacteria | 26770 |
| 576 | Ga0501072_0004805 | 3300049588 | Bacteria | 10290 |
| 577 | Ga0501074_0026065 | 3300049590 | Bacteria | 4240 |
| 578 | Ga0501074_0047456 | 3300049590 | Bacteria | 3104 |
| 579 | Ga0501074_0141964 | 3300049590 | Bacteria | 1718 |
| 580 | Ga0501075_0000020 | 3300049591 | Bacteria | 67432 |
| 581 | Ga0501075_0000035 | 3300049591 | Bacteria | 55355 |
| 582 | Ga0501075_0010105 | 3300049591 | Bacteria | 6623 |
| 583 | Ga0501076_0000074 | 3300049592 | Bacteria | 50353 |
| 584 | Ga0501076_0000860 | 3300049592 | Bacteria | 19712 |
| 585 | Ga0501077_0000534 | 3300049593 | Bacteria | 23065 |
| 586 | Ga0501238_001035 | 3300049671 | Bacteria | 3168 |
| 587 | Ga0501079_0001380 | 3300049741 | Bacteria | 17098 |
| 588 | Ga0501079_0132293 | 3300049741 | Bacteria | 1941 |
| 589 | Ga0501080_0020125 | 3300049742 | Bacteria | 6176 |
| 590 | Ga0501080_0050507 | 3300049742 | Bacteria | 3870 |
| 591 | Ga0501081_0002552 | 3300049743 | Bacteria | 11491 |
| 592 | Ga0501081_0004988 | 3300049743 | Bacteria | 8546 |
| 593 | Ga0501081_0009657 | 3300049743 | Bacteria | 6291 |
| 594 | Ga0501035_0030102 | 3300049822 | Bacteria | 4949 |
| 595 | Ga0501035_0388234 | 3300049822 | Bacteria | 1163 |
| 596 | Ga0501044_0178495 | 3300049823 | Bacteria | 2091 |
| 597 | Ga0501045_0001426 | 3300049824 | Bacteria | 15934 |
| 598 | nmdc:mga03683_1977_c2 | 3300050489 | Bacteria | 2356 |
| 599 | nmdc:mga03683_25662_c1 | 3300050489 | Bacteria | 2318 |
| 600 | nmdc:mga03n38_27549_c1 | 3300050490 | Bacteria | 2359 |
| 601 | nmdc:mga03n38_6856_c1 | 3300050490 | Bacteria | 3992 |
| 602 | nmdc:mga00v17_179472_c1 | 3300050491 | Bacteria | 1366 |
| 603 | nmdc:mga00v17_26_c4 | 3300050491 | Bacteria | 47279 |
| 604 | nmdc:mga0yw44_12063_c1 | 3300050492 | Bacteria | 4489 |
| 605 | nmdc:mga0yw44_1304_c1 | 3300050492 | Bacteria | 9849 |
| 606 | nmdc:mga0yw44_42184_c1 | 3300050492 | Bacteria | 2720 |
| 607 | nmdc:mga0yw44_5703_c1 | 3300050492 | Bacteria | 5929 |
| 608 | nmdc:mga0yw44_71610_c1 | 3300050492 | Bacteria | 2153 |
| 609 | nmdc:mga0k408_107162_c1 | 3300050493 | Bacteria | 1651 |
| 610 | nmdc:mga06z11_169871_c1 | 3300050494 | Bacteria | 1251 |
| 611 | nmdc:mga06z11_174938_c1 | 3300050494 | Bacteria | 1235 |
| 612 | nmdc:mga06z11_60847_c1 | 3300050494 | Bacteria | 1967 |
| 613 | nmdc:mga06z11_6341_c1 | 3300050494 | Bacteria | 4803 |
| 614 | nmdc:mga06z11_83338_c1 | 3300050494 | Bacteria | 1721 |
| 615 | nmdc:mga04h51_120054_c1 | 3300050495 | Bacteria | 978 |
| 616 | nmdc:mga04h51_41871_c1 | 3300050495 | Bacteria | 1499 |
| 617 | nmdc:mga07m45_57971_c1 | 3300050496 | Bacteria | 2191 |
| 618 | nmdc:mga07m45_9507_c1 | 3300050496 | Bacteria | 5045 |
| 619 | nmdc:mga05p37_117318_c1 | 3300050507 | Bacteria | 3271 |
| 620 | nmdc:mga08y16_289005_c1 | 3300050511 | Bacteria | 1690 |
| 621 | nmdc:mga0sz30_29166_c1 | 3300050516 | Bacteria | 2273 |
| 622 | nmdc:mga0sz30_51173_c1 | 3300050516 | Bacteria | 1752 |
| 623 | Ga0495601_0243834 | 3300053077 | Bacteria | 1173 |
| 624 | Ga0500610_0018728 | 3300053079 | Bacteria | 3354 |
| 625 | Ga0500610_0192037 | 3300053079 | Bacteria | 991 |
| 626 | Ga0495619_0050354 | 3300053085 | Bacteria | 2749 |
| 627 | Ga0500643_032290 | 3300053087 | Bacteria | 1591 |
| 628 | Ga0500581_015132 | 3300053089 | Bacteria | 3847 |
| 629 | Ga0500646_0069005 | 3300053090 | Bacteria | 1056 |
| 630 | Ga0500583_0105392 | 3300053092 | Bacteria | 1384 |
| 631 | Ga0500566_0007835 | 3300053094 | Bacteria | 6327 |
| 632 | Ga0500566_0044722 | 3300053094 | Bacteria | 2550 |
| 633 | Ga0500566_0212438 | 3300053094 | Bacteria | 968 |
| 634 | Ga0500641_0001799 | 3300053096 | Bacteria | 7600 |
| 635 | Ga0500650_0001027 | 3300053098 | Bacteria | 7959 |
| 636 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 637 | Ga0500556_0079668 | 3300053104 | Bacteria | 1236 |
| 638 | Ga0500557_001701 | 3300053105 | Bacteria | 3733 |
| 639 | Ga0500562_011821 | 3300053108 | Bacteria | 2217 |
| 640 | Ga0500593_011818 | 3300053117 | Bacteria | 3690 |
| 641 | Ga0500594_0006622 | 3300053118 | Bacteria | 2608 |
| 642 | Ga0500595_001180 | 3300053119 | Bacteria | 14424 |
| 643 | Ga0500608_000937 | 3300053122 | Bacteria | 10442 |
| 644 | Ga0500618_000096 | 3300053125 | Bacteria | 72003 |
| 645 | Ga0500618_000415 | 3300053125 | Bacteria | 28810 |
| 646 | Ga0500618_003908 | 3300053125 | Bacteria | 4958 |
| 647 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 648 | Ga0500642_0056491 | 3300053130 | Bacteria | 1749 |
| 649 | Ga0500652_001163 | 3300053131 | Bacteria | 8395 |
| 650 | Ga0500655_009861 | 3300053133 | Bacteria | 1724 |
| 651 | Ga0500658_0065981 | 3300053134 | Bacteria | 1517 |
| 652 | Ga0500559_0000276 | 3300053136 | Bacteria | 39738 |
| 653 | Ga0500559_0081072 | 3300053136 | Bacteria | 1475 |
| 654 | Ga0500568_0001000 | 3300053139 | Bacteria | 19361 |
| 655 | Ga0500568_0002024 | 3300053139 | Bacteria | 12357 |
| 656 | Ga0500586_000530 | 3300053145 | Bacteria | 7683 |
| 657 | Ga0500588_0054521 | 3300053146 | Bacteria | 1259 |
| 658 | Ga0500603_000275 | 3300053150 | Bacteria | 13576 |
| 659 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 660 | Ga0500616_0000170 | 3300053153 | Bacteria | 108126 |
| 661 | Ga0500616_0000903 | 3300053153 | Bacteria | 32556 |
| 662 | Ga0500622_0009939 | 3300053156 | Bacteria | 5247 |
| 663 | Ga0500622_0101899 | 3300053156 | Bacteria | 1412 |
| 664 | Ga0500634_0000006 | 3300053161 | Bacteria | 171639 |
| 665 | Ga0500634_0047729 | 3300053161 | Bacteria | 2311 |
| 666 | Ga0500638_100255 | 3300053162 | Bacteria | 1352 |
| 667 | Ga0500636_0003529 | 3300053177 | Bacteria | 8800 |
| 668 | Ga0500636_0173937 | 3300053177 | Bacteria | 1162 |
| 669 | Ga0500637_0000247 | 3300053178 | Bacteria | 20090 |
| 670 | Ga0500637_0003800 | 3300053178 | Bacteria | 7022 |
| 671 | Ga0500637_0043652 | 3300053178 | Bacteria | 2539 |
| 672 | Ga0500637_0091394 | 3300053178 | Bacteria | 1763 |
| 673 | Ga0500645_006911 | 3300053730 | Bacteria | 4004 |
| 674 | Ga0501084_0000639 | 3300054114 | Bacteria | 26652 |
| 675 | Ga0501084_0045225 | 3300054114 | Bacteria | 3686 |
| 676 | Ga0501082_0001342 | 3300060353 | Bacteria | 21602 |
| 677 | Ga0501082_0026780 | 3300060353 | Bacteria | 4969 |
| 678 | Ga0501082_0047480 | 3300060353 | Bacteria | 3700 |
| 679 | Ga0530510_0000163 | 3300061734 | Bacteria | 40170 |
| 680 | Ga0530510_0003145 | 3300061734 | Bacteria | 11338 |
| 681 | Ga0530510_0005965 | 3300061734 | Bacteria | 8451 |
| 682 | Ga0530510_0060902 | 3300061734 | Bacteria | 2732 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046522 | Ga0495643_0214360 | Ga0495643_0214360_31_720 | 229 |
| 2 | 3300046522 | Ga0495643_0193549 | Ga0495643_0193549_245_958 | 237 |
| 3 | 3300046542 | Ga0495597_0102832 | Ga0495597_0102832_453_1181 | 242 |
| 4 | 3300045976 | Ga0466967_1113015 | Ga0466967_1113015_20_772 | 250 |
| 5 | 3300035112 | Ga0373932_0140385 | Ga0373932_0140385_38_805 | 253 |
| 6 | 3300026116 | Ga0207674_10069402 | Ga0207674_100694023 | 254 |
| 7 | 3300039453 | Ga0436362_0916838 | Ga0436362_0916838_24_788 | 254 |
| 8 | 3300002773 | JGI25152J39213_1004994 | JGI25152J39213_10049944 | 258 |
| 9 | 3300025258 | Ga0209129_1000066 | Ga0209129_100006646 | 258 |
| 10 | 3300025284 | Ga0209130_1007506 | Ga0209130_10075063 | 258 |
| 11 | 3300025294 | Ga0209025_1000557 | Ga0209025_100055748 | 258 |
| 12 | 3300025303 | Ga0209051_1031330 | Ga0209051_10313302 | 258 |
| 13 | 3300048928 | Ga0496125_0016001 | Ga0496125_0016001_3073_3921 | 258 |
| 14 | 3300048928 | Ga0496125_0099040 | Ga0496125_0099040_436_1284 | 258 |
| 15 | 3300025299 | Ga0209256_1021118 | Ga0209256_10211181 | 259 |
| 16 | 3300046691 | Ga0495670_0010896 | Ga0495670_0010896_3660_4439 | 259 |
| 17 | 3300005937 | Ga0081455_10004061 | Ga0081455_100040617 | 262 |
| 18 | 3300006038 | Ga0075365_10006253 | Ga0075365_100062533 | 264 |
| 19 | 3300025297 | Ga0209758_1049921 | Ga0209758_10499212 | 264 |
| 20 | 3300048929 | Ga0496126_0461126 | Ga0496126_0461126_64_912 | 264 |
| 21 | 3300049570 | Ga0501033_0159679 | Ga0501033_0159679_97_945 | 264 |
| 22 | 3300049580 | Ga0501046_0022939 | Ga0501046_0022939_1488_2336 | 264 |
| 23 | 3300049586 | Ga0501070_0096978 | Ga0501070_0096978_1515_2363 | 264 |
| 24 | 3300049822 | Ga0501035_0388234 | Ga0501035_0388234_97_945 | 264 |
| 25 | 3300050492 | nmdc:mga0yw44_1304_c1 | nmdc:mga0yw44_1304_c1_7136_7984 | 264 |
| 26 | 3300014968 | Ga0157379_10335659 | Ga0157379_103356592 | 265 |
| 27 | 3300046689 | Ga0495613_0317874 | Ga0495613_0317874_19_864 | 266 |
| 28 | 3300005327 | Ga0070658_10002931 | Ga0070658_1000293113 | 267 |
| 29 | 3300005344 | Ga0070661_100333652 | Ga0070661_1003336522 | 267 |
| 30 | 3300005455 | Ga0070663_100385175 | Ga0070663_1003851752 | 267 |
| 31 | 3300005539 | Ga0068853_100059188 | Ga0068853_1000591882 | 267 |
| 32 | 3300005539 | Ga0068853_100067103 | Ga0068853_1000671033 | 267 |
| 33 | 3300005563 | Ga0068855_100006458 | Ga0068855_1000064586 | 267 |
| 34 | 3300005578 | Ga0068854_100021113 | Ga0068854_1000211133 | 267 |
| 35 | 3300005614 | Ga0068856_100131080 | Ga0068856_1001310802 | 267 |
| 36 | 3300005616 | Ga0068852_100005809 | Ga0068852_1000058092 | 267 |
| 37 | 3300009093 | Ga0105240_10045150 | Ga0105240_100451503 | 267 |
| 38 | 3300009174 | Ga0105241_10027549 | Ga0105241_100275493 | 267 |
| 39 | 3300009551 | Ga0105238_10059190 | Ga0105238_100591902 | 267 |
| 40 | 3300013102 | Ga0157371_10277564 | Ga0157371_102775642 | 267 |
| 41 | 3300013104 | Ga0157370_10031995 | Ga0157370_100319952 | 267 |
| 42 | 3300013104 | Ga0157370_10056603 | Ga0157370_100566032 | 267 |
| 43 | 3300013105 | Ga0157369_10062094 | Ga0157369_100620943 | 267 |
| 44 | 3300013105 | Ga0157369_10211955 | Ga0157369_102119553 | 267 |
| 45 | 3300013307 | Ga0157372_10141630 | Ga0157372_101416303 | 267 |
| 46 | 3300013307 | Ga0157372_10483861 | Ga0157372_104838612 | 267 |
| 47 | 3300025909 | Ga0207705_10158286 | Ga0207705_101582861 | 267 |
| 48 | 3300025911 | Ga0207654_10213610 | Ga0207654_102136102 | 267 |
| 49 | 3300025913 | Ga0207695_10049745 | Ga0207695_100497452 | 267 |
| 50 | 3300025919 | Ga0207657_10157707 | Ga0207657_101577072 | 267 |
| 51 | 3300025949 | Ga0207667_10022439 | Ga0207667_100224397 | 267 |
| 52 | 3300025949 | Ga0207667_10058772 | Ga0207667_100587723 | 267 |
| 53 | 3300025981 | Ga0207640_10026126 | Ga0207640_100261263 | 267 |
| 54 | 3300025981 | Ga0207640_10254653 | Ga0207640_102546531 | 267 |
| 55 | 3300026041 | Ga0207639_10044046 | Ga0207639_100440463 | 267 |
| 56 | 3300026067 | Ga0207678_10388433 | Ga0207678_103884332 | 267 |
| 57 | 3300026078 | Ga0207702_10003356 | Ga0207702_1000335611 | 267 |
| 58 | 3300026142 | Ga0207698_10061660 | Ga0207698_100616602 | 267 |
| 59 | 3300026142 | Ga0207698_10281577 | Ga0207698_102815771 | 267 |
| 60 | 3300037418 | Ga0395900_0392517 | Ga0395900_0392517_494_1342 | 267 |
| 61 | 3300038443 | Ga0395901_0385638 | Ga0395901_0385638_162_1010 | 267 |
| 62 | 3300025304 | Ga0209257_1034975 | Ga0209257_10349752 | 270 |
| 63 | 3300032004 | Ga0307414_10030964 | Ga0307414_100309643 | 271 |
| 64 | 3300047319 | Ga0495674_0202125 | Ga0495674_0202125_604_1452 | 271 |
| 65 | 3300050511 | nmdc:mga08y16_289005_c1 | nmdc:mga08y16_289005_c1_306_1121 | 271 |
| 66 | 3300005340 | Ga0070689_100129764 | Ga0070689_1001297642 | 273 |
| 67 | 3300009176 | Ga0105242_10387777 | Ga0105242_103877771 | 273 |
| 68 | 3300025936 | Ga0207670_10467094 | Ga0207670_104670941 | 273 |
| 69 | iso_pu_bacteria | 2937843397 | 2937845105 | 273 |
| 70 | 3300042007 | Ga0439449_0095604 | Ga0439449_0095604_78_962 | 275 |
| 71 | 3300049574 | Ga0501038_0156099 | Ga0501038_0156099_251_1096 | 275 |
| 72 | 3300049575 | Ga0501039_0043067 | Ga0501039_0043067_2209_3054 | 275 |
| 73 | 3300049577 | Ga0501041_0056361 | Ga0501041_0056361_967_1812 | 275 |
| 74 | 3300049580 | Ga0501046_0063933 | Ga0501046_0063933_1140_1985 | 275 |
| 75 | 3300049590 | Ga0501074_0141964 | Ga0501074_0141964_398_1243 | 275 |
| 76 | 3300049591 | Ga0501075_0010105 | Ga0501075_0010105_3458_4303 | 275 |
| 77 | 3300049741 | Ga0501079_0132293 | Ga0501079_0132293_509_1354 | 275 |
| 78 | 3300049743 | Ga0501081_0009657 | Ga0501081_0009657_1239_2084 | 275 |
| 79 | 3300060353 | Ga0501082_0047480 | Ga0501082_0047480_818_1663 | 275 |
| 80 | 3300061734 | Ga0530510_0060902 | Ga0530510_0060902_917_1762 | 275 |
| 81 | iso_pu_bacteria | 2508501050 | 2508731492 | 277 |
| 82 | iso_pu_bacteria | 2773857925 | 2774868428 | 277 |
| 83 | iso_pu_bacteria | 2775506901 | 2776262638 | 277 |
| 84 | iso_pu_bacteria | 2882456835 | 2882459224 | 277 |
| 85 | iso_pu_bacteria | 2894232714 | 2894233002 | 277 |
| 86 | iso_pu_bacteria | 2510917026 | 2511172461 | 278 |
| 87 | iso_pu_bacteria | 2513237101 | 2513694298 | 278 |
| 88 | iso_pu_bacteria | 2513237144 | 2513911183 | 278 |
| 89 | iso_pu_bacteria | 2523231067 | 2523467511 | 278 |
| 90 | iso_pu_bacteria | 2585427594 | 2585843836 | 278 |
| 91 | iso_pu_bacteria | 2602042107 | 2603858412 | 278 |
| 92 | iso_pu_bacteria | 2643221580 | 2643913053 | 278 |
| 93 | iso_pu_bacteria | 2643221591 | 2643964870 | 278 |
| 94 | iso_pu_bacteria | 2643221643 | 2644237549 | 278 |
| 95 | iso_pu_bacteria | 2643221674 | 2644411493 | 278 |
| 96 | iso_pu_bacteria | 2721755755 | 2723841539 | 278 |
| 97 | iso_pu_bacteria | 2738541293 | 2738800912 | 278 |
| 98 | iso_pu_bacteria | 2738543031 | 2739347952 | 278 |
| 99 | iso_pu_bacteria | 2791355199 | 2793079229 | 278 |
| 100 | iso_pu_bacteria | 2818991461 | 2819685926 | 278 |
| 101 | iso_pu_bacteria | 2837678835 | 2837680206 | 278 |
| 102 | iso_pu_bacteria | 2857524615 | 2857526491 | 278 |
| 103 | iso_pu_bacteria | 2874604998 | 2874608166 | 278 |
| 104 | iso_pu_bacteria | 2876808645 | 2876813382 | 278 |
| 105 | iso_pu_bacteria | 2879110137 | 2879113065 | 278 |
| 106 | iso_pu_bacteria | 2884298095 | 2884298699 | 278 |
| 107 | iso_pu_bacteria | 2889033259 | 2889035615 | 278 |
| 108 | iso_pu_bacteria | 2889790730 | 2889794572 | 278 |
| 109 | iso_pu_bacteria | 2889914905 | 2889919340 | 278 |
| 110 | iso_pu_bacteria | 2893066018 | 2893067261 | 278 |
| 111 | iso_pu_bacteria | 2909042592 | 2909047006 | 278 |
| 112 | iso_pu_bacteria | 2919073203 | 2919073694 | 278 |
| 113 | iso_pu_bacteria | 2919171160 | 2919172363 | 278 |
| 114 | iso_pu_bacteria | 2922361189 | 2922364095 | 278 |
| 115 | iso_pu_bacteria | 2922386360 | 2922392670 | 278 |
| 116 | iso_pu_bacteria | 2932401849 | 2932404296 | 278 |
| 117 | iso_pu_bacteria | 3000017691 | 3000018675 | 278 |
| 118 | iso_pu_bacteria | 3005409236 | 3005410744 | 278 |
| 119 | iso_pu_bacteria | 8006964411 | 8006969261 | 278 |
| 120 | iso_pu_bacteria | 8006984368 | 8006990818 | 278 |
| 121 | iso_pu_bacteria | 8006994254 | 8006996691 | 278 |
| 122 | iso_pu_bacteria | 8056673599 | 8056675638 | 278 |
| 123 | 3300049576 | Ga0501040_0156031 | Ga0501040_0156031_49_891 | 280 |
| 124 | 3300005340 | Ga0070689_100084924 | Ga0070689_1000849243 | 281 |
| 125 | 3300005354 | Ga0070675_100123235 | Ga0070675_1001232351 | 281 |
| 126 | 3300005364 | Ga0070673_100236139 | Ga0070673_1002361391 | 281 |
| 127 | 3300005445 | Ga0070708_100184522 | Ga0070708_1001845222 | 281 |
| 128 | 3300005471 | Ga0070698_100011606 | Ga0070698_10001160610 | 281 |
| 129 | 3300005543 | Ga0070672_100562740 | Ga0070672_1005627402 | 281 |
| 130 | 3300005937 | Ga0081455_10047934 | Ga0081455_100479342 | 281 |
| 131 | 3300009094 | Ga0111539_10405287 | Ga0111539_104052872 | 281 |
| 132 | 3300009551 | Ga0105238_10006101 | Ga0105238_1000610112 | 281 |
| 133 | 3300014968 | Ga0157379_10178557 | Ga0157379_101785572 | 281 |
| 134 | 3300025924 | Ga0207694_10023027 | Ga0207694_100230273 | 281 |
| 135 | 3300025926 | Ga0207659_10083424 | Ga0207659_100834241 | 281 |
| 136 | 3300025935 | Ga0207709_10034769 | Ga0207709_100347693 | 281 |
| 137 | 3300025940 | Ga0207691_10409514 | Ga0207691_104095142 | 281 |
| 138 | 3300025960 | Ga0207651_10124159 | Ga0207651_101241592 | 281 |
| 139 | 3300026075 | Ga0207708_10235871 | Ga0207708_102358712 | 281 |
| 140 | 3300027876 | Ga0209974_10044132 | Ga0209974_100441322 | 281 |
| 141 | 3300028573 | Ga0265334_10019220 | Ga0265334_100192202 | 281 |
| 142 | 3300031548 | Ga0307408_100105215 | Ga0307408_1001052152 | 281 |
| 143 | 3300031731 | Ga0307405_10021947 | Ga0307405_100219472 | 281 |
| 144 | 3300031911 | Ga0307412_10409713 | Ga0307412_104097131 | 281 |
| 145 | 3300031995 | Ga0307409_100120532 | Ga0307409_1001205322 | 281 |
| 146 | 3300035691 | Ga0373931_0039608 | Ga0373931_0039608_1290_2141 | 281 |
| 147 | 3300035692 | Ga0373935_0147060 | Ga0373935_0147060_214_1065 | 281 |
| 148 | 3300036401 | Ga0373937_0017978 | Ga0373937_0017978_3601_4452 | 281 |
| 149 | 3300044901 | Ga0466960_0130267 | Ga0466960_0130267_270_1115 | 281 |
| 150 | 3300049568 | Ga0501031_0013783 | Ga0501031_0013783_3046_3891 | 281 |
| 151 | 3300049572 | Ga0501036_0002580 | Ga0501036_0002580_1174_2019 | 281 |
| 152 | 3300049574 | Ga0501038_0054282 | Ga0501038_0054282_1495_2340 | 281 |
| 153 | 3300049575 | Ga0501039_0068344 | Ga0501039_0068344_1119_1964 | 281 |
| 154 | 3300049575 | Ga0501039_0090688 | Ga0501039_0090688_239_1084 | 281 |
| 155 | 3300049576 | Ga0501040_0010259 | Ga0501040_0010259_224_1069 | 281 |
| 156 | 3300049577 | Ga0501041_0000389 | Ga0501041_0000389_969_1814 | 281 |
| 157 | 3300049577 | Ga0501041_0028442 | Ga0501041_0028442_2010_2855 | 281 |
| 158 | 3300049578 | Ga0501042_0000299 | Ga0501042_0000299_1451_2296 | 281 |
| 159 | 3300049578 | Ga0501042_0135063 | Ga0501042_0135063_749_1594 | 281 |
| 160 | 3300049580 | Ga0501046_0124426 | Ga0501046_0124426_913_1758 | 281 |
| 161 | 3300049582 | Ga0501048_0008163 | Ga0501048_0008163_6379_7224 | 281 |
| 162 | 3300049584 | Ga0501068_0029725 | Ga0501068_0029725_1348_2193 | 281 |
| 163 | 3300049584 | Ga0501068_0201881 | Ga0501068_0201881_33_878 | 281 |
| 164 | 3300049586 | Ga0501070_0040406 | Ga0501070_0040406_288_1133 | 281 |
| 165 | 3300049587 | Ga0501071_0001011 | Ga0501071_0001011_6044_6889 | 281 |
| 166 | 3300049587 | Ga0501071_0087529 | Ga0501071_0087529_628_1473 | 281 |
| 167 | 3300049588 | Ga0501072_0000560 | Ga0501072_0000560_24_869 | 281 |
| 168 | 3300049588 | Ga0501072_0004805 | Ga0501072_0004805_947_1792 | 281 |
| 169 | 3300049590 | Ga0501074_0026065 | Ga0501074_0026065_876_1721 | 281 |
| 170 | 3300049590 | Ga0501074_0047456 | Ga0501074_0047456_766_1611 | 281 |
| 171 | 3300049591 | Ga0501075_0000020 | Ga0501075_0000020_36125_36970 | 281 |
| 172 | 3300049591 | Ga0501075_0000035 | Ga0501075_0000035_15420_16265 | 281 |
| 173 | 3300049592 | Ga0501076_0000074 | Ga0501076_0000074_13384_14229 | 281 |
| 174 | 3300049592 | Ga0501076_0000860 | Ga0501076_0000860_5815_6660 | 281 |
| 175 | 3300049593 | Ga0501077_0000534 | Ga0501077_0000534_12098_12943 | 281 |
| 176 | 3300049671 | Ga0501238_001035 | Ga0501238_001035_1414_2259 | 281 |
| 177 | 3300049741 | Ga0501079_0001380 | Ga0501079_0001380_11278_12123 | 281 |
| 178 | 3300049742 | Ga0501080_0020125 | Ga0501080_0020125_1145_1990 | 281 |
| 179 | 3300049742 | Ga0501080_0050507 | Ga0501080_0050507_2824_3669 | 281 |
| 180 | 3300049743 | Ga0501081_0002552 | Ga0501081_0002552_9715_10560 | 281 |
| 181 | 3300049743 | Ga0501081_0004988 | Ga0501081_0004988_2155_3000 | 281 |
| 182 | 3300049824 | Ga0501045_0001426 | Ga0501045_0001426_12166_13011 | 281 |
| 183 | 3300053096 | Ga0500641_0001799 | Ga0500641_0001799_1073_1924 | 281 |
| 184 | 3300054114 | Ga0501084_0000639 | Ga0501084_0000639_936_1781 | 281 |
| 185 | 3300054114 | Ga0501084_0045225 | Ga0501084_0045225_1348_2193 | 281 |
| 186 | 3300060353 | Ga0501082_0001342 | Ga0501082_0001342_8787_9632 | 281 |
| 187 | 3300060353 | Ga0501082_0026780 | Ga0501082_0026780_3730_4575 | 281 |
| 188 | 3300061734 | Ga0530510_0000163 | Ga0530510_0000163_36125_36970 | 281 |
| 189 | 3300061734 | Ga0530510_0003145 | Ga0530510_0003145_1446_2291 | 281 |
| 190 | 3300061734 | Ga0530510_0005965 | Ga0530510_0005965_5104_5949 | 281 |
| 191 | 3300000549 | LJQas_1002682 | LJQas_10026823 | 282 |
| 192 | 3300002244 | JGI24742J22300_10012830 | JGI24742J22300_100128302 | 282 |
| 193 | 3300002773 | JGI25152J39213_1003864 | JGI25152J39213_10038642 | 282 |
| 194 | 3300002774 | JGI25150J39212_1000064 | JGI25150J39212_10000644 | 282 |
| 195 | 3300003187 | JGI25151J46595_10000242 | JGI25151J46595_1000024269 | 282 |
| 196 | 3300003203 | JGI25406J46586_10000544 | JGI25406J46586_100005445 | 282 |
| 197 | 3300003215 | JGI25153J46596_10007551 | JGI25153J46596_100075514 | 282 |
| 198 | 3300003215 | JGI25153J46596_10041996 | JGI25153J46596_100419961 | 282 |
| 199 | 3300003320 | rootH2_10027291 | rootH2_100272912 | 282 |
| 200 | 3300003354 | JGI25160J50197_1005691 | JGI25160J50197_10056913 | 282 |
| 201 | 3300003659 | JGI25404J52841_10006208 | JGI25404J52841_100062082 | 282 |
| 202 | 3300003771 | Ga0055526_1005564 | Ga0055526_10055644 | 282 |
| 203 | 3300003771 | Ga0055526_1007731 | Ga0055526_10077313 | 282 |
| 204 | 3300003775 | Ga0055524_1012575 | Ga0055524_10125752 | 282 |
| 205 | 3300003781 | Ga0055536_1009917 | Ga0055536_10099172 | 282 |
| 206 | 3300003790 | Ga0055528_1001254 | Ga0055528_100125417 | 282 |
| 207 | 3300003791 | Ga0055530_10011607 | Ga0055530_100116072 | 282 |
| 208 | 3300003792 | Ga0055540_1003251 | Ga0055540_10032511 | 282 |
| 209 | 3300003794 | Ga0055531_10001575 | Ga0055531_1000157517 | 282 |
| 210 | 3300004625 | Ga0055543_1012893 | Ga0055543_10128932 | 282 |
| 211 | 3300005295 | Ga0065707_10239209 | Ga0065707_102392091 | 282 |
| 212 | 3300005327 | Ga0070658_10337405 | Ga0070658_103374052 | 282 |
| 213 | 3300005327 | Ga0070658_10385260 | Ga0070658_103852602 | 282 |
| 214 | 3300005328 | Ga0070676_10335280 | Ga0070676_103352801 | 282 |
| 215 | 3300005331 | Ga0070670_100251903 | Ga0070670_1002519032 | 282 |
| 216 | 3300005334 | Ga0068869_100058330 | Ga0068869_1000583302 | 282 |
| 217 | 3300005334 | Ga0068869_100249692 | Ga0068869_1002496922 | 282 |
| 218 | 3300005336 | Ga0070680_100120516 | Ga0070680_1001205162 | 282 |
| 219 | 3300005337 | Ga0070682_100075952 | Ga0070682_1000759522 | 282 |
| 220 | 3300005338 | Ga0068868_100010934 | Ga0068868_1000109343 | 282 |
| 221 | 3300005338 | Ga0068868_100049069 | Ga0068868_1000490693 | 282 |
| 222 | 3300005338 | Ga0068868_100091013 | Ga0068868_1000910132 | 282 |
| 223 | 3300005344 | Ga0070661_100133517 | Ga0070661_1001335172 | 282 |
| 224 | 3300005344 | Ga0070661_100467254 | Ga0070661_1004672541 | 282 |
| 225 | 3300005355 | Ga0070671_100117137 | Ga0070671_1001171373 | 282 |
| 226 | 3300005355 | Ga0070671_100328061 | Ga0070671_1003280612 | 282 |
| 227 | 3300005355 | Ga0070671_100409543 | Ga0070671_1004095432 | 282 |
| 228 | 3300005356 | Ga0070674_100042951 | Ga0070674_1000429511 | 282 |
| 229 | 3300005364 | Ga0070673_100199553 | Ga0070673_1001995531 | 282 |
| 230 | 3300005438 | Ga0070701_10165671 | Ga0070701_101656712 | 282 |
| 231 | 3300005444 | Ga0070694_100339016 | Ga0070694_1003390162 | 282 |
| 232 | 3300005455 | Ga0070663_100004161 | Ga0070663_10000416111 | 282 |
| 233 | 3300005455 | Ga0070663_100127368 | Ga0070663_1001273682 | 282 |
| 234 | 3300005455 | Ga0070663_100179179 | Ga0070663_1001791792 | 282 |
| 235 | 3300005456 | Ga0070678_100010694 | Ga0070678_1000106942 | 282 |
| 236 | 3300005456 | Ga0070678_100081981 | Ga0070678_1000819812 | 282 |
| 237 | 3300005456 | Ga0070678_100209195 | Ga0070678_1002091952 | 282 |
| 238 | 3300005458 | Ga0070681_10009227 | Ga0070681_1000922711 | 282 |
| 239 | 3300005471 | Ga0070698_100392582 | Ga0070698_1003925821 | 282 |
| 240 | 3300005535 | Ga0070684_100113580 | Ga0070684_1001135802 | 282 |
| 241 | 3300005539 | Ga0068853_100066285 | Ga0068853_1000662852 | 282 |
| 242 | 3300005539 | Ga0068853_100119381 | Ga0068853_1001193812 | 282 |
| 243 | 3300005539 | Ga0068853_100154723 | Ga0068853_1001547232 | 282 |
| 244 | 3300005539 | Ga0068853_100295543 | Ga0068853_1002955432 | 282 |
| 245 | 3300005544 | Ga0070686_100234201 | Ga0070686_1002342012 | 282 |
| 246 | 3300005548 | Ga0070665_100026809 | Ga0070665_1000268092 | 282 |
| 247 | 3300005548 | Ga0070665_100080978 | Ga0070665_1000809782 | 282 |
| 248 | 3300005548 | Ga0070665_100098823 | Ga0070665_1000988232 | 282 |
| 249 | 3300005548 | Ga0070665_100242346 | Ga0070665_1002423462 | 282 |
| 250 | 3300005563 | Ga0068855_100015167 | Ga0068855_1000151672 | 282 |
| 251 | 3300005563 | Ga0068855_100147186 | Ga0068855_1001471862 | 282 |
| 252 | 3300005564 | Ga0070664_100010417 | Ga0070664_1000104178 | 282 |
| 253 | 3300005564 | Ga0070664_100297039 | Ga0070664_1002970392 | 282 |
| 254 | 3300005577 | Ga0068857_100220345 | Ga0068857_1002203452 | 282 |
| 255 | 3300005614 | Ga0068856_100020278 | Ga0068856_1000202784 | 282 |
| 256 | 3300005615 | Ga0070702_100009494 | Ga0070702_1000094942 | 282 |
| 257 | 3300005616 | Ga0068852_100105090 | Ga0068852_1001050903 | 282 |
| 258 | 3300005616 | Ga0068852_100118252 | Ga0068852_1001182522 | 282 |
| 259 | 3300005617 | Ga0068859_100063039 | Ga0068859_1000630393 | 282 |
| 260 | 3300005618 | Ga0068864_100019747 | Ga0068864_1000197472 | 282 |
| 261 | 3300005618 | Ga0068864_100607650 | Ga0068864_1006076502 | 282 |
| 262 | 3300005719 | Ga0068861_100222998 | Ga0068861_1002229982 | 282 |
| 263 | 3300005842 | Ga0068858_100163808 | Ga0068858_1001638082 | 282 |
| 264 | 3300005842 | Ga0068858_100280847 | Ga0068858_1002808471 | 282 |
| 265 | 3300005843 | Ga0068860_100001772 | Ga0068860_1000017722 | 282 |
| 266 | 3300005843 | Ga0068860_100146136 | Ga0068860_1001461362 | 282 |
| 267 | 3300005843 | Ga0068860_100312341 | Ga0068860_1003123412 | 282 |
| 268 | 3300005844 | Ga0068862_100038755 | Ga0068862_1000387552 | 282 |
| 269 | 3300005937 | Ga0081455_10026871 | Ga0081455_100268714 | 282 |
| 270 | 3300005937 | Ga0081455_10033821 | Ga0081455_100338211 | 282 |
| 271 | 3300005937 | Ga0081455_10298168 | Ga0081455_102981682 | 282 |
| 272 | 3300005937 | Ga0081455_10360327 | Ga0081455_103603271 | 282 |
| 273 | 3300005981 | Ga0081538_10039589 | Ga0081538_100395892 | 282 |
| 274 | 3300005983 | Ga0081540_1004539 | Ga0081540_10045391 | 282 |
| 275 | 3300005983 | Ga0081540_1028335 | Ga0081540_10283353 | 282 |
| 276 | 3300005985 | Ga0081539_10000064 | Ga0081539_10000064148 | 282 |
| 277 | 3300005985 | Ga0081539_10026402 | Ga0081539_100264023 | 282 |
| 278 | 3300005985 | Ga0081539_10124496 | Ga0081539_101244962 | 282 |
| 279 | 3300006038 | Ga0075365_10016939 | Ga0075365_100169393 | 282 |
| 280 | 3300006038 | Ga0075365_10421550 | Ga0075365_104215501 | 282 |
| 281 | 3300006048 | Ga0075363_100014688 | Ga0075363_1000146882 | 282 |
| 282 | 3300006048 | Ga0075363_100033094 | Ga0075363_1000330942 | 282 |
| 283 | 3300006048 | Ga0075363_100054616 | Ga0075363_1000546162 | 282 |
| 284 | 3300006051 | Ga0075364_10004957 | Ga0075364_100049577 | 282 |
| 285 | 3300006051 | Ga0075364_10064628 | Ga0075364_100646282 | 282 |
| 286 | 3300006177 | Ga0075362_10032637 | Ga0075362_100326372 | 282 |
| 287 | 3300006177 | Ga0075362_10052949 | Ga0075362_100529492 | 282 |
| 288 | 3300006178 | Ga0075367_10009368 | Ga0075367_100093682 | 282 |
| 289 | 3300006178 | Ga0075367_10107091 | Ga0075367_101070912 | 282 |
| 290 | 3300006186 | Ga0075369_10045723 | Ga0075369_100457232 | 282 |
| 291 | 3300006195 | Ga0075366_10103812 | Ga0075366_101038122 | 282 |
| 292 | 3300006195 | Ga0075366_10146587 | Ga0075366_101465872 | 282 |
| 293 | 3300006195 | Ga0075366_10260016 | Ga0075366_102600162 | 282 |
| 294 | 3300006237 | Ga0097621_100424522 | Ga0097621_1004245222 | 282 |
| 295 | 3300006353 | Ga0075370_10016320 | Ga0075370_100163202 | 282 |
| 296 | 3300006353 | Ga0075370_10273209 | Ga0075370_102732091 | 282 |
| 297 | 3300006358 | Ga0068871_100412391 | Ga0068871_1004123912 | 282 |
| 298 | 3300006844 | Ga0075428_100108508 | Ga0075428_1001085083 | 282 |
| 299 | 3300006881 | Ga0068865_100117664 | Ga0068865_1001176642 | 282 |
| 300 | 3300006931 | Ga0097620_100063044 | Ga0097620_1000630443 | 282 |
| 301 | 3300007265 | Ga0099794_10049503 | Ga0099794_100495032 | 282 |
| 302 | 3300007788 | Ga0099795_10042586 | Ga0099795_100425862 | 282 |
| 303 | 3300009093 | Ga0105240_10048903 | Ga0105240_100489033 | 282 |
| 304 | 3300009093 | Ga0105240_10649289 | Ga0105240_106492892 | 282 |
| 305 | 3300009098 | Ga0105245_10005676 | Ga0105245_1000567610 | 282 |
| 306 | 3300009101 | Ga0105247_10200550 | Ga0105247_102005502 | 282 |
| 307 | 3300009147 | Ga0114129_10369560 | Ga0114129_103695601 | 282 |
| 308 | 3300009174 | Ga0105241_10438262 | Ga0105241_104382622 | 282 |
| 309 | 3300009176 | Ga0105242_10403675 | Ga0105242_104036752 | 282 |
| 310 | 3300009177 | Ga0105248_10460539 | Ga0105248_104605392 | 282 |
| 311 | 3300009177 | Ga0105248_10787236 | Ga0105248_107872362 | 282 |
| 312 | 3300009545 | Ga0105237_10026719 | Ga0105237_100267192 | 282 |
| 313 | 3300009545 | Ga0105237_10306202 | Ga0105237_103062022 | 282 |
| 314 | 3300009551 | Ga0105238_10386833 | Ga0105238_103868332 | 282 |
| 315 | 3300010375 | Ga0105239_10063997 | Ga0105239_100639972 | 282 |
| 316 | 3300013102 | Ga0157371_10291922 | Ga0157371_102919221 | 282 |
| 317 | 3300013104 | Ga0157370_10143024 | Ga0157370_101430242 | 282 |
| 318 | 3300013296 | Ga0157374_10013103 | Ga0157374_100131033 | 282 |
| 319 | 3300013297 | Ga0157378_10017239 | Ga0157378_100172393 | 282 |
| 320 | 3300013297 | Ga0157378_10294318 | Ga0157378_102943182 | 282 |
| 321 | 3300013306 | Ga0163162_10012800 | Ga0163162_100128009 | 282 |
| 322 | 3300013306 | Ga0163162_10421435 | Ga0163162_104214352 | 282 |
| 323 | 3300014325 | Ga0163163_10006051 | Ga0163163_100060514 | 282 |
| 324 | 3300014325 | Ga0163163_10012803 | Ga0163163_100128032 | 282 |
| 325 | 3300014968 | Ga0157379_10394803 | Ga0157379_103948032 | 282 |
| 326 | 3300014969 | Ga0157376_10040219 | Ga0157376_100402193 | 282 |
| 327 | 3300021388 | Ga0213875_10070149 | Ga0213875_100701492 | 282 |
| 328 | 3300021388 | Ga0213875_10158525 | Ga0213875_101585251 | 282 |
| 329 | 3300025245 | Ga0207425_1000139 | Ga0207425_100013970 | 282 |
| 330 | 3300025258 | Ga0209129_1000223 | Ga0209129_10002235 | 282 |
| 331 | 3300025273 | Ga0209673_1000024 | Ga0209673_1000024217 | 282 |
| 332 | 3300025273 | Ga0209673_1003641 | Ga0209673_10036414 | 282 |
| 333 | 3300025292 | Ga0209676_1016844 | Ga0209676_10168442 | 282 |
| 334 | 3300025292 | Ga0209676_1018937 | Ga0209676_10189373 | 282 |
| 335 | 3300025294 | Ga0209025_1000612 | Ga0209025_10006125 | 282 |
| 336 | 3300025294 | Ga0209025_1005811 | Ga0209025_100581112 | 282 |
| 337 | 3300025295 | Ga0209564_1010204 | Ga0209564_10102043 | 282 |
| 338 | 3300025295 | Ga0209564_1023997 | Ga0209564_10239972 | 282 |
| 339 | 3300025297 | Ga0209758_1000170 | Ga0209758_1000170144 | 282 |
| 340 | 3300025297 | Ga0209758_1000495 | Ga0209758_10004955 | 282 |
| 341 | 3300025297 | Ga0209758_1007502 | Ga0209758_10075022 | 282 |
| 342 | 3300025297 | Ga0209758_1017939 | Ga0209758_10179392 | 282 |
| 343 | 3300025298 | Ga0209050_1004141 | Ga0209050_10041417 | 282 |
| 344 | 3300025299 | Ga0209256_1001386 | Ga0209256_10013866 | 282 |
| 345 | 3300025302 | Ga0207426_1008914 | Ga0207426_10089143 | 282 |
| 346 | 3300025303 | Ga0209051_1004249 | Ga0209051_10042493 | 282 |
| 347 | 3300025304 | Ga0209257_1001313 | Ga0209257_10013135 | 282 |
| 348 | 3300025315 | Ga0207697_10014103 | Ga0207697_100141033 | 282 |
| 349 | 3300025900 | Ga0207710_10088174 | Ga0207710_100881742 | 282 |
| 350 | 3300025901 | Ga0207688_10054243 | Ga0207688_100542433 | 282 |
| 351 | 3300025903 | Ga0207680_10377981 | Ga0207680_103779812 | 282 |
| 352 | 3300025908 | Ga0207643_10075494 | Ga0207643_100754942 | 282 |
| 353 | 3300025911 | Ga0207654_10083973 | Ga0207654_100839732 | 282 |
| 354 | 3300025912 | Ga0207707_10072016 | Ga0207707_100720162 | 282 |
| 355 | 3300025913 | Ga0207695_10055190 | Ga0207695_100551904 | 282 |
| 356 | 3300025913 | Ga0207695_10423326 | Ga0207695_104233262 | 282 |
| 357 | 3300025914 | Ga0207671_10212220 | Ga0207671_102122202 | 282 |
| 358 | 3300025918 | Ga0207662_10034108 | Ga0207662_100341082 | 282 |
| 359 | 3300025921 | Ga0207652_10087179 | Ga0207652_100871793 | 282 |
| 360 | 3300025921 | Ga0207652_10396118 | Ga0207652_103961181 | 282 |
| 361 | 3300025927 | Ga0207687_10022996 | Ga0207687_100229962 | 282 |
| 362 | 3300025931 | Ga0207644_10152836 | Ga0207644_101528362 | 282 |
| 363 | 3300025937 | Ga0207669_10005204 | Ga0207669_100052044 | 282 |
| 364 | 3300025940 | Ga0207691_10202880 | Ga0207691_102028802 | 282 |
| 365 | 3300025941 | Ga0207711_10148928 | Ga0207711_101489282 | 282 |
| 366 | 3300025941 | Ga0207711_10484241 | Ga0207711_104842412 | 282 |
| 367 | 3300025942 | Ga0207689_10023247 | Ga0207689_100232472 | 282 |
| 368 | 3300025942 | Ga0207689_10324719 | Ga0207689_103247192 | 282 |
| 369 | 3300025945 | Ga0207679_10022818 | Ga0207679_100228186 | 282 |
| 370 | 3300025945 | Ga0207679_10328611 | Ga0207679_103286112 | 282 |
| 371 | 3300025945 | Ga0207679_10421657 | Ga0207679_104216572 | 282 |
| 372 | 3300025949 | Ga0207667_10033609 | Ga0207667_100336092 | 282 |
| 373 | 3300025949 | Ga0207667_10453942 | Ga0207667_104539421 | 282 |
| 374 | 3300025972 | Ga0207668_10193322 | Ga0207668_101933222 | 282 |
| 375 | 3300025972 | Ga0207668_10340104 | Ga0207668_103401042 | 282 |
| 376 | 3300026023 | Ga0207677_10050484 | Ga0207677_100504842 | 282 |
| 377 | 3300026023 | Ga0207677_10066698 | Ga0207677_100666982 | 282 |
| 378 | 3300026035 | Ga0207703_10220249 | Ga0207703_102202492 | 282 |
| 379 | 3300026041 | Ga0207639_10377146 | Ga0207639_103771462 | 282 |
| 380 | 3300026067 | Ga0207678_10001940 | Ga0207678_100019408 | 282 |
| 381 | 3300026067 | Ga0207678_10024458 | Ga0207678_100244584 | 282 |
| 382 | 3300026067 | Ga0207678_10037244 | Ga0207678_100372442 | 282 |
| 383 | 3300026067 | Ga0207678_10049285 | Ga0207678_100492853 | 282 |
| 384 | 3300026067 | Ga0207678_10084355 | Ga0207678_100843552 | 282 |
| 385 | 3300026067 | Ga0207678_10539372 | Ga0207678_105393722 | 282 |
| 386 | 3300026078 | Ga0207702_10033935 | Ga0207702_100339356 | 282 |
| 387 | 3300026078 | Ga0207702_10094416 | Ga0207702_100944162 | 282 |
| 388 | 3300026078 | Ga0207702_10558100 | Ga0207702_105581002 | 282 |
| 389 | 3300026095 | Ga0207676_10207299 | Ga0207676_102072992 | 282 |
| 390 | 3300026116 | Ga0207674_10356954 | Ga0207674_103569542 | 282 |
| 391 | 3300026118 | Ga0207675_100123921 | Ga0207675_1001239212 | 282 |
| 392 | 3300026121 | Ga0207683_10075692 | Ga0207683_100756923 | 282 |
| 393 | 3300026121 | Ga0207683_10134620 | Ga0207683_101346202 | 282 |
| 394 | 3300026121 | Ga0207683_10214473 | Ga0207683_102144732 | 282 |
| 395 | 3300026142 | Ga0207698_10087879 | Ga0207698_100878794 | 282 |
| 396 | 3300027671 | Ga0209588_1030991 | Ga0209588_10309912 | 282 |
| 397 | 3300027866 | Ga0209813_10112615 | Ga0209813_101126151 | 282 |
| 398 | 3300028379 | Ga0268266_10004300 | Ga0268266_1000430015 | 282 |
| 399 | 3300028379 | Ga0268266_10090488 | Ga0268266_100904882 | 282 |
| 400 | 3300028380 | Ga0268265_10037061 | Ga0268265_100370613 | 282 |
| 401 | 3300028381 | Ga0268264_10000157 | Ga0268264_1000015740 | 282 |
| 402 | 3300028786 | Ga0307517_10000563 | Ga0307517_1000056325 | 282 |
| 403 | 3300028794 | Ga0307515_10051455 | Ga0307515_100514556 | 282 |
| 404 | 3300028794 | Ga0307515_10097972 | Ga0307515_100979721 | 282 |
| 405 | 3300028794 | Ga0307515_10285074 | Ga0307515_102850742 | 282 |
| 406 | 3300030521 | Ga0307511_10156389 | Ga0307511_101563892 | 282 |
| 407 | 3300031456 | Ga0307513_10075026 | Ga0307513_100750263 | 282 |
| 408 | 3300031548 | Ga0307408_100494584 | Ga0307408_1004945842 | 282 |
| 409 | 3300031616 | Ga0307508_10084260 | Ga0307508_100842602 | 282 |
| 410 | 3300031730 | Ga0307516_10075321 | Ga0307516_100753214 | 282 |
| 411 | 3300031730 | Ga0307516_10206971 | Ga0307516_102069712 | 282 |
| 412 | 3300031731 | Ga0307405_10003590 | Ga0307405_100035904 | 282 |
| 413 | 3300031731 | Ga0307405_10097536 | Ga0307405_100975362 | 282 |
| 414 | 3300031824 | Ga0307413_10081300 | Ga0307413_100813002 | 282 |
| 415 | 3300031824 | Ga0307413_10236275 | Ga0307413_102362752 | 282 |
| 416 | 3300031903 | Ga0307407_10096993 | Ga0307407_100969932 | 282 |
| 417 | 3300031911 | Ga0307412_10004798 | Ga0307412_100047982 | 282 |
| 418 | 3300032002 | Ga0307416_100524016 | Ga0307416_1005240161 | 282 |
| 419 | 3300032002 | Ga0307416_100582896 | Ga0307416_1005828962 | 282 |
| 420 | 3300032005 | Ga0307411_10150379 | Ga0307411_101503792 | 282 |
| 421 | 3300032126 | Ga0307415_100017294 | Ga0307415_1000172944 | 282 |
| 422 | 3300032126 | Ga0307415_100129245 | Ga0307415_1001292452 | 282 |
| 423 | 3300032126 | Ga0307415_100161505 | Ga0307415_1001615052 | 282 |
| 424 | 3300033179 | Ga0307507_10218076 | Ga0307507_102180762 | 282 |
| 425 | 3300033180 | Ga0307510_10003322 | Ga0307510_100033229 | 282 |
| 426 | 3300035111 | Ga0373923_0115012 | Ga0373923_0115012_262_1110 | 282 |
| 427 | 3300035116 | Ga0373945_0021487 | Ga0373945_0021487_431_1279 | 282 |
| 428 | 3300035170 | Ga0373943_0004586 | Ga0373943_0004586_267_1115 | 282 |
| 429 | 3300035170 | Ga0373943_0031617 | Ga0373943_0031617_75_923 | 282 |
| 430 | 3300035171 | Ga0373946_0003778 | Ga0373946_0003778_4032_4880 | 282 |
| 431 | 3300035410 | Ga0373924_0049940 | Ga0373924_0049940_275_1123 | 282 |
| 432 | 3300035691 | Ga0373931_0001536 | Ga0373931_0001536_1448_2296 | 282 |
| 433 | 3300035691 | Ga0373931_0037121 | Ga0373931_0037121_808_1656 | 282 |
| 434 | 3300035692 | Ga0373935_0003462 | Ga0373935_0003462_6369_7217 | 282 |
| 435 | 3300035695 | Ga0373927_0003270 | Ga0373927_0003270_81_929 | 282 |
| 436 | 3300035695 | Ga0373927_0046561 | Ga0373927_0046561_333_1181 | 282 |
| 437 | 3300035695 | Ga0373927_0048000 | Ga0373927_0048000_1544_2392 | 282 |
| 438 | 3300035724 | Ga0373933_0000118 | Ga0373933_0000118_17541_18389 | 282 |
| 439 | 3300035725 | Ga0373947_0000402 | Ga0373947_0000402_15680_16528 | 282 |
| 440 | 3300035725 | Ga0373947_0083197 | Ga0373947_0083197_732_1580 | 282 |
| 441 | 3300035725 | Ga0373947_0305189 | Ga0373947_0305189_58_906 | 282 |
| 442 | 3300036401 | Ga0373937_0061382 | Ga0373937_0061382_466_1314 | 282 |
| 443 | 3300037068 | Ga0373925_0005137 | Ga0373925_0005137_4318_5166 | 282 |
| 444 | 3300037068 | Ga0373925_0387402 | Ga0373925_0387402_156_1004 | 282 |
| 445 | 3300037471 | Ga0395905_0042788 | Ga0395905_0042788_1348_2196 | 282 |
| 446 | 3300037471 | Ga0395905_0248249 | Ga0395905_0248249_388_1236 | 282 |
| 447 | 3300037853 | Ga0436364_0022219 | Ga0436364_0022219_5656_6504 | 282 |
| 448 | 3300037853 | Ga0436364_1025898 | Ga0436364_1025898_1416_2264 | 282 |
| 449 | 3300038443 | Ga0395901_0106311 | Ga0395901_0106311_486_1334 | 282 |
| 450 | 3300041509 | Ga0451843_0952665 | Ga0451843_0952665_145_993 | 282 |
| 451 | 3300041512 | Ga0451853_0699412 | Ga0451853_0699412_163_1011 | 282 |
| 452 | 3300044901 | Ga0466960_0030825 | Ga0466960_0030825_1573_2421 | 282 |
| 453 | 3300046452 | Ga0495617_020423 | Ga0495617_020423_69_917 | 282 |
| 454 | 3300046453 | Ga0495627_036172 | Ga0495627_036172_73_921 | 282 |
| 455 | 3300046454 | Ga0495592_0056633 | Ga0495592_0056633_211_1059 | 282 |
| 456 | 3300046455 | Ga0495603_0000826 | Ga0495603_0000826_12864_13712 | 282 |
| 457 | 3300046455 | Ga0495603_0023711 | Ga0495603_0023711_1829_2677 | 282 |
| 458 | 3300046455 | Ga0495603_0066420 | Ga0495603_0066420_1163_2011 | 282 |
| 459 | 3300046455 | Ga0495603_0075578 | Ga0495603_0075578_840_1688 | 282 |
| 460 | 3300046459 | Ga0495629_0000587 | Ga0495629_0000587_12815_13663 | 282 |
| 461 | 3300046459 | Ga0495629_0190864 | Ga0495629_0190864_290_1138 | 282 |
| 462 | 3300046460 | Ga0495638_0000833 | Ga0495638_0000833_28346_29194 | 282 |
| 463 | 3300046460 | Ga0495638_0012048 | Ga0495638_0012048_4348_5196 | 282 |
| 464 | 3300046460 | Ga0495638_0208682 | Ga0495638_0208682_32_880 | 282 |
| 465 | 3300046461 | Ga0495641_0019439 | Ga0495641_0019439_1292_2140 | 282 |
| 466 | 3300046472 | Ga0495580_0002634 | Ga0495580_0002634_7676_8524 | 282 |
| 467 | 3300046472 | Ga0495580_0128338 | Ga0495580_0128338_595_1443 | 282 |
| 468 | 3300046473 | Ga0495582_0000018 | Ga0495582_0000018_74880_75728 | 282 |
| 469 | 3300046473 | Ga0495582_0179846 | Ga0495582_0179846_76_924 | 282 |
| 470 | 3300046474 | Ga0495605_0002954 | Ga0495605_0002954_2742_3590 | 282 |
| 471 | 3300046475 | Ga0495639_0000272 | Ga0495639_0000272_6921_7769 | 282 |
| 472 | 3300046477 | Ga0495664_0054267 | Ga0495664_0054267_1101_1949 | 282 |
| 473 | 3300046492 | Ga0495585_0010998 | Ga0495585_0010998_1051_1899 | 282 |
| 474 | 3300046492 | Ga0495585_0053442 | Ga0495585_0053442_1274_2122 | 282 |
| 475 | 3300046492 | Ga0495585_0226400 | Ga0495585_0226400_12_860 | 282 |
| 476 | 3300046499 | Ga0495594_0000155 | Ga0495594_0000155_18977_19825 | 282 |
| 477 | 3300046499 | Ga0495594_0201232 | Ga0495594_0201232_274_1122 | 282 |
| 478 | 3300046501 | Ga0495607_0048719 | Ga0495607_0048719_519_1367 | 282 |
| 479 | 3300046501 | Ga0495607_0053211 | Ga0495607_0053211_749_1597 | 282 |
| 480 | 3300046506 | Ga0495583_0016172 | Ga0495583_0016172_991_1839 | 282 |
| 481 | 3300046507 | Ga0495606_0214763 | Ga0495606_0214763_52_900 | 282 |
| 482 | 3300046512 | Ga0495610_0007227 | Ga0495610_0007227_4388_5236 | 282 |
| 483 | 3300046512 | Ga0495610_0138702 | Ga0495610_0138702_156_1004 | 282 |
| 484 | 3300046513 | Ga0495616_0018020 | Ga0495616_0018020_608_1456 | 282 |
| 485 | 3300046513 | Ga0495616_0067090 | Ga0495616_0067090_640_1488 | 282 |
| 486 | 3300046514 | Ga0495618_0007273 | Ga0495618_0007273_3106_3954 | 282 |
| 487 | 3300046515 | Ga0495620_0025262 | Ga0495620_0025262_1499_2347 | 282 |
| 488 | 3300046516 | Ga0495628_0225301 | Ga0495628_0225301_288_1136 | 282 |
| 489 | 3300046517 | Ga0495630_0034444 | Ga0495630_0034444_914_1762 | 282 |
| 490 | 3300046518 | Ga0495631_0005687 | Ga0495631_0005687_2916_3764 | 282 |
| 491 | 3300046518 | Ga0495631_0066771 | Ga0495631_0066771_119_967 | 282 |
| 492 | 3300046519 | Ga0495632_0012036 | Ga0495632_0012036_3311_4159 | 282 |
| 493 | 3300046519 | Ga0495632_0115494 | Ga0495632_0115494_226_1074 | 282 |
| 494 | 3300046520 | Ga0495637_0067400 | Ga0495637_0067400_409_1257 | 282 |
| 495 | 3300046522 | Ga0495643_0160169 | Ga0495643_0160169_180_1028 | 282 |
| 496 | 3300046523 | Ga0495644_0014165 | Ga0495644_0014165_1532_2380 | 282 |
| 497 | 3300046526 | Ga0495666_0006572 | Ga0495666_0006572_3885_4733 | 282 |
| 498 | 3300046526 | Ga0495666_0167334 | Ga0495666_0167334_160_1008 | 282 |
| 499 | 3300046529 | Ga0495652_0037042 | Ga0495652_0037042_2356_3204 | 282 |
| 500 | 3300046530 | Ga0495654_0000070 | Ga0495654_0000070_52450_53298 | 282 |
| 501 | 3300046533 | Ga0495640_0007630 | Ga0495640_0007630_1834_2682 | 282 |
| 502 | 3300046536 | Ga0495587_0239528 | Ga0495587_0239528_149_997 | 282 |
| 503 | 3300046538 | Ga0495609_0044048 | Ga0495609_0044048_1089_1937 | 282 |
| 504 | 3300046538 | Ga0495609_0131690 | Ga0495609_0131690_97_945 | 282 |
| 505 | 3300046543 | Ga0495645_0210350 | Ga0495645_0210350_430_1278 | 282 |
| 506 | 3300046557 | Ga0495622_0063255 | Ga0495622_0063255_738_1586 | 282 |
| 507 | 3300046559 | Ga0495667_0101034 | Ga0495667_0101034_15_863 | 282 |
| 508 | 3300046615 | Ga0495656_0010222 | Ga0495656_0010222_641_1489 | 282 |
| 509 | 3300046615 | Ga0495656_0042684 | Ga0495656_0042684_267_1115 | 282 |
| 510 | 3300046616 | Ga0495668_0008208 | Ga0495668_0008208_2428_3276 | 282 |
| 511 | 3300046642 | Ga0495634_0005787 | Ga0495634_0005787_7497_8345 | 282 |
| 512 | 3300046648 | Ga0495611_0013344 | Ga0495611_0013344_2434_3282 | 282 |
| 513 | 3300046648 | Ga0495611_0106773 | Ga0495611_0106773_110_958 | 282 |
| 514 | 3300046660 | Ga0495625_0007996 | Ga0495625_0007996_1085_1933 | 282 |
| 515 | 3300046660 | Ga0495625_0062133 | Ga0495625_0062133_1249_2097 | 282 |
| 516 | 3300046660 | Ga0495625_0149406 | Ga0495625_0149406_456_1304 | 282 |
| 517 | 3300046660 | Ga0495625_0260514 | Ga0495625_0260514_80_928 | 282 |
| 518 | 3300046663 | Ga0495635_0001867 | Ga0495635_0001867_5707_6555 | 282 |
| 519 | 3300046664 | Ga0495659_0158973 | Ga0495659_0158973_40_888 | 282 |
| 520 | 3300046665 | Ga0495661_0125139 | Ga0495661_0125139_133_981 | 282 |
| 521 | 3300046674 | Ga0495588_0002125 | Ga0495588_0002125_5439_6287 | 282 |
| 522 | 3300046674 | Ga0495588_0050176 | Ga0495588_0050176_331_1179 | 282 |
| 523 | 3300046678 | Ga0495599_0126438 | Ga0495599_0126438_672_1520 | 282 |
| 524 | 3300046680 | Ga0495646_0049449 | Ga0495646_0049449_1247_2095 | 282 |
| 525 | 3300046681 | Ga0495647_0001870 | Ga0495647_0001870_5607_6455 | 282 |
| 526 | 3300046683 | Ga0495658_0002067 | Ga0495658_0002067_208_1056 | 282 |
| 527 | 3300046683 | Ga0495658_0290200 | Ga0495658_0290200_171_1019 | 282 |
| 528 | 3300046684 | Ga0495669_0084519 | Ga0495669_0084519_515_1363 | 282 |
| 529 | 3300046689 | Ga0495613_0027117 | Ga0495613_0027117_1048_1896 | 282 |
| 530 | 3300046690 | Ga0495624_0001316 | Ga0495624_0001316_5808_6656 | 282 |
| 531 | 3300046691 | Ga0495670_0127528 | Ga0495670_0127528_354_1202 | 282 |
| 532 | 3300046809 | Ga0495600_0261693 | Ga0495600_0261693_134_982 | 282 |
| 533 | 3300046810 | Ga0495660_0008560 | Ga0495660_0008560_2476_3324 | 282 |
| 534 | 3300047315 | Ga0495581_0001084 | Ga0495581_0001084_1089_1937 | 282 |
| 535 | 3300047315 | Ga0495581_0012982 | Ga0495581_0012982_2550_3398 | 282 |
| 536 | 3300047315 | Ga0495581_0024937 | Ga0495581_0024937_2407_3255 | 282 |
| 537 | 3300047318 | Ga0495636_0019473 | Ga0495636_0019473_1345_2193 | 282 |
| 538 | 3300047319 | Ga0495674_0003842 | Ga0495674_0003842_933_1781 | 282 |
| 539 | 3300047320 | Ga0495672_0006265 | Ga0495672_0006265_1945_2793 | 282 |
| 540 | 3300047320 | Ga0495672_0025520 | Ga0495672_0025520_71_919 | 282 |
| 541 | 3300047321 | Ga0495676_0014924 | Ga0495676_0014924_3321_4169 | 282 |
| 542 | 3300047443 | Ga0495687_021545 | Ga0495687_021545_1500_2348 | 282 |
| 543 | 3300047471 | Ga0495684_0045699 | Ga0495684_0045699_1625_2473 | 282 |
| 544 | 3300047472 | Ga0495686_0023341 | Ga0495686_0023341_1660_2508 | 282 |
| 545 | 3300047472 | Ga0495686_0031787 | Ga0495686_0031787_408_1256 | 282 |
| 546 | 3300047673 | Ga0495593_0000419 | Ga0495593_0000419_12864_13712 | 282 |
| 547 | 3300048090 | Ga0495615_0054306 | Ga0495615_0054306_95_943 | 282 |
| 548 | 3300048091 | Ga0495626_0027839 | Ga0495626_0027839_1126_1974 | 282 |
| 549 | 3300048903 | Ga0496100_0020076 | Ga0496100_0020076_1675_2523 | 282 |
| 550 | 3300048903 | Ga0496100_0228476 | Ga0496100_0228476_401_1249 | 282 |
| 551 | 3300048904 | Ga0496101_0240659 | Ga0496101_0240659_154_1002 | 282 |
| 552 | 3300048905 | Ga0496102_0002704 | Ga0496102_0002704_6062_6910 | 282 |
| 553 | 3300048905 | Ga0496102_0175439 | Ga0496102_0175439_844_1692 | 282 |
| 554 | 3300048905 | Ga0496102_0217481 | Ga0496102_0217481_787_1635 | 282 |
| 555 | 3300048905 | Ga0496102_0240401 | Ga0496102_0240401_250_1098 | 282 |
| 556 | 3300048906 | Ga0496103_0091609 | Ga0496103_0091609_205_1053 | 282 |
| 557 | 3300048907 | Ga0496104_0001082 | Ga0496104_0001082_8817_9665 | 282 |
| 558 | 3300048907 | Ga0496104_0016511 | Ga0496104_0016511_1242_2090 | 282 |
| 559 | 3300048908 | Ga0496105_0001148 | Ga0496105_0001148_4047_4895 | 282 |
| 560 | 3300048908 | Ga0496105_0003117 | Ga0496105_0003117_4653_5501 | 282 |
| 561 | 3300048908 | Ga0496105_0063670 | Ga0496105_0063670_1594_2442 | 282 |
| 562 | 3300048909 | Ga0496106_0000246 | Ga0496106_0000246_35383_36231 | 282 |
| 563 | 3300048909 | Ga0496106_0007049 | Ga0496106_0007049_3132_3980 | 282 |
| 564 | 3300048910 | Ga0496107_0015565 | Ga0496107_0015565_1221_2069 | 282 |
| 565 | 3300048911 | Ga0496108_0001659 | Ga0496108_0001659_16211_17059 | 282 |
| 566 | 3300048911 | Ga0496108_0022922 | Ga0496108_0022922_684_1532 | 282 |
| 567 | 3300048911 | Ga0496108_0028959 | Ga0496108_0028959_1199_2047 | 282 |
| 568 | 3300048912 | Ga0496109_0002048 | Ga0496109_0002048_13599_14447 | 282 |
| 569 | 3300048912 | Ga0496109_0013738 | Ga0496109_0013738_5617_6465 | 282 |
| 570 | 3300048913 | Ga0496110_0008384 | Ga0496110_0008384_1383_2231 | 282 |
| 571 | 3300048913 | Ga0496110_0029898 | Ga0496110_0029898_2714_3562 | 282 |
| 572 | 3300048913 | Ga0496110_0061035 | Ga0496110_0061035_280_1128 | 282 |
| 573 | 3300048913 | Ga0496110_0130949 | Ga0496110_0130949_791_1639 | 282 |
| 574 | 3300048914 | Ga0496111_0012718 | Ga0496111_0012718_349_1197 | 282 |
| 575 | 3300048914 | Ga0496111_0045079 | Ga0496111_0045079_1602_2450 | 282 |
| 576 | 3300048914 | Ga0496111_0062177 | Ga0496111_0062177_1218_2066 | 282 |
| 577 | 3300048914 | Ga0496111_0073060 | Ga0496111_0073060_1431_2279 | 282 |
| 578 | 3300048915 | Ga0496112_0000020 | Ga0496112_0000020_158197_159045 | 282 |
| 579 | 3300048915 | Ga0496112_0000896 | Ga0496112_0000896_7131_7979 | 282 |
| 580 | 3300048915 | Ga0496112_0029729 | Ga0496112_0029729_1836_2684 | 282 |
| 581 | 3300048915 | Ga0496112_0052787 | Ga0496112_0052787_2807_3655 | 282 |
| 582 | 3300048915 | Ga0496112_0054174 | Ga0496112_0054174_2848_3696 | 282 |
| 583 | 3300048915 | Ga0496112_0123913 | Ga0496112_0123913_497_1345 | 282 |
| 584 | 3300048915 | Ga0496112_0146675 | Ga0496112_0146675_935_1783 | 282 |
| 585 | 3300048916 | Ga0496113_0000418 | Ga0496113_0000418_13321_14169 | 282 |
| 586 | 3300048916 | Ga0496113_0005880 | Ga0496113_0005880_899_1747 | 282 |
| 587 | 3300048916 | Ga0496113_0008522 | Ga0496113_0008522_5531_6379 | 282 |
| 588 | 3300048916 | Ga0496113_0142445 | Ga0496113_0142445_929_1777 | 282 |
| 589 | 3300048916 | Ga0496113_0288980 | Ga0496113_0288980_151_999 | 282 |
| 590 | 3300048917 | Ga0496114_0018754 | Ga0496114_0018754_2487_3335 | 282 |
| 591 | 3300048918 | Ga0496115_0001613 | Ga0496115_0001613_996_1844 | 282 |
| 592 | 3300048918 | Ga0496115_0001912 | Ga0496115_0001912_4219_5067 | 282 |
| 593 | 3300048918 | Ga0496115_0074897 | Ga0496115_0074897_1217_2065 | 282 |
| 594 | 3300048918 | Ga0496115_0144881 | Ga0496115_0144881_489_1337 | 282 |
| 595 | 3300048919 | Ga0496116_0003347 | Ga0496116_0003347_6380_7228 | 282 |
| 596 | 3300048919 | Ga0496116_0013325 | Ga0496116_0013325_3847_4695 | 282 |
| 597 | 3300048919 | Ga0496116_0031866 | Ga0496116_0031866_1016_1864 | 282 |
| 598 | 3300048920 | Ga0496117_0018057 | Ga0496117_0018057_707_1555 | 282 |
| 599 | 3300048920 | Ga0496117_0020727 | Ga0496117_0020727_3185_4033 | 282 |
| 600 | 3300048920 | Ga0496117_0022800 | Ga0496117_0022800_3960_4808 | 282 |
| 601 | 3300048920 | Ga0496117_0248607 | Ga0496117_0248607_54_902 | 282 |
| 602 | 3300048921 | Ga0496118_0043406 | Ga0496118_0043406_2009_2857 | 282 |
| 603 | 3300048921 | Ga0496118_0065233 | Ga0496118_0065233_547_1395 | 282 |
| 604 | 3300048921 | Ga0496118_0094446 | Ga0496118_0094446_952_1800 | 282 |
| 605 | 3300048921 | Ga0496118_0102794 | Ga0496118_0102794_620_1468 | 282 |
| 606 | 3300048922 | Ga0496119_0200833 | Ga0496119_0200833_97_945 | 282 |
| 607 | 3300048923 | Ga0496120_0088234 | Ga0496120_0088234_262_1110 | 282 |
| 608 | 3300048923 | Ga0496120_0118508 | Ga0496120_0118508_346_1194 | 282 |
| 609 | 3300048923 | Ga0496120_0155762 | Ga0496120_0155762_176_1024 | 282 |
| 610 | 3300048924 | Ga0496121_0000270 | Ga0496121_0000270_100693_101541 | 282 |
| 611 | 3300048924 | Ga0496121_0000423 | Ga0496121_0000423_10093_10941 | 282 |
| 612 | 3300048924 | Ga0496121_0038910 | Ga0496121_0038910_560_1408 | 282 |
| 613 | 3300048924 | Ga0496121_0042847 | Ga0496121_0042847_2318_3166 | 282 |
| 614 | 3300048924 | Ga0496121_0054223 | Ga0496121_0054223_1242_2090 | 282 |
| 615 | 3300048924 | Ga0496121_0093632 | Ga0496121_0093632_225_1073 | 282 |
| 616 | 3300048925 | Ga0496122_0035434 | Ga0496122_0035434_2448_3296 | 282 |
| 617 | 3300048925 | Ga0496122_0045607 | Ga0496122_0045607_386_1234 | 282 |
| 618 | 3300048926 | Ga0496123_0043809 | Ga0496123_0043809_285_1133 | 282 |
| 619 | 3300048927 | Ga0496124_0000235 | Ga0496124_0000235_96214_97062 | 282 |
| 620 | 3300048927 | Ga0496124_0008518 | Ga0496124_0008518_6199_7047 | 282 |
| 621 | 3300048927 | Ga0496124_0055170 | Ga0496124_0055170_2459_3307 | 282 |
| 622 | 3300048927 | Ga0496124_0057434 | Ga0496124_0057434_934_1782 | 282 |
| 623 | 3300048927 | Ga0496124_0141340 | Ga0496124_0141340_274_1122 | 282 |
| 624 | 3300048927 | Ga0496124_0168123 | Ga0496124_0168123_287_1135 | 282 |
| 625 | 3300048928 | Ga0496125_0000136 | Ga0496125_0000136_55919_56767 | 282 |
| 626 | 3300048928 | Ga0496125_0010670 | Ga0496125_0010670_830_1678 | 282 |
| 627 | 3300048928 | Ga0496125_0019278 | Ga0496125_0019278_485_1333 | 282 |
| 628 | 3300048928 | Ga0496125_0066023 | Ga0496125_0066023_716_1564 | 282 |
| 629 | 3300048928 | Ga0496125_0126245 | Ga0496125_0126245_452_1300 | 282 |
| 630 | 3300048928 | Ga0496125_0145003 | Ga0496125_0145003_480_1328 | 282 |
| 631 | 3300048929 | Ga0496126_0022756 | Ga0496126_0022756_3827_4675 | 282 |
| 632 | 3300048929 | Ga0496126_0028765 | Ga0496126_0028765_1315_2163 | 282 |
| 633 | 3300048929 | Ga0496126_0041530 | Ga0496126_0041530_1433_2281 | 282 |
| 634 | 3300048929 | Ga0496126_0173703 | Ga0496126_0173703_348_1196 | 282 |
| 635 | 3300048929 | Ga0496126_0193117 | Ga0496126_0193117_34_882 | 282 |
| 636 | 3300048929 | Ga0496126_0211409 | Ga0496126_0211409_327_1175 | 282 |
| 637 | 3300048929 | Ga0496126_0227673 | Ga0496126_0227673_223_1071 | 282 |
| 638 | 3300049459 | Ga0495678_031113 | Ga0495678_031113_840_1688 | 282 |
| 639 | 3300049459 | Ga0495678_081863 | Ga0495678_081863_229_1077 | 282 |
| 640 | 3300049460 | Ga0495682_0018813 | Ga0495682_0018813_1662_2510 | 282 |
| 641 | 3300049568 | Ga0501031_0029347 | Ga0501031_0029347_864_1712 | 282 |
| 642 | 3300049569 | Ga0501032_0104593 | Ga0501032_0104593_472_1320 | 282 |
| 643 | 3300049571 | Ga0501034_0000243 | Ga0501034_0000243_24422_25270 | 282 |
| 644 | 3300049571 | Ga0501034_0203547 | Ga0501034_0203547_809_1657 | 282 |
| 645 | 3300049571 | Ga0501034_0223324 | Ga0501034_0223324_903_1751 | 282 |
| 646 | 3300049573 | Ga0501037_0013834 | Ga0501037_0013834_528_1376 | 282 |
| 647 | 3300049574 | Ga0501038_0076488 | Ga0501038_0076488_762_1610 | 282 |
| 648 | 3300049579 | Ga0501043_0026939 | Ga0501043_0026939_491_1339 | 282 |
| 649 | 3300049581 | Ga0501047_0021011 | Ga0501047_0021011_4869_5717 | 282 |
| 650 | 3300049583 | Ga0501067_0215816 | Ga0501067_0215816_112_960 | 282 |
| 651 | 3300049822 | Ga0501035_0030102 | Ga0501035_0030102_3188_4036 | 282 |
| 652 | 3300049823 | Ga0501044_0178495 | Ga0501044_0178495_111_959 | 282 |
| 653 | 3300050489 | nmdc:mga03683_1977_c2 | nmdc:mga03683_1977_c2_1063_1911 | 282 |
| 654 | 3300050489 | nmdc:mga03683_25662_c1 | nmdc:mga03683_25662_c1_558_1406 | 282 |
| 655 | 3300050490 | nmdc:mga03n38_27549_c1 | nmdc:mga03n38_27549_c1_1064_1912 | 282 |
| 656 | 3300050490 | nmdc:mga03n38_6856_c1 | nmdc:mga03n38_6856_c1_1254_2102 | 282 |
| 657 | 3300050491 | nmdc:mga00v17_179472_c1 | nmdc:mga00v17_179472_c1_377_1225 | 282 |
| 658 | 3300050491 | nmdc:mga00v17_26_c4 | nmdc:mga00v17_26_c4_23222_24070 | 282 |
| 659 | 3300050492 | nmdc:mga0yw44_12063_c1 | nmdc:mga0yw44_12063_c1_250_1098 | 282 |
| 660 | 3300050492 | nmdc:mga0yw44_42184_c1 | nmdc:mga0yw44_42184_c1_78_926 | 282 |
| 661 | 3300050492 | nmdc:mga0yw44_5703_c1 | nmdc:mga0yw44_5703_c1_2786_3634 | 282 |
| 662 | 3300050492 | nmdc:mga0yw44_71610_c1 | nmdc:mga0yw44_71610_c1_1134_1982 | 282 |
| 663 | 3300050493 | nmdc:mga0k408_107162_c1 | nmdc:mga0k408_107162_c1_390_1238 | 282 |
| 664 | 3300050494 | nmdc:mga06z11_169871_c1 | nmdc:mga06z11_169871_c1_361_1209 | 282 |
| 665 | 3300050494 | nmdc:mga06z11_174938_c1 | nmdc:mga06z11_174938_c1_75_923 | 282 |
| 666 | 3300050494 | nmdc:mga06z11_60847_c1 | nmdc:mga06z11_60847_c1_448_1296 | 282 |
| 667 | 3300050494 | nmdc:mga06z11_6341_c1 | nmdc:mga06z11_6341_c1_2878_3726 | 282 |
| 668 | 3300050494 | nmdc:mga06z11_83338_c1 | nmdc:mga06z11_83338_c1_39_887 | 282 |
| 669 | 3300050495 | nmdc:mga04h51_120054_c1 | nmdc:mga04h51_120054_c1_49_897 | 282 |
| 670 | 3300050495 | nmdc:mga04h51_41871_c1 | nmdc:mga04h51_41871_c1_336_1184 | 282 |
| 671 | 3300050496 | nmdc:mga07m45_57971_c1 | nmdc:mga07m45_57971_c1_1218_2066 | 282 |
| 672 | 3300050496 | nmdc:mga07m45_9507_c1 | nmdc:mga07m45_9507_c1_2762_3610 | 282 |
| 673 | 3300050507 | nmdc:mga05p37_117318_c1 | nmdc:mga05p37_117318_c1_1562_2410 | 282 |
| 674 | 3300050516 | nmdc:mga0sz30_29166_c1 | nmdc:mga0sz30_29166_c1_479_1327 | 282 |
| 675 | 3300050516 | nmdc:mga0sz30_51173_c1 | nmdc:mga0sz30_51173_c1_672_1520 | 282 |
| 676 | 3300053077 | Ga0495601_0243834 | Ga0495601_0243834_288_1136 | 282 |
| 677 | 3300053079 | Ga0500610_0018728 | Ga0500610_0018728_1817_2665 | 282 |
| 678 | 3300053079 | Ga0500610_0192037 | Ga0500610_0192037_132_980 | 282 |
| 679 | 3300053085 | Ga0495619_0050354 | Ga0495619_0050354_604_1452 | 282 |
| 680 | 3300053087 | Ga0500643_032290 | Ga0500643_032290_163_1011 | 282 |
| 681 | 3300053089 | Ga0500581_015132 | Ga0500581_015132_49_897 | 282 |
| 682 | 3300053090 | Ga0500646_0069005 | Ga0500646_0069005_24_872 | 282 |
| 683 | 3300053092 | Ga0500583_0105392 | Ga0500583_0105392_228_1076 | 282 |
| 684 | 3300053094 | Ga0500566_0007835 | Ga0500566_0007835_4403_5251 | 282 |
| 685 | 3300053094 | Ga0500566_0044722 | Ga0500566_0044722_1526_2374 | 282 |
| 686 | 3300053094 | Ga0500566_0212438 | Ga0500566_0212438_110_958 | 282 |
| 687 | 3300053098 | Ga0500650_0001027 | Ga0500650_0001027_5803_6651 | 282 |
| 688 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_435197_436045 | 282 |
| 689 | 3300053104 | Ga0500556_0079668 | Ga0500556_0079668_187_1035 | 282 |
| 690 | 3300053105 | Ga0500557_001701 | Ga0500557_001701_2001_2849 | 282 |
| 691 | 3300053108 | Ga0500562_011821 | Ga0500562_011821_163_1011 | 282 |
| 692 | 3300053117 | Ga0500593_011818 | Ga0500593_011818_129_977 | 282 |
| 693 | 3300053118 | Ga0500594_0006622 | Ga0500594_0006622_980_1828 | 282 |
| 694 | 3300053119 | Ga0500595_001180 | Ga0500595_001180_4235_5083 | 282 |
| 695 | 3300053122 | Ga0500608_000937 | Ga0500608_000937_7644_8492 | 282 |
| 696 | 3300053125 | Ga0500618_000096 | Ga0500618_000096_66554_67402 | 282 |
| 697 | 3300053125 | Ga0500618_000415 | Ga0500618_000415_19756_20604 | 282 |
| 698 | 3300053125 | Ga0500618_003908 | Ga0500618_003908_775_1623 | 282 |
| 699 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_17940_18788 | 282 |
| 700 | 3300053130 | Ga0500642_0056491 | Ga0500642_0056491_40_888 | 282 |
| 701 | 3300053131 | Ga0500652_001163 | Ga0500652_001163_1731_2579 | 282 |
| 702 | 3300053133 | Ga0500655_009861 | Ga0500655_009861_858_1706 | 282 |
| 703 | 3300053134 | Ga0500658_0065981 | Ga0500658_0065981_84_932 | 282 |
| 704 | 3300053136 | Ga0500559_0000276 | Ga0500559_0000276_33225_34073 | 282 |
| 705 | 3300053136 | Ga0500559_0081072 | Ga0500559_0081072_108_956 | 282 |
| 706 | 3300053139 | Ga0500568_0001000 | Ga0500568_0001000_6645_7493 | 282 |
| 707 | 3300053139 | Ga0500568_0002024 | Ga0500568_0002024_3806_4654 | 282 |
| 708 | 3300053145 | Ga0500586_000530 | Ga0500586_000530_514_1362 | 282 |
| 709 | 3300053146 | Ga0500588_0054521 | Ga0500588_0054521_293_1141 | 282 |
| 710 | 3300053150 | Ga0500603_000275 | Ga0500603_000275_3530_4378 | 282 |
| 711 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_441642_442490 | 282 |
| 712 | 3300053153 | Ga0500616_0000170 | Ga0500616_0000170_47172_48020 | 282 |
| 713 | 3300053153 | Ga0500616_0000903 | Ga0500616_0000903_16893_17741 | 282 |
| 714 | 3300053156 | Ga0500622_0009939 | Ga0500622_0009939_2087_2935 | 282 |
| 715 | 3300053156 | Ga0500622_0101899 | Ga0500622_0101899_164_1012 | 282 |
| 716 | 3300053161 | Ga0500634_0000006 | Ga0500634_0000006_124846_125694 | 282 |
| 717 | 3300053161 | Ga0500634_0047729 | Ga0500634_0047729_589_1437 | 282 |
| 718 | 3300053162 | Ga0500638_100255 | Ga0500638_100255_340_1188 | 282 |
| 719 | 3300053177 | Ga0500636_0003529 | Ga0500636_0003529_6246_7094 | 282 |
| 720 | 3300053177 | Ga0500636_0173937 | Ga0500636_0173937_198_1046 | 282 |
| 721 | 3300053178 | Ga0500637_0000247 | Ga0500637_0000247_12676_13524 | 282 |
| 722 | 3300053178 | Ga0500637_0003800 | Ga0500637_0003800_4397_5245 | 282 |
| 723 | 3300053178 | Ga0500637_0043652 | Ga0500637_0043652_367_1215 | 282 |
| 724 | 3300053178 | Ga0500637_0091394 | Ga0500637_0091394_746_1594 | 282 |
| 725 | 3300053730 | Ga0500645_006911 | Ga0500645_006911_1382_2230 | 282 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tqu-assembly1.cif.gz_N | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8003 | 1 | 274 |
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7915 | 1 | 271 |
| 4tqu-assembly1.cif.gz_N | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.7776 | 1 | 274 |
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7616 | 1 | 271 |
| 8hpr-assembly1.cif.gz_B | lpqy-sugabc in state 4 | 0.7545 | 1 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P10906_2_274_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9027 | 2 | 274 | 1.10.3720.10 |
| af_P10906_2_274_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8965 | 2 | 274 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.871 | 6 | 271 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8662 | 5 | 270 | 1.10.3720.10 |
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8523 | 1 | 274 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I4YSZ6-F1-model_v4 | sn-glycerol-3-phosphate transport system permease protein UgpE | 0.9165 | 1 | 282 |
GO:0005886
GO:0055085 |
| AF-A0A0W0X023-F1-model_v4 | sn-glycerol-3-phosphate transport system permease protein UgpE | 0.9165 | 5 | 277 |
GO:0005886
GO:0055085 |
| AF-A0A0W0VN93-F1-model_v4 | sn-glycerol-3-phosphate transport system permease protein UgpE | 0.9158 | 5 | 276 |
GO:0005886
GO:0055085 |
| AF-A0A4Q3HYC3-F1-model_v4 | sn-glycerol-3-phosphate transport system permease protein UgpE | 0.9155 | 1 | 264 |
GO:0005886
GO:0055085 |
| AF-I4YSZ6-F1-model_v4 | sn-glycerol-3-phosphate transport system permease protein UgpE | 0.9134 | 1 | 282 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar