F477616

General Info

Members Datasets Scaffolds Average Seq Length
725 262 1450 144

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10122757|Ga0207706_101227573
Length 162
Sequence MCARLGSDSGAARPGVPVLAHEARVADALIPRADGPAELVLAPRAGQEEQFTPEFKEVRSSYDAKHTPKLAAPDSVKRGQWFDVTITVGAGGEHPSLSEHHVRYIALYKDSAEIARVYLHPVFSAPRVTFTIALDEGGSLRAIAEPTHSAAWEASKKISVVP

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
88 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
187 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
188 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
198 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
260 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.79
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10122757 3300025933 Bacteria 2285
2 rootL2_10356550 3300003322 Bacteria 1193
3 Ga0058862_12690600 3300004803 Unclassified 790
4 Ga0065712_10004747 3300005290 Bacteria 3119
5 Ga0065712_10069486 3300005290 Bacteria 7198
6 Ga0065715_10091128 3300005293 Bacteria 6082
7 Ga0065707_10020350 3300005295 Unclassified 1457
8 Ga0065707_10140972 3300005295 Unclassified 1773
9 Ga0065707_10148360 3300005295 Bacteria 1685
10 Ga0065707_10196840 3300005295 Bacteria 1331
11 Ga0065707_10366270 3300005295 Bacteria 896
12 Ga0065707_10948388 3300005295 Unclassified 553
13 Ga0070683_100545149 3300005329 Unclassified 1109
14 Ga0070690_100007878 3300005330 Bacteria 6111
15 Ga0070670_100001766 3300005331 Bacteria 17595
16 Ga0070677_10314736 3300005333 Unclassified 800
17 Ga0070666_10014437 3300005335 Bacteria 5029
18 Ga0070680_100011527 3300005336 Bacteria 6840
19 Ga0070682_100147288 3300005337 Bacteria 1612
20 Ga0068868_100154639 3300005338 Bacteria 1891
21 Ga0070660_100012240 3300005339 Bacteria 6123
22 Ga0070691_10061433 3300005341 Bacteria 1807
23 Ga0070661_100005812 3300005344 Bacteria 8484
24 Ga0070692_10283612 3300005345 Unclassified 1005
25 Ga0070668_100856912 3300005347 Bacteria 810
26 Ga0070669_100015077 3300005353 Bacteria 5507
27 Ga0070669_100067062 3300005353 Bacteria 2646
28 Ga0070675_100102532 3300005354 Bacteria 2411
29 Ga0070671_100318817 3300005355 Bacteria 1324
30 Ga0070671_100377159 3300005355 Unclassified 1212
31 Ga0070674_100041440 3300005356 Bacteria 3121
32 Ga0070674_100278508 3300005356 Unclassified 1325
33 Ga0070673_100158758 3300005364 Bacteria 1921
34 Ga0070659_100071414 3300005366 Bacteria 2760
35 Ga0070659_100855809 3300005366 Bacteria 793
36 Ga0070667_100023120 3300005367 Bacteria 5156
37 Ga0070703_10513771 3300005406 Bacteria 541
38 Ga0070713_100406565 3300005436 Bacteria 1272
39 Ga0070711_100252001 3300005439 Bacteria 1385
40 Ga0070711_101121687 3300005439 Unclassified 678
41 Ga0070705_100008284 3300005440 Bacteria 5147
42 Ga0070705_100071958 3300005440 Bacteria 2093
43 Ga0070705_100124898 3300005440 Bacteria 1668
44 Ga0070700_100280908 3300005441 Unclassified 1207
45 Ga0070694_100007759 3300005444 Bacteria 6546
46 Ga0070694_100165880 3300005444 Bacteria 1624
47 Ga0070694_100189987 3300005444 Bacteria 1524
48 Ga0070708_100000602 3300005445 Bacteria 27055
49 Ga0070708_100137141 3300005445 Bacteria 2267
50 Ga0070708_100338436 3300005445 Bacteria 1418
51 Ga0070708_100748514 3300005445 Unclassified 919
52 Ga0070663_100066464 3300005455 Bacteria 2612
53 Ga0070663_101091905 3300005455 Unclassified 697
54 Ga0070678_100011100 3300005456 Bacteria 5540
55 Ga0070662_100151289 3300005457 Bacteria 1807
56 Ga0070662_100260071 3300005457 Unclassified 1398
57 Ga0070681_10052880 3300005458 Bacteria 4050
58 Ga0070681_10454251 3300005458 Unclassified 1193
59 Ga0068867_100412196 3300005459 Bacteria 1142
60 Ga0068867_100700010 3300005459 Unclassified 894
61 Ga0068867_101415388 3300005459 Unclassified 645
62 Ga0070706_100015188 3300005467 Bacteria 7110
63 Ga0070706_100034961 3300005467 Bacteria 4640
64 Ga0070706_100697241 3300005467 Unclassified 942
65 Ga0070707_100003325 3300005468 Bacteria 15181
66 Ga0070707_100062028 3300005468 Bacteria 3586
67 Ga0070698_100186685 3300005471 Bacteria 2011
68 Ga0070698_100300682 3300005471 Bacteria 1535
69 Ga0070698_100636058 3300005471 Bacteria 1008
70 Ga0070699_100004312 3300005518 Bacteria 12575
71 Ga0070699_100038120 3300005518 Bacteria 4162
72 Ga0070699_100040908 3300005518 Bacteria 4012
73 Ga0070699_100129976 3300005518 Bacteria 2220
74 Ga0070679_100038097 3300005530 Bacteria 4779
75 Ga0070697_100007393 3300005536 Bacteria 8552
76 Ga0070697_100009950 3300005536 Bacteria 7419
77 Ga0070697_100218176 3300005536 Bacteria 1625
78 Ga0070697_100282165 3300005536 Unclassified 1425
79 Ga0070697_100410454 3300005536 Unclassified 1176
80 Ga0070672_100045864 3300005543 Bacteria 3384
81 Ga0070672_100213496 3300005543 Bacteria 1617
82 Ga0070672_100705230 3300005543 Unclassified 884
83 Ga0070672_101760043 3300005543 Unclassified 557
84 Ga0070686_100730828 3300005544 Bacteria 792
85 Ga0070695_100013227 3300005545 Bacteria 4957
86 Ga0070695_100674578 3300005545 Bacteria 818
87 Ga0070696_100009505 3300005546 Bacteria 6509
88 Ga0070696_100020304 3300005546 Bacteria 4503
89 Ga0070696_100104051 3300005546 Bacteria 2038
90 Ga0070696_100160545 3300005546 Bacteria 1656
91 Ga0070696_100355704 3300005546 Bacteria 1135
92 Ga0070696_100509825 3300005546 Bacteria 958
93 Ga0070696_101685168 3300005546 Bacteria 546
94 Ga0070693_100111002 3300005547 Bacteria 1687
95 Ga0070693_100309303 3300005547 Unclassified 1068
96 Ga0070665_100304150 3300005548 Bacteria 1598
97 Ga0070704_100143263 3300005549 Bacteria 1869
98 Ga0070704_100272043 3300005549 Bacteria 1400
99 Ga0068855_100219544 3300005563 Bacteria 2132
100 Ga0070664_100033682 3300005564 Bacteria 4293
101 Ga0070702_100069315 3300005615 Bacteria 2077
102 Ga0068864_100534185 3300005618 Unclassified 1132
103 Ga0068861_100737950 3300005719 Bacteria 919
104 Ga0068861_101076976 3300005719 Unclassified 771
105 Ga0068863_100007993 3300005841 Bacteria 10338
106 Ga0068863_100372288 3300005841 Unclassified 1394
107 Ga0068860_100012812 3300005843 Bacteria 8244
108 Ga0068860_100191681 3300005843 Bacteria 1978
109 Ga0068860_100406155 3300005843 Unclassified 1348
110 Ga0068860_100755602 3300005843 Bacteria 984
111 Ga0068862_100052481 3300005844 Bacteria 3489
112 Ga0068862_100949987 3300005844 Bacteria 848
113 Ga0068862_100996631 3300005844 Unclassified 828
114 Ga0081455_10009226 3300005937 Bacteria 10166
115 Ga0081455_10077726 3300005937 Bacteria 2729
116 Ga0081455_10164918 3300005937 Bacteria 1694
117 Ga0081538_10009006 3300005981 Bacteria 8382
118 Ga0081538_10274969 3300005981 Unclassified 628
119 Ga0081540_1012974 3300005983 Bacteria 5443
120 Ga0081539_10001912 3300005985 Bacteria 32258
121 Ga0070715_10112765 3300006163 Unclassified 1285
122 Ga0070715_11008890 3300006163 Unclassified 519
123 Ga0070716_100091232 3300006173 Unclassified 1845
124 Ga0070716_100630947 3300006173 Unclassified 810
125 Ga0068871_100076313 3300006358 Bacteria 2767
126 Ga0075428_100002587 3300006844 Bacteria 19658
127 Ga0075428_100015920 3300006844 Bacteria 8320
128 Ga0075428_100024084 3300006844 Bacteria 6736
129 Ga0075428_100043178 3300006844 Bacteria 4957
130 Ga0075428_100093244 3300006844 Bacteria 3283
131 Ga0075428_100171354 3300006844 Bacteria 2352
132 Ga0075428_100232127 3300006844 Bacteria 1991
133 Ga0075428_100555955 3300006844 Unclassified 1227
134 Ga0075428_100688494 3300006844 Unclassified 1089
135 Ga0075428_101304865 3300006844 Unclassified 763
136 Ga0075430_100004545 3300006846 Bacteria 11682
137 Ga0075430_100027551 3300006846 Bacteria 4827
138 Ga0075430_100067775 3300006846 Bacteria 2995
139 Ga0075430_100116775 3300006846 Unclassified 2224
140 Ga0075430_100127480 3300006846 Bacteria 2122
141 Ga0075430_100195424 3300006846 Unclassified 1681
142 Ga0075430_100326325 3300006846 Bacteria 1269
143 Ga0075430_100383297 3300006846 Bacteria 1160
144 Ga0075430_100506950 3300006846 Bacteria 996
145 Ga0075431_100013329 3300006847 Bacteria 8310
146 Ga0075431_100017994 3300006847 Bacteria 7186
147 Ga0075431_100022315 3300006847 Bacteria 6470
148 Ga0075431_100091971 3300006847 Bacteria 3130
149 Ga0075431_100097607 3300006847 Bacteria 3034
150 Ga0075431_100173397 3300006847 Bacteria 2216
151 Ga0075431_100273404 3300006847 Unclassified 1711
152 Ga0075431_100335979 3300006847 Bacteria 1521
153 Ga0075431_100357399 3300006847 Unclassified 1468
154 Ga0075431_100434527 3300006847 Unclassified 1310
155 Ga0075431_100836083 3300006847 Bacteria 892
156 Ga0075431_100988657 3300006847 Unclassified 809
157 Ga0075433_10001832 3300006852 Bacteria 15958
158 Ga0075433_10003217 3300006852 Bacteria 12602
159 Ga0075433_10030968 3300006852 Bacteria 4568
160 Ga0075433_10047905 3300006852 Bacteria 3717
161 Ga0075433_10054362 3300006852 Bacteria 3493
162 Ga0075433_10091967 3300006852 Bacteria 2682
163 Ga0075433_10113404 3300006852 Bacteria 2405
164 Ga0075433_10161549 3300006852 Bacteria 1994
165 Ga0075433_10167234 3300006852 Bacteria 1957
166 Ga0075433_10181126 3300006852 Bacteria 1875
167 Ga0075433_10241522 3300006852 Bacteria 1603
168 Ga0075433_10344034 3300006852 Bacteria 1318
169 Ga0075433_10858008 3300006852 Unclassified 792
170 Ga0075433_10860406 3300006852 Unclassified 791
171 Ga0075434_100023778 3300006871 Bacteria 5978
172 Ga0075434_100026457 3300006871 Bacteria 5683
173 Ga0075434_100057028 3300006871 Bacteria 3882
174 Ga0075434_100071134 3300006871 Bacteria 3469
175 Ga0075434_100141573 3300006871 Bacteria 2425
176 Ga0075434_100327527 3300006871 Bacteria 1552
177 Ga0075434_100410237 3300006871 Bacteria 1376
178 Ga0075434_100963377 3300006871 Unclassified 867
179 Ga0075434_100980039 3300006871 Unclassified 859
180 Ga0075434_101189361 3300006871 Unclassified 774
181 Ga0075434_101377345 3300006871 Unclassified 715
182 Ga0075429_100004577 3300006880 Bacteria 11886
183 Ga0075429_100004773 3300006880 Bacteria 11673
184 Ga0075429_100011924 3300006880 Bacteria 7537
185 Ga0075429_100015172 3300006880 Bacteria 6678
186 Ga0075429_100027596 3300006880 Bacteria 4928
187 Ga0075429_100029359 3300006880 Bacteria 4777
188 Ga0075429_100285090 3300006880 Bacteria 1446
189 Ga0075429_100371018 3300006880 Bacteria 1253
190 Ga0075429_100566431 3300006880 Bacteria 995
191 Ga0075429_100756906 3300006880 Bacteria 851
192 Ga0068865_100146207 3300006881 Bacteria 1788
193 Ga0068865_100230520 3300006881 Bacteria 1453
194 Ga0068865_100386969 3300006881 Unclassified 1142
195 Ga0068865_100970553 3300006881 Unclassified 743
196 Ga0068865_101027834 3300006881 Bacteria 723
197 Ga0075436_100002456 3300006914 Bacteria 12751
198 Ga0075436_100033918 3300006914 Bacteria 3518
199 Ga0075436_100042970 3300006914 Bacteria 3116
200 Ga0075436_100054258 3300006914 Bacteria 2767
201 Ga0075436_100138315 3300006914 Bacteria 1711
202 Ga0075436_100590007 3300006914 Bacteria 818
203 Ga0075435_100005700 3300007076 Bacteria 8727
204 Ga0075435_100025025 3300007076 Bacteria 4641
205 Ga0075435_100028211 3300007076 Bacteria 4400
206 Ga0075435_100042041 3300007076 Bacteria 3655
207 Ga0075435_100098116 3300007076 Bacteria 2425
208 Ga0075435_100109091 3300007076 Bacteria 2300
209 Ga0075435_100134854 3300007076 Bacteria 2067
210 Ga0075435_100410483 3300007076 Unclassified 1165
211 Ga0075435_100582144 3300007076 Unclassified 970
212 Ga0099794_10004555 3300007265 Bacteria 5462
213 Ga0099794_10006006 3300007265 Bacteria 4901
214 Ga0111539_10006819 3300009094 Bacteria 14687
215 Ga0111539_10009263 3300009094 Bacteria 12441
216 Ga0111539_10031669 3300009094 Bacteria 6424
217 Ga0114129_10000042 3300009147 Bacteria 107385
218 Ga0114129_10003401 3300009147 Bacteria 22352
219 Ga0114129_10006751 3300009147 Bacteria 16294
220 Ga0114129_10007338 3300009147 Bacteria 15692
221 Ga0114129_10013154 3300009147 Bacteria 11791
222 Ga0114129_10022282 3300009147 Bacteria 8993
223 Ga0114129_10038257 3300009147 Bacteria 6769
224 Ga0114129_10096900 3300009147 Bacteria 4083
225 Ga0114129_10101266 3300009147 Bacteria 3986
226 Ga0114129_10250783 3300009147 Bacteria 2376
227 Ga0114129_10635293 3300009147 Unclassified 1379
228 Ga0114129_12029883 3300009147 Unclassified 695
229 Ga0105243_10018921 3300009148 Bacteria 5222
230 Ga0105241_10017267 3300009174 Bacteria 5301
231 Ga0105241_10026584 3300009174 Bacteria 4307
232 Ga0105242_10078292 3300009176 Unclassified 2759
233 Ga0105242_10415195 3300009176 Bacteria 1259
234 Ga0105242_10553745 3300009176 Unclassified 1103
235 Ga0105248_10063087 3300009177 Bacteria 4159
236 Ga0105248_10295803 3300009177 Bacteria 1823
237 Ga0105237_10917725 3300009545 Unclassified 883
238 Ga0105238_10740704 3300009551 Unclassified 996
239 Ga0105249_10074661 3300009553 Bacteria 3139
240 Ga0105249_10150685 3300009553 Bacteria 2239
241 Ga0105249_10157216 3300009553 Bacteria 2193
242 Ga0105249_11664399 3300009553 Bacteria 711
243 Ga0105239_10026489 3300010375 Bacteria 6380
244 Ga0157328_1012565 3300012478 Unclassified 616
245 Ga0157324_1011124 3300012506 Unclassified 774
246 Ga0157373_10650659 3300013100 Unclassified 770
247 Ga0157374_10219861 3300013296 Bacteria 1864
248 Ga0157378_10068138 3300013297 Bacteria 3190
249 Ga0157378_10149452 3300013297 Unclassified 2176
250 Ga0157372_10297859 3300013307 Bacteria 1876
251 Ga0157372_11388646 3300013307 Bacteria 810
252 Ga0157375_10117053 3300013308 Bacteria 2770
253 Ga0157375_11471185 3300013308 Unclassified 803
254 Ga0157375_12631317 3300013308 Unclassified 601
255 Ga0163163_10324492 3300014325 Bacteria 1593
256 Ga0163163_10735065 3300014325 Bacteria 1050
257 Ga0157380_10387218 3300014326 Bacteria 1322
258 Ga0157376_10132577 3300014969 Bacteria 2226
259 Ga0163161_10138356 3300017792 Bacteria 1842
260 Ga0207697_10010005 3300025315 Bacteria 4073
261 Ga0207697_10021653 3300025315 Bacteria 2632
262 Ga0207653_10352875 3300025885 Bacteria 574
263 Ga0207642_10284378 3300025899 Unclassified 952
264 Ga0207688_10014066 3300025901 Bacteria 4351
265 Ga0207645_10002135 3300025907 Bacteria 15800
266 Ga0207705_10296453 3300025909 Unclassified 1239
267 Ga0207684_10000546 3300025910 Bacteria 46386
268 Ga0207684_10003757 3300025910 Bacteria 14679
269 Ga0207684_10008118 3300025910 Bacteria 9360
270 Ga0207684_10152242 3300025910 Bacteria 1990
271 Ga0207684_10287314 3300025910 Bacteria 1418
272 Ga0207654_10013702 3300025911 Bacteria 4175
273 Ga0207654_10017607 3300025911 Bacteria 3739
274 Ga0207707_10066141 3300025912 Bacteria 3147
275 Ga0207707_10079397 3300025912 Bacteria 2865
276 Ga0207695_10744157 3300025913 Unclassified 861
277 Ga0207671_10553986 3300025914 Unclassified 917
278 Ga0207663_10768196 3300025916 Bacteria 766
279 Ga0207660_10007223 3300025917 Bacteria 7190
280 Ga0207657_10008121 3300025919 Bacteria 10703
281 Ga0207657_10528385 3300025919 Unclassified 923
282 Ga0207649_10347516 3300025920 Unclassified 1097
283 Ga0207652_10009685 3300025921 Bacteria 7751
284 Ga0207646_10001810 3300025922 Bacteria 25862
285 Ga0207646_10010158 3300025922 Bacteria 9225
286 Ga0207646_10034336 3300025922 Bacteria 4583
287 Ga0207681_10030697 3300025923 Bacteria 3505
288 Ga0207681_10386610 3300025923 Unclassified 1127
289 Ga0207681_10535323 3300025923 Unclassified 962
290 Ga0207650_11154955 3300025925 Unclassified 659
291 Ga0207644_10466142 3300025931 Unclassified 1039
292 Ga0207690_10417171 3300025932 Unclassified 1073
293 Ga0207690_10853352 3300025932 Bacteria 754
294 Ga0207706_10005843 3300025933 Bacteria 11441
295 Ga0207706_10129009 3300025933 Bacteria 2224
296 Ga0207686_10155782 3300025934 Unclassified 1596
297 Ga0207709_10044412 3300025935 Bacteria 2685
298 Ga0207670_10676719 3300025936 Unclassified 853
299 Ga0207670_10701385 3300025936 Unclassified 838
300 Ga0207704_11137573 3300025938 Unclassified 664
301 Ga0207665_10094981 3300025939 Bacteria 2071
302 Ga0207665_10312280 3300025939 Bacteria 1178
303 Ga0207691_10020252 3300025940 Bacteria 6289
304 Ga0207691_10111345 3300025940 Unclassified 2434
305 Ga0207711_10270553 3300025941 Bacteria 1563
306 Ga0207679_10027038 3300025945 Bacteria 3963
307 Ga0207679_10119614 3300025945 Bacteria 2094
308 Ga0207667_10512863 3300025949 Unclassified 1215
309 Ga0207651_10146252 3300025960 Bacteria 1833
310 Ga0207712_10281957 3300025961 Bacteria 1356
311 Ga0207712_10707016 3300025961 Unclassified 880
312 Ga0207712_11570106 3300025961 Unclassified 590
313 Ga0207658_10132257 3300025986 Bacteria 2006
314 Ga0207677_10175294 3300026023 Unclassified 1681
315 Ga0207639_10060524 3300026041 Bacteria 2921
316 Ga0207678_10007705 3300026067 Bacteria 9512
317 Ga0207678_11741197 3300026067 Unclassified 547
318 Ga0207708_10533852 3300026075 Unclassified 987
319 Ga0207702_10487295 3300026078 Bacteria 1200
320 Ga0207641_10063732 3300026088 Bacteria 3149
321 Ga0207648_10254373 3300026089 Bacteria 1566
322 Ga0207648_10848879 3300026089 Unclassified 852
323 Ga0207676_10842839 3300026095 Bacteria 896
324 Ga0207675_100026649 3300026118 Bacteria 5381
325 Ga0207683_10006875 3300026121 Bacteria 9743
326 Ga0209984_1041721 3300027424 Unclassified 662
327 Ga0209995_1015392 3300027471 Unclassified 1254
328 Ga0209982_1007253 3300027552 Bacteria 1620
329 Ga0209982_1069464 3300027552 Unclassified 576
330 Ga0209983_1008903 3300027665 Bacteria 2051
331 Ga0209983_1076409 3300027665 Unclassified 749
332 Ga0209588_1008963 3300027671 Bacteria 2978
333 Ga0209971_1030575 3300027682 Unclassified 1289
334 Ga0209966_1026131 3300027695 Bacteria 1162
335 Ga0209998_10013351 3300027717 Bacteria 1709
336 Ga0209974_10004408 3300027876 Bacteria 5007
337 Ga0209974_10027872 3300027876 Bacteria 1869
338 Ga0207428_10068901 3300027907 Bacteria 2782
339 Ga0268266_10621659 3300028379 Unclassified 1038
340 Ga0268265_10159065 3300028380 Bacteria 1916
341 Ga0268265_10525635 3300028380 Bacteria 1119
342 Ga0268265_12064454 3300028380 Unclassified 577
343 Ga0268264_10376695 3300028381 Bacteria 1358
344 Ga0268264_11456811 3300028381 Unclassified 695
345 Ga0307408_100007409 3300031548 Bacteria 7257
346 Ga0307408_100045322 3300031548 Bacteria 3140
347 Ga0307408_100170516 3300031548 Bacteria 1737
348 Ga0307405_10021556 3300031731 Bacteria 3624
349 Ga0307405_10036637 3300031731 Bacteria 2941
350 Ga0307410_10119901 3300031852 Bacteria 1917
351 Ga0307410_11466452 3300031852 Bacteria 600
352 Ga0307407_10194287 3300031903 Bacteria 1355
353 Ga0307407_10602412 3300031903 Bacteria 818
354 Ga0307412_10005134 3300031911 Bacteria 7334
355 Ga0307409_100056343 3300031995 Bacteria 3039
356 Ga0307416_100003263 3300032002 Bacteria 9495
357 Ga0307416_100422755 3300032002 Bacteria 1377
358 Ga0307414_11554157 3300032004 Bacteria 616
359 Ga0307411_10159270 3300032005 Bacteria 1688
360 Ga0307411_11830927 3300032005 Unclassified 564
361 Ga0307415_100137932 3300032126 Bacteria 1858
362 Ga0373950_0039970 3300034818 Bacteria 895
363 Ga0373958_0016400 3300034819 Bacteria 1320
364 Ga0373959_0130784 3300034820 Unclassified 621
365 Ga0373926_0015035 3300035083 Unclassified 2636
366 Ga0373940_0000462 3300035088 Bacteria 6249
367 Ga0373940_0027012 3300035088 Bacteria 1506
368 Ga0373940_0043958 3300035088 Unclassified 1236
369 Ga0373949_0005424 3300035090 Bacteria 2846
370 Ga0373951_0012880 3300035091 Bacteria 1880
371 Ga0373932_0006584 3300035112 Bacteria 2749
372 Ga0373939_0007161 3300035114 Bacteria 2704
373 Ga0373941_0237880 3300035115 Bacteria 706
374 Ga0373945_0574898 3300035116 Unclassified 507
375 Ga0373956_0377153 3300035119 Bacteria 676
376 Ga0373960_0200229 3300035121 Unclassified 705
377 Ga0373960_0350786 3300035121 Bacteria 559
378 Ga0373942_0050001 3300035207 Unclassified 1169
379 Ga0373962_0009329 3300035242 Bacteria 2430
380 Ga0373931_0017748 3300035691 Unclassified 3525
381 Ga0373947_0025354 3300035725 Unclassified 3458
382 Ga0373925_0045680 3300037068 Bacteria 3254
383 Ga0395899_0028945 3300037312 Bacteria 4169
384 Ga0395900_0062689 3300037418 Bacteria 3822
385 Ga0395905_0065729 3300037471 Bacteria 3396
386 Ga0395901_0226726 3300038443 Bacteria 1952
387 Ga0242420_019261 3300038996 Bacteria 1207
388 Ga0450923_177452 3300042125 Bacteria 524
389 Ga0439446_0034923 3300042156 Bacteria 1465
390 Ga0439434_0022425 3300042435 Bacteria 1898
391 Ga0451577_0269969 3300042876 Unclassified 1540
392 Ga0451577_0378186 3300042876 Bacteria 1285
393 Ga0453684_0234848 3300044712 Bacteria 2114
394 Ga0451576_0070858 3300045051 Bacteria 3628
395 Ga0451576_0170731 3300045051 Bacteria 2270
396 Ga0451576_0692389 3300045051 Unclassified 1071
397 Ga0495603_0288012 3300046455 Unclassified 944
398 Ga0495580_0983515 3300046472 Bacteria 539
399 Ga0495584_0433117 3300046491 Bacteria 669
400 Ga0495594_0308952 3300046499 Unclassified 901
401 Ga0495644_0198659 3300046523 Unclassified 773
402 Ga0495642_0299410 3300046528 Unclassified 705
403 Ga0495621_0143247 3300046539 Archaea 936
404 Ga0495621_0318298 3300046539 Bacteria 648
405 Ga0495633_0180420 3300046558 Bacteria 972
406 Ga0495659_0120627 3300046664 Bacteria 1032
407 Ga0495588_0385302 3300046674 Unclassified 736
408 Ga0495669_0008889 3300046684 Bacteria 4232
409 Ga0495669_0145686 3300046684 Unclassified 1119
410 Ga0495670_0133792 3300046691 Bacteria 1294
411 Ga0495581_0279645 3300047315 Unclassified 976
412 Ga0496101_0176713 3300048904 Bacteria 1643
413 Ga0496102_0401932 3300048905 Unclassified 1288
414 Ga0496103_0070813 3300048906 Unclassified 2182
415 Ga0496103_0607125 3300048906 Bacteria 697
416 Ga0496104_0296643 3300048907 Bacteria 1529
417 Ga0496106_0188443 3300048909 Unclassified 1639
418 Ga0496107_0430508 3300048910 Unclassified 981
419 Ga0496107_0476053 3300048910 Unclassified 927
420 Ga0496109_0190919 3300048912 Bacteria 1925
421 Ga0496112_0006528 3300048915 Bacteria 10257
422 Ga0496114_0100246 3300048917 Bacteria 2471
423 Ga0496114_0143912 3300048917 Bacteria 2066
424 Ga0496115_0498648 3300048918 Unclassified 979
425 Ga0501031_0016482 3300049568 Bacteria 4801
426 Ga0501032_0157892 3300049569 Viruses 1489
427 Ga0501032_0735766 3300049569 Bacteria 624
428 Ga0501032_0820297 3300049569 Unclassified 587
429 Ga0501033_0064442 3300049570 Bacteria 2697
430 Ga0501033_0067847 3300049570 Bacteria 2623
431 Ga0501033_0114658 3300049570 Unclassified 1959
432 Ga0501033_0421352 3300049570 Viruses 929
433 Ga0501034_0009597 3300049571 Bacteria 10125
434 Ga0501034_0105028 3300049571 Unclassified 2818
435 Ga0501036_0132685 3300049572 Bacteria 2102
436 Ga0501036_0134794 3300049572 Unclassified 2084
437 Ga0501036_0177060 3300049572 Bacteria 1796
438 Ga0501036_0216689 3300049572 Bacteria 1608
439 Ga0501036_0314094 3300049572 Bacteria 1310
440 Ga0501036_0582494 3300049572 Bacteria 929
441 Ga0501036_1468003 3300049572 Bacteria 552
442 Ga0501037_0038552 3300049573 Bacteria 3520
443 Ga0501037_0137579 3300049573 Bacteria 1749
444 Ga0501037_0172890 3300049573 Bacteria 1535
445 Ga0501037_0229127 3300049573 Bacteria 1305
446 Ga0501038_0001539 3300049574 Bacteria 21270
447 Ga0501038_0025651 3300049574 Bacteria 5251
448 Ga0501038_0045247 3300049574 Bacteria 3821
449 Ga0501038_0216419 3300049574 Bacteria 1530
450 Ga0501039_0001351 3300049575 Bacteria 17957
451 Ga0501039_0081165 3300049575 Bacteria 2524
452 Ga0501039_0093948 3300049575 Bacteria 2337
453 Ga0501039_0112284 3300049575 Bacteria 2131
454 Ga0501039_0158293 3300049575 Bacteria 1780
455 Ga0501039_0367622 3300049575 Bacteria 1130
456 Ga0501039_1518436 3300049575 Unclassified 515
457 Ga0501040_0002474 3300049576 Bacteria 11896
458 Ga0501040_0016770 3300049576 Bacteria 4856
459 Ga0501040_0029233 3300049576 Bacteria 3720
460 Ga0501040_0047473 3300049576 Bacteria 2932
461 Ga0501040_0110790 3300049576 Bacteria 1919
462 Ga0501040_0271303 3300049576 Bacteria 1211
463 Ga0501040_0293296 3300049576 Bacteria 1162
464 Ga0501040_1325668 3300049576 Unclassified 522
465 Ga0501041_0004419 3300049577 Bacteria 8131
466 Ga0501041_0004507 3300049577 Bacteria 8076
467 Ga0501041_0016103 3300049577 Bacteria 4441
468 Ga0501041_0031825 3300049577 Bacteria 3189
469 Ga0501041_0035075 3300049577 Bacteria 3039
470 Ga0501041_0065222 3300049577 Bacteria 2230
471 Ga0501041_0299947 3300049577 Unclassified 1012
472 Ga0501041_0339651 3300049577 Unclassified 948
473 Ga0501042_0003428 3300049578 Bacteria 9956
474 Ga0501042_0035164 3300049578 Bacteria 3554
475 Ga0501042_0048170 3300049578 Bacteria 3039
476 Ga0501042_0094254 3300049578 Bacteria 2150
477 Ga0501042_0161313 3300049578 Bacteria 1618
478 Ga0501042_0216127 3300049578 Bacteria 1383
479 Ga0501042_0897502 3300049578 Unclassified 645
480 Ga0501043_0398776 3300049579 Bacteria 1040
481 Ga0501043_1327279 3300049579 Bacteria 501
482 Ga0501046_0004318 3300049580 Bacteria 12937
483 Ga0501046_0056320 3300049580 Bacteria 3087
484 Ga0501046_0077274 3300049580 Bacteria 2578
485 Ga0501046_0095065 3300049580 Bacteria 2290
486 Ga0501048_0029854 3300049582 Bacteria 3948
487 Ga0501048_0047096 3300049582 Viruses 3076
488 Ga0501048_0111458 3300049582 Bacteria 1932
489 Ga0501048_0158918 3300049582 Bacteria 1599
490 Ga0501048_0182661 3300049582 Bacteria 1487
491 Ga0501048_0482283 3300049582 Unclassified 889
492 Ga0501067_0010544 3300049583 Bacteria 5118
493 Ga0501068_0005072 3300049584 Bacteria 7179
494 Ga0501068_0008284 3300049584 Bacteria 5777
495 Ga0501068_0013731 3300049584 Bacteria 4614
496 Ga0501068_0121117 3300049584 Bacteria 1631
497 Ga0501068_0334779 3300049584 Bacteria 972
498 Ga0501068_0499268 3300049584 Bacteria 789
499 Ga0501068_0867951 3300049584 Unclassified 593
500 Ga0501069_0010659 3300049585 Bacteria 4872
501 Ga0501069_0322027 3300049585 Bacteria 908
502 Ga0501070_0030706 3300049586 Bacteria 4501
503 Ga0501070_0036555 3300049586 Bacteria 4100
504 Ga0501070_0134553 3300049586 Bacteria 2041
505 Ga0501070_0169969 3300049586 Bacteria 1796
506 Ga0501070_0509923 3300049586 Bacteria 966
507 Ga0501071_0017350 3300049587 Bacteria 4962
508 Ga0501071_0024075 3300049587 Bacteria 4256
509 Ga0501071_0032278 3300049587 Bacteria 3717
510 Ga0501071_0156447 3300049587 Bacteria 1702
511 Ga0501071_0272399 3300049587 Bacteria 1280
512 Ga0501071_0422089 3300049587 Bacteria 1019
513 Ga0501071_0610242 3300049587 Unclassified 839
514 Ga0501072_0000634 3300049588 Bacteria 25170
515 Ga0501072_0004981 3300049588 Bacteria 10106
516 Ga0501072_0019188 3300049588 Bacteria 5283
517 Ga0501072_0046552 3300049588 Bacteria 3414
518 Ga0501072_0086103 3300049588 Bacteria 2494
519 Ga0501072_0116236 3300049588 Bacteria 2130
520 Ga0501072_0753278 3300049588 Unclassified 764
521 Ga0501072_0758121 3300049588 Unclassified 761
522 Ga0501072_1182419 3300049588 Unclassified 594
523 Ga0501073_0005650 3300049589 Bacteria 9357
524 Ga0501073_0020008 3300049589 Bacteria 4826
525 Ga0501073_0660997 3300049589 Unclassified 721
526 Ga0501074_0045257 3300049590 Bacteria 3184
527 Ga0501074_0058291 3300049590 Bacteria 2782
528 Ga0501074_0074761 3300049590 Bacteria 2433
529 Ga0501074_0174512 3300049590 Bacteria 1534
530 Ga0501074_0330922 3300049590 Bacteria 1081
531 Ga0501074_0833946 3300049590 Bacteria 649
532 Ga0501074_1122877 3300049590 Bacteria 552
533 Ga0501075_0000273 3300049591 Bacteria 28401
534 Ga0501075_0011783 3300049591 Bacteria 6198
535 Ga0501075_0014535 3300049591 Bacteria 5641
536 Ga0501075_0041079 3300049591 Bacteria 3466
537 Ga0501075_0064793 3300049591 Bacteria 2756
538 Ga0501075_0070679 3300049591 Viruses 2637
539 Ga0501075_0085396 3300049591 Bacteria 2391
540 Ga0501075_0134004 3300049591 Unclassified 1887
541 Ga0501075_0281504 3300049591 Bacteria 1267
542 Ga0501075_0284800 3300049591 Unclassified 1259
543 Ga0501075_0478996 3300049591 Unclassified 949
544 Ga0501075_0788420 3300049591 Unclassified 723
545 Ga0501076_0000533 3300049592 Bacteria 24272
546 Ga0501076_0001082 3300049592 Bacteria 17902
547 Ga0501076_0011985 3300049592 Bacteria 6477
548 Ga0501076_0029349 3300049592 Bacteria 4277
549 Ga0501076_0074869 3300049592 Bacteria 2713
550 Ga0501076_0240227 3300049592 Bacteria 1482
551 Ga0501076_0301732 3300049592 Unclassified 1313
552 Ga0501076_0436861 3300049592 Bacteria 1077
553 Ga0501077_0001092 3300049593 Bacteria 16358
554 Ga0501077_0005332 3300049593 Bacteria 7815
555 Ga0501077_0009728 3300049593 Bacteria 5977
556 Ga0501077_0031137 3300049593 Bacteria 3393
557 Ga0501077_0077122 3300049593 Unclassified 2111
558 Ga0501077_0114353 3300049593 Unclassified 1711
559 Ga0501077_0419337 3300049593 Bacteria 856
560 Ga0501077_0694502 3300049593 Unclassified 654
561 Ga0501235_066692 3300049669 Unclassified 848
562 Ga0501079_0000496 3300049741 Bacteria 25691
563 Ga0501079_0003087 3300049741 Bacteria 12194
564 Ga0501079_0020111 3300049741 Bacteria 5100
565 Ga0501079_0028874 3300049741 Bacteria 4257
566 Ga0501079_0050518 3300049741 Unclassified 3210
567 Ga0501079_0077639 3300049741 Bacteria 2568
568 Ga0501079_0167524 3300049741 Bacteria 1713
569 Ga0501079_0172779 3300049741 Bacteria 1685
570 Ga0501079_0254248 3300049741 Unclassified 1373
571 Ga0501079_0391797 3300049741 Bacteria 1089
572 Ga0501079_0448817 3300049741 Bacteria 1013
573 Ga0501080_0013689 3300049742 Bacteria 7469
574 Ga0501080_0016015 3300049742 Bacteria 6919
575 Ga0501080_0040587 3300049742 Bacteria 4340
576 Ga0501080_0057606 3300049742 Unclassified 3617
577 Ga0501080_0061461 3300049742 Bacteria 3497
578 Ga0501080_0078154 3300049742 Bacteria 3078
579 Ga0501080_0114559 3300049742 Bacteria 2499
580 Ga0501080_0163025 3300049742 Bacteria 2058
581 Ga0501080_0653775 3300049742 Bacteria 930
582 Ga0501080_1590287 3300049742 Bacteria 554
583 Ga0501081_0003599 3300049743 Bacteria 9914
584 Ga0501081_0003921 3300049743 Bacteria 9536
585 Ga0501081_0006925 3300049743 Bacteria 7367
586 Ga0501081_0020846 3300049743 Bacteria 4373
587 Ga0501081_0027548 3300049743 Unclassified 3832
588 Ga0501081_0050934 3300049743 Bacteria 2854
589 Ga0501081_0142912 3300049743 Viruses 1715
590 Ga0501081_0515349 3300049743 Bacteria 892
591 Ga0501081_1054421 3300049743 Unclassified 615
592 Ga0501083_0012421 3300049744 Bacteria 5958
593 Ga0501083_0020511 3300049744 Bacteria 4598
594 Ga0501083_0027304 3300049744 Bacteria 3940
595 Ga0501083_0229800 3300049744 Bacteria 1208
596 Ga0501035_0080754 3300049822 Bacteria 2871
597 Ga0501035_0102311 3300049822 Bacteria 2513
598 Ga0501035_0193166 3300049822 Unclassified 1749
599 Ga0501035_0365718 3300049822 Bacteria 1205
600 Ga0501035_0502606 3300049822 Unclassified 998
601 Ga0501035_1108171 3300049822 Bacteria 618
602 Ga0501044_0846067 3300049823 Bacteria 792
603 Ga0501045_0001118 3300049824 Bacteria 17716
604 Ga0501045_0019676 3300049824 Bacteria 4816
605 Ga0501045_0045182 3300049824 Bacteria 3208
606 Ga0501045_0105390 3300049824 Unclassified 2089
607 Ga0501045_0106794 3300049824 Bacteria 2075
608 nmdc:mga05p37_1075421_c1 3300050507 Unclassified 845
609 nmdc:mga05p37_12250_c1 3300050507 Bacteria 10241
610 nmdc:mga05p37_138480_c1 3300050507 Bacteria 2983
611 nmdc:mga05p37_147446_c1 3300050507 Bacteria 2880
612 nmdc:mga05p37_152001_c1 3300050507 Bacteria 2831
613 nmdc:mga05p37_222541_c1 3300050507 Bacteria 2277
614 nmdc:mga05p37_228525_c1 3300050507 Bacteria 2243
615 nmdc:mga05p37_27635_c1 3300050507 Bacteria 6911
616 nmdc:mga05p37_31015_c1 3300050507 Bacteria 6528
617 nmdc:mga05p37_319333_c1 3300050507 Unclassified 1839
618 nmdc:mga05p37_35769_c1 3300050507 Unclassified 2952
619 nmdc:mga05p37_47589_c1 3300050507 Bacteria 5274
620 nmdc:mga05p37_486040_c1 3300050507 Bacteria 1421
621 nmdc:mga05p37_5507_c1 3300050507 Bacteria 14871
622 nmdc:mga05p37_62909_c1 3300050507 Bacteria 4567
623 nmdc:mga05p37_65017_c1 3300050507 Bacteria 4283
624 nmdc:mga05p37_730_c1 3300050507 Bacteria 36492
625 nmdc:mga09592_11001_c1 3300050508 Bacteria 7359
626 nmdc:mga09592_118560_c1 3300050508 Bacteria 2272
627 nmdc:mga09592_177776_c1 3300050508 Unclassified 1841
628 nmdc:mga09592_22362_c1 3300050508 Bacteria 5217
629 nmdc:mga09592_332572_c1 3300050508 Unclassified 1315
630 nmdc:mga09592_357097_c1 3300050508 Bacteria 1265
631 nmdc:mga09592_38111_c1 3300050508 Bacteria 4034
632 nmdc:mga09592_46812_c1 3300050508 Bacteria 3644
633 nmdc:mga09592_4791_c1 3300050508 Bacteria 10962
634 nmdc:mga09592_895329_c1 3300050508 Bacteria 746
635 nmdc:mga0qj67_11125_c1 3300050509 Bacteria 6740
636 nmdc:mga0qj67_118390_c1 3300050509 Bacteria 2141
637 nmdc:mga0qj67_21112_c1 3300050509 Bacteria 4993
638 nmdc:mga0qj67_215740_c1 3300050509 Bacteria 1558
639 nmdc:mga0qj67_28468_c1 3300050509 Bacteria 4336
640 nmdc:mga0qj67_459997_c1 3300050509 Bacteria 1024
641 nmdc:mga0qj67_685454_c1 3300050509 Unclassified 816
642 nmdc:mga0qj67_6889_c1 3300050509 Bacteria 8361
643 nmdc:mga06r32_10130_c1 3300050510 Bacteria 8509
644 nmdc:mga06r32_1171575_c1 3300050510 Unclassified 716
645 nmdc:mga06r32_14246_c1 3300050510 Bacteria 7211
646 nmdc:mga06r32_239611_c1 3300050510 Bacteria 1802
647 nmdc:mga06r32_247584_c1 3300050510 Unclassified 1770
648 nmdc:mga06r32_275930_c1 3300050510 Bacteria 1668
649 nmdc:mga06r32_28140_c1 3300050510 Bacteria 5256
650 nmdc:mga06r32_28187_c1 3300050510 Bacteria 5252
651 nmdc:mga06r32_312913_c1 3300050510 Bacteria 1556
652 nmdc:mga06r32_34405_c1 3300050510 Bacteria 4777
653 nmdc:mga06r32_381636_c1 3300050510 Bacteria 1392
654 nmdc:mga06r32_515041_c1 3300050510 Bacteria 1172
655 nmdc:mga06r32_9803_c1 3300050510 Bacteria 8643
656 nmdc:mga08y16_15966_c1 3300050511 Bacteria 7894
657 nmdc:mga08y16_368324_c1 3300050511 Unclassified 1474
658 nmdc:mga08y16_44011_c1 3300050511 Bacteria 4678
659 nmdc:mga08y16_60972_c1 3300050511 Bacteria 3939
660 nmdc:mga08y16_677214_c1 3300050511 Unclassified 1033
661 nmdc:mga08y16_96133_c1 3300050511 Bacteria 3085
662 nmdc:mga0n895_11403_c1 3300050512 Bacteria 7930
663 nmdc:mga0n895_197355_c1 3300050512 Bacteria 2044
664 nmdc:mga0n895_2030883_c1 3300050512 Unclassified 532
665 nmdc:mga0n895_220_c1 3300050512 Bacteria 35971
666 nmdc:mga0n895_30449_c1 3300050512 Bacteria 5158
667 nmdc:mga0n895_3102_c1 3300050512 Bacteria 13235
668 nmdc:mga0n895_99154_c1 3300050512 Bacteria 2921
669 nmdc:mga0rr50_162037_c1 3300050513 Bacteria 1816
670 nmdc:mga0rr50_1764_c1 3300050513 Bacteria 11936
671 nmdc:mga0rr50_25246_c1 3300050513 Bacteria 4129
672 nmdc:mga0rr50_3313_c1 3300050513 Bacteria 9251
673 nmdc:mga0rr50_506622_c1 3300050513 Bacteria 1027
674 nmdc:mga0rr50_517907_c1 3300050513 Unclassified 1015
675 nmdc:mga0rr50_520325_c1 3300050513 Unclassified 1012
676 nmdc:mga0rr50_827840_c1 3300050513 Unclassified 790
677 nmdc:mga08x19_1043736_c1 3300050514 Unclassified 580
678 nmdc:mga08x19_127289_c1 3300050514 Unclassified 1711
679 nmdc:mga08x19_203929_c1 3300050514 Bacteria 1356
680 nmdc:mga08x19_207_c1 3300050514 Bacteria 45031
681 nmdc:mga08x19_328997_c1 3300050514 Unclassified 1064
682 nmdc:mga08x19_60699_c1 3300050514 Bacteria 2449
683 nmdc:mga08x19_60986_c1 3300050514 Bacteria 2444
684 nmdc:mga0a205_1358586_c1 3300050515 Unclassified 558
685 nmdc:mga0a205_143783_c1 3300050515 Bacteria 2285
686 nmdc:mga0a205_150314_c1 3300050515 Bacteria 2229
687 nmdc:mga0a205_1976_c1 3300050515 Bacteria 17858
688 nmdc:mga0a205_24678_c1 3300050515 Bacteria 4253
689 nmdc:mga0a205_27709_c1 3300050515 Bacteria 5411
690 nmdc:mga0a205_314257_c1 3300050515 Bacteria 1438
691 nmdc:mga0a205_37490_c1 3300050515 Bacteria 2225
692 nmdc:mga0a205_46506_c1 3300050515 Bacteria 4186
693 nmdc:mga0a205_55588_c1 3300050515 Bacteria 3823
694 nmdc:mga0a205_57473_c1 3300050515 Bacteria 3756
695 nmdc:mga0a205_65770_c1 3300050515 Bacteria 3504
696 nmdc:mga0a205_85882_c1 3300050515 Bacteria 3039
697 nmdc:mga0a205_904256_c1 3300050515 Unclassified 730
698 Ga0501084_0009156 3300054114 Bacteria 8191
699 Ga0501084_0012982 3300054114 Bacteria 6894
700 Ga0501084_0069630 3300054114 Bacteria 2945
701 Ga0501084_0073641 3300054114 Bacteria 2860
702 Ga0501084_0105681 3300054114 Bacteria 2365
703 Ga0501084_0204498 3300054114 Bacteria 1666
704 Ga0501084_0242849 3300054114 Bacteria 1520
705 Ga0590071_002005 3300059421 Bacteria 5211
706 Ga0590071_057936 3300059421 Bacteria 944
707 Ga0590075_087276 3300059424 Bacteria 809
708 Ga0501082_0013165 3300060353 Bacteria 7112
709 Ga0501082_0015822 3300060353 Bacteria 6487
710 Ga0501082_0018964 3300060353 Bacteria 5927
711 Ga0501082_0025859 3300060353 Bacteria 5060
712 Ga0501082_0033182 3300060353 Bacteria 4453
713 Ga0501082_0049673 3300060353 Bacteria 3618
714 Ga0501082_0068547 3300060353 Bacteria 3054
715 Ga0501082_0126746 3300060353 Bacteria 2214
716 Ga0501082_0202517 3300060353 Bacteria 1727
717 Ga0501082_0371811 3300060353 Unclassified 1247
718 Ga0501082_1306625 3300060353 Bacteria 634
719 Ga0530510_0001815 3300061734 Bacteria 14560
720 Ga0530510_0006938 3300061734 Bacteria 7895
721 Ga0530510_0010794 3300061734 Bacteria 6409
722 Ga0530510_0023603 3300061734 Bacteria 4384
723 Ga0530510_0156852 3300061734 Bacteria 1683
724 Ga0530510_0366571 3300061734 Unclassified 1083
725 Ga0530510_0642929 3300061734 Unclassified 807
726 Ga0207706_10122757
727 rootL2_10356550
728 Ga0058862_12690600
729 Ga0065712_10004747
730 Ga0065712_10069486
731 Ga0065715_10091128
732 Ga0065707_10020350
733 Ga0065707_10140972
734 Ga0065707_10148360
735 Ga0065707_10196840
736 Ga0065707_10366270
737 Ga0065707_10948388
738 Ga0070683_100545149
739 Ga0070690_100007878
740 Ga0070670_100001766
741 Ga0070677_10314736
742 Ga0070666_10014437
743 Ga0070680_100011527
744 Ga0070682_100147288
745 Ga0068868_100154639
746 Ga0070660_100012240
747 Ga0070691_10061433
748 Ga0070661_100005812
749 Ga0070692_10283612
750 Ga0070668_100856912
751 Ga0070669_100015077
752 Ga0070669_100067062
753 Ga0070675_100102532
754 Ga0070671_100318817
755 Ga0070671_100377159
756 Ga0070674_100041440
757 Ga0070674_100278508
758 Ga0070673_100158758
759 Ga0070659_100071414
760 Ga0070659_100855809
761 Ga0070667_100023120
762 Ga0070703_10513771
763 Ga0070713_100406565
764 Ga0070711_100252001
765 Ga0070711_101121687
766 Ga0070705_100008284
767 Ga0070705_100071958
768 Ga0070705_100124898
769 Ga0070700_100280908
770 Ga0070694_100007759
771 Ga0070694_100165880
772 Ga0070694_100189987
773 Ga0070708_100000602
774 Ga0070708_100137141
775 Ga0070708_100338436
776 Ga0070708_100748514
777 Ga0070663_100066464
778 Ga0070663_101091905
779 Ga0070678_100011100
780 Ga0070662_100151289
781 Ga0070662_100260071
782 Ga0070681_10052880
783 Ga0070681_10454251
784 Ga0068867_100412196
785 Ga0068867_100700010
786 Ga0068867_101415388
787 Ga0070706_100015188
788 Ga0070706_100034961
789 Ga0070706_100697241
790 Ga0070707_100003325
791 Ga0070707_100062028
792 Ga0070698_100186685
793 Ga0070698_100300682
794 Ga0070698_100636058
795 Ga0070699_100004312
796 Ga0070699_100038120
797 Ga0070699_100040908
798 Ga0070699_100129976
799 Ga0070679_100038097
800 Ga0070697_100007393
801 Ga0070697_100009950
802 Ga0070697_100218176
803 Ga0070697_100282165
804 Ga0070697_100410454
805 Ga0070672_100045864
806 Ga0070672_100213496
807 Ga0070672_100705230
808 Ga0070672_101760043
809 Ga0070686_100730828
810 Ga0070695_100013227
811 Ga0070695_100674578
812 Ga0070696_100009505
813 Ga0070696_100020304
814 Ga0070696_100104051
815 Ga0070696_100160545
816 Ga0070696_100355704
817 Ga0070696_100509825
818 Ga0070696_101685168
819 Ga0070693_100111002
820 Ga0070693_100309303
821 Ga0070665_100304150
822 Ga0070704_100143263
823 Ga0070704_100272043
824 Ga0068855_100219544
825 Ga0070664_100033682
826 Ga0070702_100069315
827 Ga0068864_100534185
828 Ga0068861_100737950
829 Ga0068861_101076976
830 Ga0068863_100007993
831 Ga0068863_100372288
832 Ga0068860_100012812
833 Ga0068860_100191681
834 Ga0068860_100406155
835 Ga0068860_100755602
836 Ga0068862_100052481
837 Ga0068862_100949987
838 Ga0068862_100996631
839 Ga0081455_10009226
840 Ga0081455_10077726
841 Ga0081455_10164918
842 Ga0081538_10009006
843 Ga0081538_10274969
844 Ga0081540_1012974
845 Ga0081539_10001912
846 Ga0070715_10112765
847 Ga0070715_11008890
848 Ga0070716_100091232
849 Ga0070716_100630947
850 Ga0068871_100076313
851 Ga0075428_100002587
852 Ga0075428_100015920
853 Ga0075428_100024084
854 Ga0075428_100043178
855 Ga0075428_100093244
856 Ga0075428_100171354
857 Ga0075428_100232127
858 Ga0075428_100555955
859 Ga0075428_100688494
860 Ga0075428_101304865
861 Ga0075430_100004545
862 Ga0075430_100027551
863 Ga0075430_100067775
864 Ga0075430_100116775
865 Ga0075430_100127480
866 Ga0075430_100195424
867 Ga0075430_100326325
868 Ga0075430_100383297
869 Ga0075430_100506950
870 Ga0075431_100013329
871 Ga0075431_100017994
872 Ga0075431_100022315
873 Ga0075431_100091971
874 Ga0075431_100097607
875 Ga0075431_100173397
876 Ga0075431_100273404
877 Ga0075431_100335979
878 Ga0075431_100357399
879 Ga0075431_100434527
880 Ga0075431_100836083
881 Ga0075431_100988657
882 Ga0075433_10001832
883 Ga0075433_10003217
884 Ga0075433_10030968
885 Ga0075433_10047905
886 Ga0075433_10054362
887 Ga0075433_10091967
888 Ga0075433_10113404
889 Ga0075433_10161549
890 Ga0075433_10167234
891 Ga0075433_10181126
892 Ga0075433_10241522
893 Ga0075433_10344034
894 Ga0075433_10858008
895 Ga0075433_10860406
896 Ga0075434_100023778
897 Ga0075434_100026457
898 Ga0075434_100057028
899 Ga0075434_100071134
900 Ga0075434_100141573
901 Ga0075434_100327527
902 Ga0075434_100410237
903 Ga0075434_100963377
904 Ga0075434_100980039
905 Ga0075434_101189361
906 Ga0075434_101377345
907 Ga0075429_100004577
908 Ga0075429_100004773
909 Ga0075429_100011924
910 Ga0075429_100015172
911 Ga0075429_100027596
912 Ga0075429_100029359
913 Ga0075429_100285090
914 Ga0075429_100371018
915 Ga0075429_100566431
916 Ga0075429_100756906
917 Ga0068865_100146207
918 Ga0068865_100230520
919 Ga0068865_100386969
920 Ga0068865_100970553
921 Ga0068865_101027834
922 Ga0075436_100002456
923 Ga0075436_100033918
924 Ga0075436_100042970
925 Ga0075436_100054258
926 Ga0075436_100138315
927 Ga0075436_100590007
928 Ga0075435_100005700
929 Ga0075435_100025025
930 Ga0075435_100028211
931 Ga0075435_100042041
932 Ga0075435_100098116
933 Ga0075435_100109091
934 Ga0075435_100134854
935 Ga0075435_100410483
936 Ga0075435_100582144
937 Ga0099794_10004555
938 Ga0099794_10006006
939 Ga0111539_10006819
940 Ga0111539_10009263
941 Ga0111539_10031669
942 Ga0114129_10000042
943 Ga0114129_10003401
944 Ga0114129_10006751
945 Ga0114129_10007338
946 Ga0114129_10013154
947 Ga0114129_10022282
948 Ga0114129_10038257
949 Ga0114129_10096900
950 Ga0114129_10101266
951 Ga0114129_10250783
952 Ga0114129_10635293
953 Ga0114129_12029883
954 Ga0105243_10018921
955 Ga0105241_10017267
956 Ga0105241_10026584
957 Ga0105242_10078292
958 Ga0105242_10415195
959 Ga0105242_10553745
960 Ga0105248_10063087
961 Ga0105248_10295803
962 Ga0105237_10917725
963 Ga0105238_10740704
964 Ga0105249_10074661
965 Ga0105249_10150685
966 Ga0105249_10157216
967 Ga0105249_11664399
968 Ga0105239_10026489
969 Ga0157328_1012565
970 Ga0157324_1011124
971 Ga0157373_10650659
972 Ga0157374_10219861
973 Ga0157378_10068138
974 Ga0157378_10149452
975 Ga0157372_10297859
976 Ga0157372_11388646
977 Ga0157375_10117053
978 Ga0157375_11471185
979 Ga0157375_12631317
980 Ga0163163_10324492
981 Ga0163163_10735065
982 Ga0157380_10387218
983 Ga0157376_10132577
984 Ga0163161_10138356
985 Ga0207697_10010005
986 Ga0207697_10021653
987 Ga0207653_10352875
988 Ga0207642_10284378
989 Ga0207688_10014066
990 Ga0207645_10002135
991 Ga0207705_10296453
992 Ga0207684_10000546
993 Ga0207684_10003757
994 Ga0207684_10008118
995 Ga0207684_10152242
996 Ga0207684_10287314
997 Ga0207654_10013702
998 Ga0207654_10017607
999 Ga0207707_10066141
1000 Ga0207707_10079397
1001 Ga0207695_10744157
1002 Ga0207671_10553986
1003 Ga0207663_10768196
1004 Ga0207660_10007223
1005 Ga0207657_10008121
1006 Ga0207657_10528385
1007 Ga0207649_10347516
1008 Ga0207652_10009685
1009 Ga0207646_10001810
1010 Ga0207646_10010158
1011 Ga0207646_10034336
1012 Ga0207681_10030697
1013 Ga0207681_10386610
1014 Ga0207681_10535323
1015 Ga0207650_11154955
1016 Ga0207644_10466142
1017 Ga0207690_10417171
1018 Ga0207690_10853352
1019 Ga0207706_10005843
1020 Ga0207706_10129009
1021 Ga0207686_10155782
1022 Ga0207709_10044412
1023 Ga0207670_10676719
1024 Ga0207670_10701385
1025 Ga0207704_11137573
1026 Ga0207665_10094981
1027 Ga0207665_10312280
1028 Ga0207691_10020252
1029 Ga0207691_10111345
1030 Ga0207711_10270553
1031 Ga0207679_10027038
1032 Ga0207679_10119614
1033 Ga0207667_10512863
1034 Ga0207651_10146252
1035 Ga0207712_10281957
1036 Ga0207712_10707016
1037 Ga0207712_11570106
1038 Ga0207658_10132257
1039 Ga0207677_10175294
1040 Ga0207639_10060524
1041 Ga0207678_10007705
1042 Ga0207678_11741197
1043 Ga0207708_10533852
1044 Ga0207702_10487295
1045 Ga0207641_10063732
1046 Ga0207648_10254373
1047 Ga0207648_10848879
1048 Ga0207676_10842839
1049 Ga0207675_100026649
1050 Ga0207683_10006875
1051 Ga0209984_1041721
1052 Ga0209995_1015392
1053 Ga0209982_1007253
1054 Ga0209982_1069464
1055 Ga0209983_1008903
1056 Ga0209983_1076409
1057 Ga0209588_1008963
1058 Ga0209971_1030575
1059 Ga0209966_1026131
1060 Ga0209998_10013351
1061 Ga0209974_10004408
1062 Ga0209974_10027872
1063 Ga0207428_10068901
1064 Ga0268266_10621659
1065 Ga0268265_10159065
1066 Ga0268265_10525635
1067 Ga0268265_12064454
1068 Ga0268264_10376695
1069 Ga0268264_11456811
1070 Ga0307408_100007409
1071 Ga0307408_100045322
1072 Ga0307408_100170516
1073 Ga0307405_10021556
1074 Ga0307405_10036637
1075 Ga0307410_10119901
1076 Ga0307410_11466452
1077 Ga0307407_10194287
1078 Ga0307407_10602412
1079 Ga0307412_10005134
1080 Ga0307409_100056343
1081 Ga0307416_100003263
1082 Ga0307416_100422755
1083 Ga0307414_11554157
1084 Ga0307411_10159270
1085 Ga0307411_11830927
1086 Ga0307415_100137932
1087 Ga0373950_0039970
1088 Ga0373958_0016400
1089 Ga0373959_0130784
1090 Ga0373926_0015035
1091 Ga0373940_0000462
1092 Ga0373940_0027012
1093 Ga0373940_0043958
1094 Ga0373949_0005424
1095 Ga0373951_0012880
1096 Ga0373932_0006584
1097 Ga0373939_0007161
1098 Ga0373941_0237880
1099 Ga0373945_0574898
1100 Ga0373956_0377153
1101 Ga0373960_0200229
1102 Ga0373960_0350786
1103 Ga0373942_0050001
1104 Ga0373962_0009329
1105 Ga0373931_0017748
1106 Ga0373947_0025354
1107 Ga0373925_0045680
1108 Ga0395899_0028945
1109 Ga0395900_0062689
1110 Ga0395905_0065729
1111 Ga0395901_0226726
1112 Ga0242420_019261
1113 Ga0450923_177452
1114 Ga0439446_0034923
1115 Ga0439434_0022425
1116 Ga0451577_0269969
1117 Ga0451577_0378186
1118 Ga0453684_0234848
1119 Ga0451576_0070858
1120 Ga0451576_0170731
1121 Ga0451576_0692389
1122 Ga0495603_0288012
1123 Ga0495580_0983515
1124 Ga0495584_0433117
1125 Ga0495594_0308952
1126 Ga0495644_0198659
1127 Ga0495642_0299410
1128 Ga0495621_0143247
1129 Ga0495621_0318298
1130 Ga0495633_0180420
1131 Ga0495659_0120627
1132 Ga0495588_0385302
1133 Ga0495669_0008889
1134 Ga0495669_0145686
1135 Ga0495670_0133792
1136 Ga0495581_0279645
1137 Ga0496101_0176713
1138 Ga0496102_0401932
1139 Ga0496103_0070813
1140 Ga0496103_0607125
1141 Ga0496104_0296643
1142 Ga0496106_0188443
1143 Ga0496107_0430508
1144 Ga0496107_0476053
1145 Ga0496109_0190919
1146 Ga0496112_0006528
1147 Ga0496114_0100246
1148 Ga0496114_0143912
1149 Ga0496115_0498648
1150 Ga0501031_0016482
1151 Ga0501032_0157892
1152 Ga0501032_0735766
1153 Ga0501032_0820297
1154 Ga0501033_0064442
1155 Ga0501033_0067847
1156 Ga0501033_0114658
1157 Ga0501033_0421352
1158 Ga0501034_0009597
1159 Ga0501034_0105028
1160 Ga0501036_0132685
1161 Ga0501036_0134794
1162 Ga0501036_0177060
1163 Ga0501036_0216689
1164 Ga0501036_0314094
1165 Ga0501036_0582494
1166 Ga0501036_1468003
1167 Ga0501037_0038552
1168 Ga0501037_0137579
1169 Ga0501037_0172890
1170 Ga0501037_0229127
1171 Ga0501038_0001539
1172 Ga0501038_0025651
1173 Ga0501038_0045247
1174 Ga0501038_0216419
1175 Ga0501039_0001351
1176 Ga0501039_0081165
1177 Ga0501039_0093948
1178 Ga0501039_0112284
1179 Ga0501039_0158293
1180 Ga0501039_0367622
1181 Ga0501039_1518436
1182 Ga0501040_0002474
1183 Ga0501040_0016770
1184 Ga0501040_0029233
1185 Ga0501040_0047473
1186 Ga0501040_0110790
1187 Ga0501040_0271303
1188 Ga0501040_0293296
1189 Ga0501040_1325668
1190 Ga0501041_0004419
1191 Ga0501041_0004507
1192 Ga0501041_0016103
1193 Ga0501041_0031825
1194 Ga0501041_0035075
1195 Ga0501041_0065222
1196 Ga0501041_0299947
1197 Ga0501041_0339651
1198 Ga0501042_0003428
1199 Ga0501042_0035164
1200 Ga0501042_0048170
1201 Ga0501042_0094254
1202 Ga0501042_0161313
1203 Ga0501042_0216127
1204 Ga0501042_0897502
1205 Ga0501043_0398776
1206 Ga0501043_1327279
1207 Ga0501046_0004318
1208 Ga0501046_0056320
1209 Ga0501046_0077274
1210 Ga0501046_0095065
1211 Ga0501048_0029854
1212 Ga0501048_0047096
1213 Ga0501048_0111458
1214 Ga0501048_0158918
1215 Ga0501048_0182661
1216 Ga0501048_0482283
1217 Ga0501067_0010544
1218 Ga0501068_0005072
1219 Ga0501068_0008284
1220 Ga0501068_0013731
1221 Ga0501068_0121117
1222 Ga0501068_0334779
1223 Ga0501068_0499268
1224 Ga0501068_0867951
1225 Ga0501069_0010659
1226 Ga0501069_0322027
1227 Ga0501070_0030706
1228 Ga0501070_0036555
1229 Ga0501070_0134553
1230 Ga0501070_0169969
1231 Ga0501070_0509923
1232 Ga0501071_0017350
1233 Ga0501071_0024075
1234 Ga0501071_0032278
1235 Ga0501071_0156447
1236 Ga0501071_0272399
1237 Ga0501071_0422089
1238 Ga0501071_0610242
1239 Ga0501072_0000634
1240 Ga0501072_0004981
1241 Ga0501072_0019188
1242 Ga0501072_0046552
1243 Ga0501072_0086103
1244 Ga0501072_0116236
1245 Ga0501072_0753278
1246 Ga0501072_0758121
1247 Ga0501072_1182419
1248 Ga0501073_0005650
1249 Ga0501073_0020008
1250 Ga0501073_0660997
1251 Ga0501074_0045257
1252 Ga0501074_0058291
1253 Ga0501074_0074761
1254 Ga0501074_0174512
1255 Ga0501074_0330922
1256 Ga0501074_0833946
1257 Ga0501074_1122877
1258 Ga0501075_0000273
1259 Ga0501075_0011783
1260 Ga0501075_0014535
1261 Ga0501075_0041079
1262 Ga0501075_0064793
1263 Ga0501075_0070679
1264 Ga0501075_0085396
1265 Ga0501075_0134004
1266 Ga0501075_0281504
1267 Ga0501075_0284800
1268 Ga0501075_0478996
1269 Ga0501075_0788420
1270 Ga0501076_0000533
1271 Ga0501076_0001082
1272 Ga0501076_0011985
1273 Ga0501076_0029349
1274 Ga0501076_0074869
1275 Ga0501076_0240227
1276 Ga0501076_0301732
1277 Ga0501076_0436861
1278 Ga0501077_0001092
1279 Ga0501077_0005332
1280 Ga0501077_0009728
1281 Ga0501077_0031137
1282 Ga0501077_0077122
1283 Ga0501077_0114353
1284 Ga0501077_0419337
1285 Ga0501077_0694502
1286 Ga0501235_066692
1287 Ga0501079_0000496
1288 Ga0501079_0003087
1289 Ga0501079_0020111
1290 Ga0501079_0028874
1291 Ga0501079_0050518
1292 Ga0501079_0077639
1293 Ga0501079_0167524
1294 Ga0501079_0172779
1295 Ga0501079_0254248
1296 Ga0501079_0391797
1297 Ga0501079_0448817
1298 Ga0501080_0013689
1299 Ga0501080_0016015
1300 Ga0501080_0040587
1301 Ga0501080_0057606
1302 Ga0501080_0061461
1303 Ga0501080_0078154
1304 Ga0501080_0114559
1305 Ga0501080_0163025
1306 Ga0501080_0653775
1307 Ga0501080_1590287
1308 Ga0501081_0003599
1309 Ga0501081_0003921
1310 Ga0501081_0006925
1311 Ga0501081_0020846
1312 Ga0501081_0027548
1313 Ga0501081_0050934
1314 Ga0501081_0142912
1315 Ga0501081_0515349
1316 Ga0501081_1054421
1317 Ga0501083_0012421
1318 Ga0501083_0020511
1319 Ga0501083_0027304
1320 Ga0501083_0229800
1321 Ga0501035_0080754
1322 Ga0501035_0102311
1323 Ga0501035_0193166
1324 Ga0501035_0365718
1325 Ga0501035_0502606
1326 Ga0501035_1108171
1327 Ga0501044_0846067
1328 Ga0501045_0001118
1329 Ga0501045_0019676
1330 Ga0501045_0045182
1331 Ga0501045_0105390
1332 Ga0501045_0106794
1333 nmdc:mga05p37_1075421_c1
1334 nmdc:mga05p37_12250_c1
1335 nmdc:mga05p37_138480_c1
1336 nmdc:mga05p37_147446_c1
1337 nmdc:mga05p37_152001_c1
1338 nmdc:mga05p37_222541_c1
1339 nmdc:mga05p37_228525_c1
1340 nmdc:mga05p37_27635_c1
1341 nmdc:mga05p37_31015_c1
1342 nmdc:mga05p37_319333_c1
1343 nmdc:mga05p37_35769_c1
1344 nmdc:mga05p37_47589_c1
1345 nmdc:mga05p37_486040_c1
1346 nmdc:mga05p37_5507_c1
1347 nmdc:mga05p37_62909_c1
1348 nmdc:mga05p37_65017_c1
1349 nmdc:mga05p37_730_c1
1350 nmdc:mga09592_11001_c1
1351 nmdc:mga09592_118560_c1
1352 nmdc:mga09592_177776_c1
1353 nmdc:mga09592_22362_c1
1354 nmdc:mga09592_332572_c1
1355 nmdc:mga09592_357097_c1
1356 nmdc:mga09592_38111_c1
1357 nmdc:mga09592_46812_c1
1358 nmdc:mga09592_4791_c1
1359 nmdc:mga09592_895329_c1
1360 nmdc:mga0qj67_11125_c1
1361 nmdc:mga0qj67_118390_c1
1362 nmdc:mga0qj67_21112_c1
1363 nmdc:mga0qj67_215740_c1
1364 nmdc:mga0qj67_28468_c1
1365 nmdc:mga0qj67_459997_c1
1366 nmdc:mga0qj67_685454_c1
1367 nmdc:mga0qj67_6889_c1
1368 nmdc:mga06r32_10130_c1
1369 nmdc:mga06r32_1171575_c1
1370 nmdc:mga06r32_14246_c1
1371 nmdc:mga06r32_239611_c1
1372 nmdc:mga06r32_247584_c1
1373 nmdc:mga06r32_275930_c1
1374 nmdc:mga06r32_28140_c1
1375 nmdc:mga06r32_28187_c1
1376 nmdc:mga06r32_312913_c1
1377 nmdc:mga06r32_34405_c1
1378 nmdc:mga06r32_381636_c1
1379 nmdc:mga06r32_515041_c1
1380 nmdc:mga06r32_9803_c1
1381 nmdc:mga08y16_15966_c1
1382 nmdc:mga08y16_368324_c1
1383 nmdc:mga08y16_44011_c1
1384 nmdc:mga08y16_60972_c1
1385 nmdc:mga08y16_677214_c1
1386 nmdc:mga08y16_96133_c1
1387 nmdc:mga0n895_11403_c1
1388 nmdc:mga0n895_197355_c1
1389 nmdc:mga0n895_2030883_c1
1390 nmdc:mga0n895_220_c1
1391 nmdc:mga0n895_30449_c1
1392 nmdc:mga0n895_3102_c1
1393 nmdc:mga0n895_99154_c1
1394 nmdc:mga0rr50_162037_c1
1395 nmdc:mga0rr50_1764_c1
1396 nmdc:mga0rr50_25246_c1
1397 nmdc:mga0rr50_3313_c1
1398 nmdc:mga0rr50_506622_c1
1399 nmdc:mga0rr50_517907_c1
1400 nmdc:mga0rr50_520325_c1
1401 nmdc:mga0rr50_827840_c1
1402 nmdc:mga08x19_1043736_c1
1403 nmdc:mga08x19_127289_c1
1404 nmdc:mga08x19_203929_c1
1405 nmdc:mga08x19_207_c1
1406 nmdc:mga08x19_328997_c1
1407 nmdc:mga08x19_60699_c1
1408 nmdc:mga08x19_60986_c1
1409 nmdc:mga0a205_1358586_c1
1410 nmdc:mga0a205_143783_c1
1411 nmdc:mga0a205_150314_c1
1412 nmdc:mga0a205_1976_c1
1413 nmdc:mga0a205_24678_c1
1414 nmdc:mga0a205_27709_c1
1415 nmdc:mga0a205_314257_c1
1416 nmdc:mga0a205_37490_c1
1417 nmdc:mga0a205_46506_c1
1418 nmdc:mga0a205_55588_c1
1419 nmdc:mga0a205_57473_c1
1420 nmdc:mga0a205_65770_c1
1421 nmdc:mga0a205_85882_c1
1422 nmdc:mga0a205_904256_c1
1423 Ga0501084_0009156
1424 Ga0501084_0012982
1425 Ga0501084_0069630
1426 Ga0501084_0073641
1427 Ga0501084_0105681
1428 Ga0501084_0204498
1429 Ga0501084_0242849
1430 Ga0590071_002005
1431 Ga0590071_057936
1432 Ga0590075_087276
1433 Ga0501082_0013165
1434 Ga0501082_0015822
1435 Ga0501082_0018964
1436 Ga0501082_0025859
1437 Ga0501082_0033182
1438 Ga0501082_0049673
1439 Ga0501082_0068547
1440 Ga0501082_0126746
1441 Ga0501082_0202517
1442 Ga0501082_0371811
1443 Ga0501082_1306625
1444 Ga0530510_0001815
1445 Ga0530510_0006938
1446 Ga0530510_0010794
1447 Ga0530510_0023603
1448 Ga0530510_0156852
1449 Ga0530510_0366571
1450 Ga0530510_0642929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01880

Desulfoferrodox

Desulfoferrodoxin

58

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4brv-assembly1.cif.gz_D superoxide reductase (neelaredoxin) from ignicoccus hospitalis e23a 0.8745 50 147
4bk8-assembly1.cif.gz_A superoxide reductase (neelaredoxin) from ignicoccus hospitalis 0.8666 52 147
3gm8-assembly1.cif.gz_A crystal structure of a beta-glycosidase from bacteroides vulgatus 0.8335 51 145
2nnc-assembly1.cif.gz_B structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8287 54 146
2oxh-assembly1.cif.gz_Z the soxyz complex of paracoccus pantotrophus 0.8273 51 146
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8215 54 147 2.60.40.10
6gq8B00 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8036 43 144 2.60.40.730
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.7962 38 147 2.60.40.730
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.793 38 148 2.60.40.2470
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.7762 38 147 2.60.40.730
ID Description Score Start End GO Terms
AF-A0A1Q7SR25-F1-model_v4 Desulfoferrodoxin ferrous iron-binding domain-containing protein 0.9388 44 148 GO:0005506
GO:0016491
AF-A0A1Q7SR25-F1-model_v4 Desulfoferrodoxin ferrous iron-binding domain-containing protein 0.9302 44 148 GO:0005506
GO:0016491
AF-A0A2R6T4Z8-F1-model_v4 Desulfoferrodoxin ferrous iron-binding domain-containing protein 0.926 51 147 GO:0005506
GO:0016491
AF-A0A133UD49-F1-model_v4 Desulfoferrodoxin ferrous iron-binding domain-containing protein 0.9244 51 147 GO:0005506
GO:0016491
AF-A0A7C6NG28-F1-model_v4 Desulfoferrodoxin 0.924 50 148 GO:0005506
GO:0016491

Map