F477389

General Info

Members Datasets Scaffolds Average Seq Length
721 380 1442 143

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_72491_c1|nmdc:mga06r32_72491_c1_1151_1684
Length 177
Sequence MHVAQGIDSGEDESRYDTAKRTSFTLHSAMSSTHSLKESGLKATLPRRKILELFETSKVRHLSAEDVYRKLIAEGIDIGLATVYRVLTQFEHAGLLARQHFEAGKAVFELSQGGHHDHLVCLQCGRVEEFYDAEIEQRQSTVAKERGFELHGHSLALYADCRKPDCPNRAAIRPRNS

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
207 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
245 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
246 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
247 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
248 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
249 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
250 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
253 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
254 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
257 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
288 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
313 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
314 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
315 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
316 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
317 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
343 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
344 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
345 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
346 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
347 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
348 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
349 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
350 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
355 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
361 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
362 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
369 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
370 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
371 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
372 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
373 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
374 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
377 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
380 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 0.28
Rhizosphere 95.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_72491_c1 3300050510 Bacteria 3334
2 JGI24740J21852_10002395 3300001979 Bacteria 8530
3 JGI24742J22300_10050067 3300002244 Bacteria 755
4 JGI25156J39149_1006025 3300002705 Bacteria 3381
5 JGI25154J39366_1000508 3300002738 Bacteria 19845
6 JGI25406J46586_10074336 3300003203 Bacteria 1058
7 rootH1_10192677 3300003323 Bacteria 1877
8 Ga0055532_1000008 3300003758 Bacteria 404753
9 Ga0055525_1000500 3300003759 Bacteria 19694
10 Ga0055535_1000006 3300003761 Bacteria 404753
11 Ga0055542_1001574 3300003762 Bacteria 10636
12 Ga0055529_1000025 3300003763 Bacteria 304757
13 Ga0065707_10111688 3300005295 Bacteria 2386
14 Ga0070676_10555033 3300005328 Bacteria 823
15 Ga0070690_100001215 3300005330 Bacteria 13318
16 Ga0070690_100267405 3300005330 Bacteria 1215
17 Ga0068869_100001868 3300005334 Bacteria 12654
18 Ga0068869_100071372 3300005334 Bacteria 2571
19 Ga0070666_10048428 3300005335 Bacteria 2856
20 Ga0070680_100044374 3300005336 Bacteria 3613
21 Ga0070680_100267248 3300005336 Bacteria 1448
22 Ga0070680_100274894 3300005336 Bacteria 1426
23 Ga0070682_100055357 3300005337 Bacteria 2491
24 Ga0068868_100001854 3300005338 Bacteria 14501
25 Ga0068868_100276626 3300005338 Bacteria 1420
26 Ga0070689_100001994 3300005340 Bacteria 13227
27 Ga0070689_100024064 3300005340 Bacteria 4567
28 Ga0070689_100153072 3300005340 Bacteria 1861
29 Ga0070689_100213389 3300005340 Bacteria 1581
30 Ga0070689_100362549 3300005340 Bacteria 1218
31 Ga0070691_10001499 3300005341 Bacteria 10019
32 Ga0070687_100003192 3300005343 Bacteria 6331
33 Ga0070687_100093924 3300005343 Bacteria 1665
34 Ga0070687_100151904 3300005343 Bacteria 1360
35 Ga0070687_101437372 3300005343 Bacteria 517
36 Ga0070661_100000417 3300005344 Bacteria 32723
37 Ga0070692_10008435 3300005345 Bacteria 4599
38 Ga0070692_10012858 3300005345 Bacteria 3887
39 Ga0070692_10513555 3300005345 Bacteria 779
40 Ga0070692_10769271 3300005345 Bacteria 655
41 Ga0070668_100022172 3300005347 Bacteria 4801
42 Ga0070669_101451543 3300005353 Bacteria 596
43 Ga0070675_100134475 3300005354 Bacteria 2109
44 Ga0070671_100243559 3300005355 Bacteria 1527
45 Ga0070688_100029409 3300005365 Bacteria 3290
46 Ga0070688_100129437 3300005365 Bacteria 1701
47 Ga0070688_100561605 3300005365 Bacteria 869
48 Ga0070659_100008721 3300005366 Bacteria 7420
49 Ga0070703_10133275 3300005406 Bacteria 915
50 Ga0070714_100138421 3300005435 Bacteria 2183
51 Ga0070710_10222214 3300005437 Bacteria 1202
52 Ga0070701_10001339 3300005438 Bacteria 9077
53 Ga0070701_10618097 3300005438 Bacteria 720
54 Ga0070701_10667492 3300005438 Bacteria 696
55 Ga0070701_10812583 3300005438 Bacteria 639
56 Ga0070711_100551685 3300005439 Bacteria 956
57 Ga0070705_100000265 3300005440 Bacteria 31468
58 Ga0070705_100097001 3300005440 Bacteria 1852
59 Ga0070700_100000808 3300005441 Bacteria 15359
60 Ga0070700_100074034 3300005441 Bacteria 2181
61 Ga0070700_100131184 3300005441 Bacteria 1691
62 Ga0070694_100000487 3300005444 Bacteria 21731
63 Ga0070694_100006056 3300005444 Bacteria 7337
64 Ga0070694_100067266 3300005444 Bacteria 2459
65 Ga0070694_100363167 3300005444 Bacteria 1125
66 Ga0070694_100415599 3300005444 Bacteria 1056
67 Ga0070694_100787498 3300005444 Bacteria 779
68 Ga0070694_101531942 3300005444 Bacteria 565
69 Ga0070708_100088082 3300005445 Bacteria 2822
70 Ga0070708_100694446 3300005445 Bacteria 958
71 Ga0070663_100000014 3300005455 Bacteria 134657
72 Ga0070678_100119202 3300005456 Bacteria 2078
73 Ga0070662_100268672 3300005457 Bacteria 1376
74 Ga0070681_10003339 3300005458 Bacteria 14999
75 Ga0070681_10030554 3300005458 Bacteria 5405
76 Ga0070681_10386576 3300005458 Bacteria 1310
77 Ga0070681_10480156 3300005458 Bacteria 1156
78 Ga0068867_100001461 3300005459 Bacteria 16361
79 Ga0068867_100002422 3300005459 Bacteria 13105
80 Ga0068867_100136466 3300005459 Bacteria 1913
81 Ga0070706_100633279 3300005467 Bacteria 993
82 Ga0070707_100095500 3300005468 Bacteria 2879
83 Ga0070707_100612897 3300005468 Bacteria 1051
84 Ga0070707_101750112 3300005468 Bacteria 589
85 Ga0070698_100013158 3300005471 Bacteria 8756
86 Ga0070699_100012656 3300005518 Bacteria 7278
87 Ga0070699_100089413 3300005518 Bacteria 2691
88 Ga0070699_100639568 3300005518 Bacteria 971
89 Ga0070699_101191074 3300005518 Bacteria 699
90 Ga0070679_100016118 3300005530 Bacteria 7200
91 Ga0070679_100041766 3300005530 Bacteria 4565
92 Ga0070679_101691552 3300005530 Bacteria 581
93 Ga0070684_100023971 3300005535 Bacteria 5113
94 Ga0070697_100013839 3300005536 Bacteria 6331
95 Ga0070697_100261302 3300005536 Bacteria 1482
96 Ga0070697_100295805 3300005536 Bacteria 1391
97 Ga0070697_100404660 3300005536 Bacteria 1185
98 Ga0068853_100155893 3300005539 Bacteria 2058
99 Ga0070672_100106815 3300005543 Bacteria 2278
100 Ga0070672_100343206 3300005543 Bacteria 1272
101 Ga0070672_100365153 3300005543 Bacteria 1233
102 Ga0070686_100002118 3300005544 Bacteria 10945
103 Ga0070686_100034494 3300005544 Bacteria 3118
104 Ga0070686_100048789 3300005544 Bacteria 2683
105 Ga0070686_100133755 3300005544 Bacteria 1718
106 Ga0070686_100406643 3300005544 Bacteria 1036
107 Ga0070686_100438211 3300005544 Bacteria 1002
108 Ga0070686_100438266 3300005544 Bacteria 1002
109 Ga0070695_100017443 3300005545 Bacteria 4353
110 Ga0070695_100053221 3300005545 Bacteria 2602
111 Ga0070695_100172235 3300005545 Bacteria 1528
112 Ga0070695_100422832 3300005545 Bacteria 1015
113 Ga0070696_100002664 3300005546 Bacteria 11828
114 Ga0070696_100008574 3300005546 Bacteria 6840
115 Ga0070696_100035595 3300005546 Bacteria 3429
116 Ga0070696_100078110 3300005546 Bacteria 2340
117 Ga0070696_100110338 3300005546 Bacteria 1980
118 Ga0070696_100263396 3300005546 Bacteria 1308
119 Ga0070693_100000572 3300005547 Bacteria 16351
120 Ga0070693_100495498 3300005547 Bacteria 866
121 Ga0070665_100239494 3300005548 Bacteria 1815
122 Ga0070704_100004486 3300005549 Bacteria 8061
123 Ga0070704_100075985 3300005549 Bacteria 2456
124 Ga0070704_100077676 3300005549 Bacteria 2433
125 Ga0070704_100325795 3300005549 Bacteria 1289
126 Ga0070704_100443939 3300005549 Bacteria 1116
127 Ga0070704_100447002 3300005549 Bacteria 1112
128 Ga0070704_100694236 3300005549 Bacteria 902
129 Ga0070704_100713115 3300005549 Bacteria 890
130 Ga0068855_100021017 3300005563 Bacteria 7827
131 Ga0068855_102259210 3300005563 Bacteria 545
132 Ga0070664_100000001 3300005564 Bacteria 551832
133 Ga0068857_100200767 3300005577 Bacteria 1818
134 Ga0068857_101170594 3300005577 Bacteria 744
135 Ga0068854_100000060 3300005578 Bacteria 80591
136 Ga0068854_100001366 3300005578 Bacteria 14708
137 Ga0068856_100002389 3300005614 Bacteria 19317
138 Ga0068856_100015255 3300005614 Bacteria 7424
139 Ga0068856_100274500 3300005614 Bacteria 1702
140 Ga0070702_100000549 3300005615 Bacteria 13638
141 Ga0070702_100015630 3300005615 Bacteria 3879
142 Ga0070702_100109703 3300005615 Bacteria 1709
143 Ga0070702_100245382 3300005615 Bacteria 1211
144 Ga0070702_100379389 3300005615 Bacteria 1005
145 Ga0068859_100006355 3300005617 Bacteria 11989
146 Ga0068859_100007406 3300005617 Bacteria 11140
147 Ga0068859_100125553 3300005617 Bacteria 2635
148 Ga0068859_100875469 3300005617 Bacteria 984
149 Ga0068864_100267895 3300005618 Bacteria 1591
150 Ga0068866_10001404 3300005718 Bacteria 10364
151 Ga0068861_100001259 3300005719 Bacteria 15803
152 Ga0068861_100086906 3300005719 Bacteria 2459
153 Ga0068861_100347441 3300005719 Bacteria 1300
154 Ga0068861_100819210 3300005719 Bacteria 875
155 Ga0068861_101011724 3300005719 Bacteria 794
156 Ga0068870_10007073 3300005840 Bacteria 4985
157 Ga0068870_10050112 3300005840 Bacteria 2205
158 Ga0068863_101224256 3300005841 Bacteria 757
159 Ga0068858_100011076 3300005842 Bacteria 8528
160 Ga0068858_100093983 3300005842 Bacteria 2792
161 Ga0068860_100005017 3300005843 Bacteria 13474
162 Ga0068860_100144908 3300005843 Bacteria 2285
163 Ga0068860_101549126 3300005843 Bacteria 685
164 Ga0068862_100007279 3300005844 Bacteria 9185
165 Ga0068862_100015960 3300005844 Bacteria 6243
166 Ga0068862_100043395 3300005844 Bacteria 3834
167 Ga0081538_10242326 3300005981 Bacteria 694
168 Ga0081539_10000178 3300005985 Bacteria 149201
169 Ga0075364_10547573 3300006051 Bacteria 791
170 Ga0070716_100314281 3300006173 Bacteria 1095
171 Ga0070716_100478497 3300006173 Bacteria 914
172 Ga0097621_100001204 3300006237 Bacteria 17926
173 Ga0068871_100003749 3300006358 Bacteria 10465
174 Ga0068871_100009875 3300006358 Bacteria 6930
175 Ga0068871_100500002 3300006358 Bacteria 1096
176 Ga0075428_100014581 3300006844 Bacteria 8730
177 Ga0075428_100086635 3300006844 Bacteria 3416
178 Ga0075428_100196196 3300006844 Bacteria 2183
179 Ga0075428_101030109 3300006844 Bacteria 871
180 Ga0075430_100005177 3300006846 Bacteria 10983
181 Ga0075430_100007114 3300006846 Bacteria 9438
182 Ga0075430_100248328 3300006846 Bacteria 1474
183 Ga0075430_100624836 3300006846 Bacteria 889
184 Ga0075431_100013405 3300006847 Bacteria 8282
185 Ga0075431_100108829 3300006847 Bacteria 2860
186 Ga0075431_100163533 3300006847 Bacteria 2288
187 Ga0075431_100265363 3300006847 Bacteria 1741
188 Ga0075431_100482374 3300006847 Bacteria 1232
189 Ga0075433_10009792 3300006852 Bacteria 7679
190 Ga0075433_10307423 3300006852 Bacteria 1403
191 Ga0075433_10365202 3300006852 Bacteria 1275
192 Ga0075433_10441785 3300006852 Bacteria 1147
193 Ga0075433_10520394 3300006852 Bacteria 1047
194 Ga0075434_100000054 3300006871 Bacteria 56191
195 Ga0075434_100053762 3300006871 Bacteria 4001
196 Ga0075434_100211123 3300006871 Bacteria 1961
197 Ga0075434_100252037 3300006871 Bacteria 1784
198 Ga0075434_100795991 3300006871 Bacteria 962
199 Ga0075434_101192057 3300006871 Bacteria 774
200 Ga0075434_101619255 3300006871 Bacteria 656
201 Ga0075434_102624560 3300006871 Bacteria 504
202 Ga0075429_100001558 3300006880 Bacteria 18836
203 Ga0075429_100253383 3300006880 Bacteria 1541
204 Ga0075429_100331477 3300006880 Bacteria 1332
205 Ga0075429_100648903 3300006880 Bacteria 925
206 Ga0075429_100970982 3300006880 Bacteria 743
207 Ga0068865_100002272 3300006881 Bacteria 11314
208 Ga0068865_100033663 3300006881 Bacteria 3431
209 Ga0075436_100000191 3300006914 Bacteria 37759
210 Ga0075436_100029700 3300006914 Bacteria 3759
211 Ga0075436_100040743 3300006914 Bacteria 3205
212 Ga0075436_100043963 3300006914 Bacteria 3079
213 Ga0075436_100103158 3300006914 Bacteria 1987
214 Ga0097620_100006355 3300006931 Bacteria 11989
215 Ga0097620_100007406 3300006931 Bacteria 11140
216 Ga0097620_100125549 3300006931 Bacteria 2635
217 Ga0097620_100308825 3300006931 Bacteria 1675
218 Ga0097620_100875499 3300006931 Bacteria 984
219 Ga0075435_100007703 3300007076 Bacteria 7698
220 Ga0075435_100016219 3300007076 Bacteria 5615
221 Ga0075435_100102756 3300007076 Bacteria 2369
222 Ga0075435_100160379 3300007076 Bacteria 1894
223 Ga0075435_100576109 3300007076 Bacteria 975
224 Ga0099794_10005538 3300007265 Bacteria 5070
225 Ga0099794_10054797 3300007265 Bacteria 1926
226 Ga0099794_10127020 3300007265 Bacteria 1286
227 Ga0099794_10162825 3300007265 Bacteria 1135
228 Ga0099794_10263053 3300007265 Bacteria 891
229 Ga0105240_10042167 3300009093 Bacteria 5818
230 Ga0111539_10027130 3300009094 Bacteria 6994
231 Ga0111539_10048892 3300009094 Bacteria 5048
232 Ga0111539_10056385 3300009094 Bacteria 4669
233 Ga0111539_10145364 3300009094 Bacteria 2776
234 Ga0111539_10757746 3300009094 Bacteria 1130
235 Ga0111539_11858345 3300009094 Bacteria 698
236 Ga0105245_10009209 3300009098 Bacteria 8609
237 Ga0105245_10373278 3300009098 Bacteria 1419
238 Ga0114129_10019188 3300009147 Bacteria 9740
239 Ga0114129_10021603 3300009147 Bacteria 9134
240 Ga0114129_10027991 3300009147 Bacteria 7982
241 Ga0114129_10148428 3300009147 Bacteria 3210
242 Ga0114129_10459692 3300009147 Bacteria 1668
243 Ga0114129_10518389 3300009147 Bacteria 1554
244 Ga0105243_10005056 3300009148 Bacteria 10349
245 Ga0105243_10017075 3300009148 Bacteria 5488
246 Ga0105243_10340543 3300009148 Bacteria 1373
247 Ga0105243_10698625 3300009148 Bacteria 988
248 Ga0105243_11711912 3300009148 Bacteria 658
249 Ga0105241_10005421 3300009174 Bacteria 9431
250 Ga0105241_10127166 3300009174 Bacteria 2059
251 Ga0105242_10002637 3300009176 Bacteria 14063
252 Ga0105242_10009274 3300009176 Bacteria 7555
253 Ga0105242_11951046 3300009176 Bacteria 628
254 Ga0105238_12238818 3300009551 Bacteria 581
255 Ga0105249_10013999 3300009553 Bacteria 7090
256 Ga0105249_10017277 3300009553 Bacteria 6404
257 Ga0105148_104730 3300009978 Bacteria 977
258 Ga0105239_10053531 3300010375 Bacteria 4427
259 Ga0105246_11630363 3300011119 Bacteria 611
260 Ga0157373_10023638 3300013100 Bacteria 4454
261 Ga0157371_10000038 3300013102 Bacteria 214783
262 Ga0157370_10000235 3300013104 Bacteria 70340
263 Ga0157369_10005312 3300013105 Bacteria 15012
264 Ga0157378_10006403 3300013297 Bacteria 10293
265 Ga0163162_10438172 3300013306 Bacteria 1439
266 Ga0163162_10925059 3300013306 Bacteria 984
267 Ga0157372_10009815 3300013307 Bacteria 10182
268 Ga0157372_12967030 3300013307 Bacteria 543
269 Ga0157380_10042809 3300014326 Bacteria 3542
270 Ga0157380_10863179 3300014326 Bacteria 928
271 Ga0182008_10214848 3300014497 Bacteria 982
272 Ga0157379_10051647 3300014968 Bacteria 3672
273 Ga0157376_10005502 3300014969 Bacteria 8858
274 Ga0157376_10046433 3300014969 Bacteria 3581
275 Ga0157376_10751167 3300014969 Bacteria 984
276 Ga0157376_12517272 3300014969 Bacteria 554
277 Ga0182006_1000822 3300015261 Bacteria 20817
278 Ga0206355_1334066 3300020076 Bacteria 2950
279 Ga0206351_10877710 3300020077 Bacteria 2359
280 Ga0154015_1560675 3300020610 Bacteria 11495
281 Ga0224712_10040584 3300022467 Bacteria 1752
282 Ga0209784_100063 3300025224 Bacteria 159576
283 Ga0209566_100048 3300025225 Bacteria 241570
284 Ga0209674_100071 3300025226 Bacteria 241568
285 Ga0209672_100199 3300025228 Bacteria 47771
286 Ga0209672_100339 3300025228 Bacteria 30154
287 Ga0209147_100002 3300025229 Bacteria 2158988
288 Ga0209563_100085 3300025230 Bacteria 186579
289 Ga0209258_100002 3300025242 Bacteria 2158988
290 Ga0209646_1000035 3300025246 Bacteria 363209
291 Ga0209026_1007198 3300025250 Bacteria 2555
292 Ga0209677_100040 3300025253 Bacteria 241568
293 Ga0209148_1000077 3300025254 Bacteria 298133
294 Ga0209455_1000009 3300025272 Bacteria 1042273
295 Ga0207682_10009446 3300025893 Bacteria 3849
296 Ga0207692_10144863 3300025898 Bacteria 1355
297 Ga0207692_10807205 3300025898 Bacteria 614
298 Ga0207645_10019580 3300025907 Bacteria 4436
299 Ga0207643_10147691 3300025908 Bacteria 1407
300 Ga0207684_10428912 3300025910 Bacteria 1136
301 Ga0207654_10210663 3300025911 Bacteria 1284
302 Ga0207654_10972898 3300025911 Bacteria 617
303 Ga0207707_10251237 3300025912 Bacteria 1536
304 Ga0207707_10334129 3300025912 Bacteria 1307
305 Ga0207695_10014931 3300025913 Bacteria 9166
306 Ga0207663_10046647 3300025916 Bacteria 2671
307 Ga0207660_10036796 3300025917 Bacteria 3405
308 Ga0207660_10068764 3300025917 Bacteria 2570
309 Ga0207662_10007715 3300025918 Bacteria 5861
310 Ga0207662_10015290 3300025918 Bacteria 4318
311 Ga0207662_10219845 3300025918 Bacteria 1237
312 Ga0207649_10000390 3300025920 Bacteria 32941
313 Ga0207652_10017538 3300025921 Bacteria 5859
314 Ga0207646_10060661 3300025922 Bacteria 3377
315 Ga0207659_10469401 3300025926 Bacteria 1062
316 Ga0207687_10361971 3300025927 Bacteria 1184
317 Ga0207700_11618130 3300025928 Bacteria 573
318 Ga0207664_10140534 3300025929 Bacteria 2042
319 Ga0207644_10181249 3300025931 Bacteria 1651
320 Ga0207690_10009513 3300025932 Bacteria 5774
321 Ga0207686_10119849 3300025934 Bacteria 1789
322 Ga0207709_10262483 3300025935 Bacteria 1267
323 Ga0207709_10445919 3300025935 Bacteria 999
324 Ga0207709_10614161 3300025935 Bacteria 862
325 Ga0207670_10018788 3300025936 Bacteria 4210
326 Ga0207670_10611134 3300025936 Bacteria 896
327 Ga0207670_10627901 3300025936 Bacteria 884
328 Ga0207704_10021105 3300025938 Bacteria 3461
329 Ga0207665_10679498 3300025939 Bacteria 808
330 Ga0207691_10322472 3300025940 Bacteria 1324
331 Ga0207691_10562761 3300025940 Bacteria 966
332 Ga0207689_10032806 3300025942 Bacteria 4316
333 Ga0207689_10080433 3300025942 Bacteria 2678
334 Ga0207661_10044504 3300025944 Bacteria 3509
335 Ga0207679_10000003 3300025945 Bacteria 597553
336 Ga0207668_10010656 3300025972 Bacteria 5563
337 Ga0207640_10000071 3300025981 Bacteria 80591
338 Ga0207677_10225888 3300026023 Bacteria 1505
339 Ga0207703_10043469 3300026035 Bacteria 3606
340 Ga0207678_10000175 3300026067 Bacteria 54512
341 Ga0207708_10041598 3300026075 Bacteria 3503
342 Ga0207708_10328789 3300026075 Bacteria 1249
343 Ga0207708_10434420 3300026075 Bacteria 1091
344 Ga0207702_10000110 3300026078 Bacteria 95353
345 Ga0207702_10223684 3300026078 Bacteria 1755
346 Ga0207702_10339830 3300026078 Bacteria 1434
347 Ga0207648_10019329 3300026089 Bacteria 6148
348 Ga0207676_10234898 3300026095 Bacteria 1641
349 Ga0207674_10018440 3300026116 Bacteria 7585
350 Ga0207674_10204687 3300026116 Bacteria 1923
351 Ga0207674_10810947 3300026116 Bacteria 903
352 Ga0207675_100001423 3300026118 Bacteria 23970
353 Ga0207675_100801853 3300026118 Bacteria 955
354 Ga0207698_11273131 3300026142 Bacteria 750
355 Ga0209969_1011499 3300027360 Bacteria 1273
356 Ga0209969_1032199 3300027360 Bacteria 803
357 Ga0209969_1033102 3300027360 Bacteria 793
358 Ga0209967_1002255 3300027364 Bacteria 2503
359 Ga0209981_1008910 3300027378 Bacteria 1366
360 Ga0209996_1028329 3300027395 Bacteria 808
361 Ga0209984_1020835 3300027424 Bacteria 897
362 Ga0210000_1049697 3300027462 Bacteria 672
363 Ga0209995_1051575 3300027471 Bacteria 698
364 Ga0209995_1082264 3300027471 Bacteria 553
365 Ga0209968_1018927 3300027526 Bacteria 1107
366 Ga0209968_1033458 3300027526 Bacteria 864
367 Ga0209983_1014370 3300027665 Bacteria 1631
368 Ga0209588_1034691 3300027671 Bacteria 1621
369 Ga0209588_1064050 3300027671 Bacteria 1188
370 Ga0209588_1115164 3300027671 Bacteria 862
371 Ga0209971_1028785 3300027682 Bacteria 1330
372 Ga0209971_1034418 3300027682 Bacteria 1217
373 Ga0209971_1062490 3300027682 Bacteria 902
374 Ga0209966_1084253 3300027695 Bacteria 707
375 Ga0209998_10107977 3300027717 Bacteria 694
376 Ga0209974_10018410 3300027876 Bacteria 2317
377 Ga0207428_10090265 3300027907 Bacteria 2380
378 Ga0207428_10138730 3300027907 Bacteria 1858
379 Ga0207428_10145863 3300027907 Bacteria 1804
380 Ga0268266_10225204 3300028379 Bacteria 1725
381 Ga0268265_10010401 3300028380 Bacteria 6283
382 Ga0268265_11019168 3300028380 Bacteria 818
383 Ga0268264_10163650 3300028381 Bacteria 2007
384 Ga0265330_10248899 3300031235 Bacteria 749
385 Ga0307408_100501740 3300031548 Bacteria 1062
386 Ga0307408_100555027 3300031548 Bacteria 1014
387 Ga0307408_101424408 3300031548 Bacteria 653
388 Ga0316575_10002030 3300031665 Bacteria 6729
389 Ga0316575_10008219 3300031665 Bacteria 3795
390 Ga0316579_10008523 3300031691 Bacteria 4278
391 Ga0316578_10003341 3300031728 Bacteria 7313
392 Ga0307405_10208405 3300031731 Bacteria 1425
393 Ga0307405_11020413 3300031731 Bacteria 707
394 Ga0307407_10089670 3300031903 Bacteria 1882
395 Ga0307409_100058363 3300031995 Bacteria 2997
396 Ga0307416_100067333 3300032002 Bacteria 2953
397 Ga0307416_100069155 3300032002 Bacteria 2921
398 Ga0307416_100433234 3300032002 Bacteria 1363
399 Ga0307416_100778301 3300032002 Bacteria 1051
400 Ga0307414_10795827 3300032004 Bacteria 862
401 Ga0316583_10004230 3300032133 Bacteria 5112
402 Ga0373930_0008402 3300034816 Bacteria 1807
403 Ga0373930_0050225 3300034816 Bacteria 909
404 Ga0373948_0027291 3300034817 Bacteria 1130
405 Ga0373950_0050977 3300034818 Bacteria 813
406 Ga0373958_0013225 3300034819 Bacteria 1426
407 Ga0373959_0198743 3300034820 Bacteria 529
408 Ga0373938_0118743 3300034957 Bacteria 680
409 Ga0373938_0248396 3300034957 Bacteria 508
410 Ga0373929_0016248 3300035085 Bacteria 1457
411 Ga0373929_0119955 3300035085 Bacteria 680
412 Ga0373934_0024261 3300035086 Bacteria 2345
413 Ga0373949_0004367 3300035090 Bacteria 3242
414 Ga0373951_0168636 3300035091 Bacteria 623
415 Ga0373923_0027939 3300035111 Bacteria 2253
416 Ga0373923_0259317 3300035111 Bacteria 815
417 Ga0373932_0001506 3300035112 Bacteria 6478
418 Ga0373932_0101589 3300035112 Bacteria 936
419 Ga0373936_0107985 3300035113 Bacteria 1179
420 Ga0373939_0270459 3300035114 Bacteria 668
421 Ga0373941_0028703 3300035115 Bacteria 1635
422 Ga0373941_0047955 3300035115 Bacteria 1347
423 Ga0373941_0154887 3300035115 Bacteria 843
424 Ga0373945_0121471 3300035116 Bacteria 1039
425 Ga0373954_0013891 3300035118 Bacteria 3588
426 Ga0373954_0255825 3300035118 Bacteria 862
427 Ga0373956_0090984 3300035119 Bacteria 1408
428 Ga0373957_0006042 3300035120 Bacteria 3793
429 Ga0373957_0037986 3300035120 Bacteria 1801
430 Ga0373960_0010608 3300035121 Bacteria 2255
431 Ga0373960_0034660 3300035121 Bacteria 1429
432 Ga0373946_0084563 3300035171 Bacteria 1395
433 Ga0373955_0003525 3300035172 Bacteria 6883
434 Ga0373942_0197711 3300035207 Bacteria 665
435 Ga0373962_0009261 3300035242 Bacteria 2436
436 Ga0373962_0088550 3300035242 Bacteria 950
437 Ga0316574_0020683 3300035398 Bacteria 3897
438 Ga0316574_0440768 3300035398 Bacteria 817
439 Ga0373924_0057844 3300035410 Bacteria 1617
440 Ga0373924_0122337 3300035410 Bacteria 1129
441 Ga0373931_0003664 3300035691 Bacteria 6946
442 Ga0373931_0007929 3300035691 Bacteria 5024
443 Ga0373931_0108348 3300035691 Bacteria 1572
444 Ga0373931_0158918 3300035691 Bacteria 1323
445 Ga0373931_0401737 3300035691 Bacteria 868
446 Ga0373935_0008042 3300035692 Bacteria 6322
447 Ga0373935_0076433 3300035692 Bacteria 2168
448 Ga0373927_0016891 3300035695 Bacteria 4813
449 Ga0373933_0162944 3300035724 Bacteria 1417
450 Ga0373947_0043198 3300035725 Bacteria 2692
451 Ga0373947_0201349 3300035725 Bacteria 1303
452 Ga0373937_0033346 3300036401 Bacteria 4675
453 Ga0373937_0174309 3300036401 Bacteria 2018
454 Ga0373937_0265886 3300036401 Bacteria 1618
455 Ga0373937_1710290 3300036401 Bacteria 576
456 Ga0373925_0031887 3300037068 Bacteria 3876
457 Ga0373925_0303514 3300037068 Bacteria 1289
458 Ga0395905_0061224 3300037471 Bacteria 3521
459 Ga0395905_0418532 3300037471 Bacteria 1236
460 Ga0316581_0040054 3300037588 Bacteria 1426
461 Ga0436360_0367255 3300039438 Bacteria 591
462 Ga0436360_1335703 3300039438 Bacteria 1238
463 Ga0439436_0007812 3300041404 Bacteria 3288
464 Ga0439439_0013372 3300041406 Bacteria 1990
465 Ga0439453_0009699 3300041408 Bacteria 1572
466 Ga0439466_0188172 3300041411 Bacteria 629
467 Ga0451807_1338436 3300041486 Bacteria 1796
468 Ga0451835_0209263 3300041492 Bacteria 893
469 Ga0439441_000602 3300042001 Bacteria 4046
470 Ga0439441_002387 3300042001 Bacteria 2640
471 Ga0439441_025085 3300042001 Bacteria 1124
472 Ga0439443_085144 3300042003 Bacteria 591
473 Ga0439456_007504 3300042013 Bacteria 2241
474 Ga0450913_014481 3300042117 Bacteria 672
475 Ga0450910_053607 3300042147 Bacteria 670
476 Ga0439446_0000284 3300042156 Bacteria 9583
477 Ga0439446_0068129 3300042156 Bacteria 1085
478 Ga0439434_0001978 3300042435 Bacteria 5935
479 Ga0439435_0000115 3300042436 Bacteria 10330
480 Ga0439435_0060903 3300042436 Bacteria 1099
481 Ga0439444_0001979 3300042437 Bacteria 2739
482 Ga0439460_0026202 3300042461 Bacteria 1629
483 Ga0451577_0008376 3300042876 Bacteria 10063
484 Ga0451577_0422668 3300042876 Bacteria 1210
485 Ga0451577_1885511 3300042876 Bacteria 524
486 Ga0466986_0107369 3300044650 Bacteria 1920
487 Ga0466969_0024739 3300044656 Bacteria 3089
488 Ga0466972_0070829 3300044658 Bacteria 1663
489 Ga0453683_0002860 3300044673 Bacteria 13082
490 Ga0466961_0015282 3300044693 Bacteria 4930
491 Ga0466963_0229864 3300044694 Bacteria 1300
492 Ga0466964_0010465 3300044706 Bacteria 3498
493 Ga0453684_0027489 3300044712 Bacteria 8156
494 Ga0453684_0126636 3300044712 Bacteria 3072
495 Ga0453684_0276244 3300044712 Bacteria 1918
496 Ga0466970_0002402 3300044765 Bacteria 9049
497 Ga0466957_0053022 3300044842 Bacteria 2471
498 Ga0466960_0578794 3300044901 Bacteria 665
499 Ga0466959_0020872 3300045049 Bacteria 4827
500 Ga0451576_0008921 3300045051 Bacteria 11698
501 Ga0451576_0015418 3300045051 Bacteria 8466
502 Ga0451576_0024041 3300045051 Bacteria 6585
503 Ga0451576_0148441 3300045051 Bacteria 2445
504 Ga0451576_0162038 3300045051 Bacteria 2334
505 Ga0451576_0374897 3300045051 Bacteria 1491
506 Ga0451576_1062916 3300045051 Bacteria 848
507 Ga0451576_1162444 3300045051 Bacteria 806
508 Ga0466967_0025692 3300045976 Bacteria 4859
509 Ga0466967_0054089 3300045976 Bacteria 3531
510 Ga0466967_0067551 3300045976 Bacteria 3189
511 Ga0495592_0004799 3300046454 Bacteria 9933
512 Ga0495592_0429221 3300046454 Bacteria 832
513 Ga0495641_0003195 3300046461 Bacteria 12455
514 Ga0495651_0008782 3300046462 Bacteria 7748
515 Ga0495651_0578846 3300046462 Bacteria 710
516 Ga0495653_0081977 3300046463 Bacteria 2382
517 Ga0495580_0044125 3300046472 Bacteria 3172
518 Ga0495582_0077789 3300046473 Bacteria 1840
519 Ga0495662_0014094 3300046476 Bacteria 3891
520 Ga0495664_0065984 3300046477 Bacteria 2158
521 Ga0495594_0021119 3300046499 Bacteria 3474
522 Ga0495608_0261649 3300046511 Bacteria 1077
523 Ga0495608_0605686 3300046511 Bacteria 657
524 Ga0495618_0082530 3300046514 Bacteria 2052
525 Ga0495618_0689376 3300046514 Bacteria 601
526 Ga0495628_0014603 3300046516 Bacteria 6576
527 Ga0495628_0419936 3300046516 Bacteria 975
528 Ga0495630_0028698 3300046517 Bacteria 4134
529 Ga0495630_0416087 3300046517 Bacteria 1030
530 Ga0495630_0457606 3300046517 Bacteria 978
531 Ga0495663_0163795 3300046525 Bacteria 764
532 Ga0495666_0007092 3300046526 Bacteria 5631
533 Ga0495642_0042873 3300046528 Bacteria 1845
534 Ga0495642_0073964 3300046528 Bacteria 1428
535 Ga0495652_0023629 3300046529 Bacteria 5448
536 Ga0495652_0475407 3300046529 Bacteria 871
537 Ga0495652_0851775 3300046529 Bacteria 604
538 Ga0495665_0027889 3300046531 Bacteria 3030
539 Ga0495640_0010072 3300046533 Bacteria 7326
540 Ga0495587_0185409 3300046536 Bacteria 1179
541 Ga0495598_0164266 3300046537 Bacteria 783
542 Ga0495609_0330278 3300046538 Bacteria 617
543 Ga0495621_0066165 3300046539 Bacteria 1322
544 Ga0495622_0011378 3300046557 Bacteria 4111
545 Ga0495667_0150380 3300046559 Bacteria 1499
546 Ga0495634_0003739 3300046642 Bacteria 12120
547 Ga0495635_0041979 3300046663 Bacteria 3160
548 Ga0495659_0043419 3300046664 Bacteria 1613
549 Ga0495657_0031074 3300046675 Bacteria 3735
550 Ga0495623_0450060 3300046679 Bacteria 686
551 Ga0495647_0006231 3300046681 Bacteria 3941
552 Ga0495669_0010765 3300046684 Bacteria 3871
553 Ga0495613_0028375 3300046689 Bacteria 4161
554 Ga0495624_0058072 3300046690 Bacteria 2431
555 Ga0495600_0002894 3300046809 Bacteria 10003
556 Ga0495600_0778644 3300046809 Bacteria 571
557 Ga0495604_0028704 3300047317 Bacteria 4426
558 Ga0495674_0008749 3300047319 Bacteria 9627
559 Ga0495680_0007165 3300047322 Bacteria 10274
560 Ga0495680_0417695 3300047322 Bacteria 923
561 Ga0495675_0004856 3300047444 Bacteria 8176
562 Ga0495684_0030932 3300047471 Bacteria 4109
563 Ga0495593_0058632 3300047673 Bacteria 2019
564 Ga0496104_1329721 3300048907 Bacteria 622
565 Ga0496125_0065328 3300048928 Bacteria 2884
566 Ga0501290_037299 3300049513 Bacteria 717
567 Ga0501291_015307 3300049514 Bacteria 1158
568 Ga0501291_029370 3300049514 Bacteria 920
569 Ga0501292_091358 3300049515 Bacteria 592
570 Ga0501298_062509 3300049521 Bacteria 791
571 Ga0501298_075808 3300049521 Bacteria 732
572 Ga0501299_017418 3300049522 Bacteria 1282
573 Ga0501031_0048043 3300049568 Bacteria 2782
574 Ga0501031_0525465 3300049568 Bacteria 763
575 Ga0501031_0591094 3300049568 Bacteria 714
576 Ga0501032_0040774 3300049569 Bacteria 3155
577 Ga0501032_0180066 3300049569 Bacteria 1384
578 Ga0501033_0014575 3300049570 Bacteria 5968
579 Ga0501036_0057134 3300049572 Bacteria 3305
580 Ga0501036_0160882 3300049572 Bacteria 1893
581 Ga0501037_0192564 3300049573 Bacteria 1443
582 Ga0501037_0459196 3300049573 Bacteria 868
583 Ga0501038_0001514 3300049574 Bacteria 21388
584 Ga0501038_1009692 3300049574 Bacteria 611
585 Ga0501039_0012358 3300049575 Bacteria 6515
586 Ga0501040_0025733 3300049576 Bacteria 3958
587 Ga0501040_0154218 3300049576 Bacteria 1622
588 Ga0501040_0480474 3300049576 Bacteria 895
589 Ga0501040_0644125 3300049576 Bacteria 766
590 Ga0501041_0000814 3300049577 Bacteria 16723
591 Ga0501042_0000247 3300049578 Bacteria 26226
592 Ga0501042_0096937 3300049578 Bacteria 2119
593 Ga0501043_0048684 3300049579 Bacteria 3332
594 Ga0501043_0646402 3300049579 Bacteria 777
595 Ga0501046_0000518 3300049580 Bacteria 38078
596 Ga0501046_0021553 3300049580 Bacteria 5318
597 Ga0501046_0304141 3300049580 Bacteria 1164
598 Ga0501046_0335663 3300049580 Bacteria 1099
599 Ga0501046_0947416 3300049580 Bacteria 599
600 Ga0501048_0043437 3300049582 Bacteria 3217
601 Ga0501048_0181597 3300049582 Bacteria 1491
602 Ga0501048_0568528 3300049582 Bacteria 814
603 Ga0501048_0672938 3300049582 Bacteria 743
604 Ga0501067_0086038 3300049583 Bacteria 1745
605 Ga0501068_0023737 3300049584 Bacteria 3596
606 Ga0501068_0531535 3300049584 Bacteria 764
607 Ga0501069_0233341 3300049585 Bacteria 1071
608 Ga0501070_0031205 3300049586 Bacteria 4464
609 Ga0501071_0036242 3300049587 Bacteria 3517
610 Ga0501071_0072410 3300049587 Bacteria 2513
611 Ga0501071_0132971 3300049587 Bacteria 1849
612 Ga0501071_0439060 3300049587 Bacteria 999
613 Ga0501071_0667651 3300049587 Bacteria 800
614 Ga0501072_0124521 3300049588 Bacteria 2053
615 Ga0501072_0636561 3300049588 Bacteria 840
616 Ga0501073_0191253 3300049589 Bacteria 1416
617 Ga0501073_0213617 3300049589 Bacteria 1333
618 Ga0501073_0505312 3300049589 Bacteria 836
619 Ga0501074_0018228 3300049590 Bacteria 5100
620 Ga0501074_0383383 3300049590 Bacteria 997
621 Ga0501075_0026710 3300049591 Bacteria 4252
622 Ga0501075_0029151 3300049591 Bacteria 4080
623 Ga0501075_0042612 3300049591 Bacteria 3403
624 Ga0501075_0573545 3300049591 Bacteria 861
625 Ga0501076_0043736 3300049592 Bacteria 3530
626 Ga0501076_0053640 3300049592 Bacteria 3195
627 Ga0501076_0488012 3300049592 Bacteria 1015
628 Ga0501077_0002988 3300049593 Bacteria 10147
629 Ga0501207_050820 3300049654 Bacteria 740
630 Ga0501208_131698 3300049655 Bacteria 559
631 Ga0501211_014420 3300049658 Bacteria 792
632 Ga0501211_049027 3300049658 Bacteria 520
633 Ga0501216_118647 3300049660 Bacteria 602
634 Ga0501217_105135 3300049661 Bacteria 806
635 Ga0501227_171949 3300049665 Bacteria 606
636 Ga0501233_068494 3300049668 Bacteria 895
637 Ga0501233_122567 3300049668 Bacteria 704
638 Ga0501236_044128 3300049670 Bacteria 747
639 Ga0501249_176912 3300049679 Bacteria 550
640 Ga0501079_0018674 3300049741 Bacteria 5297
641 Ga0501079_0161813 3300049741 Bacteria 1745
642 Ga0501079_0851686 3300049741 Bacteria 718
643 Ga0501080_0001187 3300049742 Bacteria 21591
644 Ga0501080_0099974 3300049742 Bacteria 2691
645 Ga0501081_0000242 3300049743 Bacteria 27990
646 Ga0501081_0105030 3300049743 Bacteria 2001
647 Ga0501263_015087 3300049760 Bacteria 995
648 Ga0501283_105219 3300049779 Bacteria 553
649 Ga0501035_0061820 3300049822 Bacteria 3332
650 Ga0501035_0451921 3300049822 Bacteria 1063
651 Ga0501045_0010748 3300049824 Bacteria 6416
652 Ga0501045_0293196 3300049824 Bacteria 1210
653 Ga0501045_0742242 3300049824 Bacteria 724
654 nmdc:mga00v17_772477_c1 3300050491 Bacteria 613
655 nmdc:mga0k408_184055_c1 3300050493 Bacteria 1246
656 nmdc:mga05p37_1000294_c1 3300050507 Bacteria 888
657 nmdc:mga05p37_14145_c1 3300050507 Bacteria 9577
658 nmdc:mga05p37_283135_c1 3300050507 Bacteria 1976
659 nmdc:mga05p37_28628_c1 3300050507 Bacteria 6796
660 nmdc:mga05p37_510357_c1 3300050507 Bacteria 1377
661 nmdc:mga09592_342799_c1 3300050508 Bacteria 1294
662 nmdc:mga09592_4216_c1 3300050508 Bacteria 11610
663 nmdc:mga09592_902899_c1 3300050508 Bacteria 743
664 nmdc:mga0qj67_13244_c1 3300050509 Bacteria 6222
665 nmdc:mga0qj67_18191_c1 3300050509 Bacteria 5354
666 nmdc:mga0qj67_345772_c1 3300050509 Bacteria 1203
667 nmdc:mga0qj67_94522_c1 3300050509 Bacteria 2405
668 nmdc:mga06r32_233807_c1 3300050510 Bacteria 1826
669 nmdc:mga06r32_238407_c1 3300050510 Bacteria 1807
670 nmdc:mga06r32_260460_c1 3300050510 Bacteria 1722
671 nmdc:mga06r32_318875_c1 3300050510 Bacteria 1540
672 nmdc:mga06r32_8481_c1 3300050510 Bacteria 9262
673 nmdc:mga06r32_96691_c1 3300050510 Bacteria 2893
674 nmdc:mga08y16_145604_c1 3300050511 Bacteria 2463
675 nmdc:mga08y16_155202_c1 3300050511 Bacteria 2379
676 nmdc:mga08y16_27578_c1 3300050511 Bacteria 4341
677 nmdc:mga08y16_36800_c1 3300050511 Bacteria 5140
678 nmdc:mga08y16_64521_c1 3300050511 Bacteria 3824
679 nmdc:mga0n895_123161_c1 3300050512 Bacteria 2615
680 nmdc:mga0n895_254963_c1 3300050512 Bacteria 1780
681 nmdc:mga0n895_4086_c1 3300050512 Bacteria 11888
682 nmdc:mga0n895_5776_c1 3300050512 Bacteria 10385
683 nmdc:mga0rr50_1244214_c1 3300050513 Bacteria 632
684 nmdc:mga0rr50_1458490_c1 3300050513 Bacteria 579
685 nmdc:mga0rr50_190046_c1 3300050513 Bacteria 1682
686 nmdc:mga0rr50_20110_c1 3300050513 Bacteria 4524
687 nmdc:mga0rr50_21407_c1 3300050513 Bacteria 4414
688 nmdc:mga0rr50_265625_c1 3300050513 Bacteria 1429
689 nmdc:mga0rr50_457525_c1 3300050513 Bacteria 1082
690 nmdc:mga0rr50_5238_c1 3300050513 Bacteria 7714
691 nmdc:mga0rr50_9340_c1 3300050513 Bacteria 6162
692 nmdc:mga08x19_170594_c1 3300050514 Bacteria 1482
693 nmdc:mga08x19_28183_c1 3300050514 Bacteria 3516
694 nmdc:mga08x19_662_c1 3300050514 Bacteria 22226
695 nmdc:mga0a205_1190729_c1 3300050515 Bacteria 610
696 nmdc:mga0a205_23253_c1 3300050515 Bacteria 5878
697 nmdc:mga0a205_35527_c2 3300050515 Bacteria 3128
698 nmdc:mga0a205_36516_c1 3300050515 Bacteria 4721
699 nmdc:mga0a205_383004_c1 3300050515 Bacteria 1271
700 nmdc:mga0a205_420427_c1 3300050515 Bacteria 1199
701 nmdc:mga0a205_500496_c1 3300050515 Bacteria 1072
702 nmdc:mga0a205_895196_c1 3300050515 Bacteria 734
703 Ga0495595_0006295 3300053084 Bacteria 4833
704 Ga0495619_0012782 3300053085 Bacteria 5285
705 Ga0500607_020374 3300053121 Bacteria 3744
706 Ga0500559_0260007 3300053136 Bacteria 817
707 Ga0500636_0000831 3300053177 Bacteria 16612
708 Ga0500637_0051975 3300053178 Bacteria 2336
709 Ga0500625_006128 3300053729 Bacteria 5095
710 Ga0501084_0058218 3300054114 Bacteria 3233
711 Ga0501084_0068229 3300054114 Bacteria 2977
712 Ga0501084_0192170 3300054114 Bacteria 1722
713 Ga0501084_0950490 3300054114 Bacteria 722
714 Ga0590071_019827 3300059421 Bacteria 1583
715 Ga0590077_008634 3300059426 Bacteria 2085
716 Ga0501082_0009783 3300060353 Bacteria 8260
717 Ga0501082_0107962 3300060353 Bacteria 2408
718 Ga0501082_0135948 3300060353 Bacteria 2133
719 Ga0466962_0074319 3300061719 Bacteria 1624
720 Ga0530510_0000121 3300061734 Bacteria 44581
721 Ga0530510_0056363 3300061734 Bacteria 2839
722 nmdc:mga06r32_72491_c1
723 JGI24740J21852_10002395
724 JGI24742J22300_10050067
725 JGI25156J39149_1006025
726 JGI25154J39366_1000508
727 JGI25406J46586_10074336
728 rootH1_10192677
729 Ga0055532_1000008
730 Ga0055525_1000500
731 Ga0055535_1000006
732 Ga0055542_1001574
733 Ga0055529_1000025
734 Ga0065707_10111688
735 Ga0070676_10555033
736 Ga0070690_100001215
737 Ga0070690_100267405
738 Ga0068869_100001868
739 Ga0068869_100071372
740 Ga0070666_10048428
741 Ga0070680_100044374
742 Ga0070680_100267248
743 Ga0070680_100274894
744 Ga0070682_100055357
745 Ga0068868_100001854
746 Ga0068868_100276626
747 Ga0070689_100001994
748 Ga0070689_100024064
749 Ga0070689_100153072
750 Ga0070689_100213389
751 Ga0070689_100362549
752 Ga0070691_10001499
753 Ga0070687_100003192
754 Ga0070687_100093924
755 Ga0070687_100151904
756 Ga0070687_101437372
757 Ga0070661_100000417
758 Ga0070692_10008435
759 Ga0070692_10012858
760 Ga0070692_10513555
761 Ga0070692_10769271
762 Ga0070668_100022172
763 Ga0070669_101451543
764 Ga0070675_100134475
765 Ga0070671_100243559
766 Ga0070688_100029409
767 Ga0070688_100129437
768 Ga0070688_100561605
769 Ga0070659_100008721
770 Ga0070703_10133275
771 Ga0070714_100138421
772 Ga0070710_10222214
773 Ga0070701_10001339
774 Ga0070701_10618097
775 Ga0070701_10667492
776 Ga0070701_10812583
777 Ga0070711_100551685
778 Ga0070705_100000265
779 Ga0070705_100097001
780 Ga0070700_100000808
781 Ga0070700_100074034
782 Ga0070700_100131184
783 Ga0070694_100000487
784 Ga0070694_100006056
785 Ga0070694_100067266
786 Ga0070694_100363167
787 Ga0070694_100415599
788 Ga0070694_100787498
789 Ga0070694_101531942
790 Ga0070708_100088082
791 Ga0070708_100694446
792 Ga0070663_100000014
793 Ga0070678_100119202
794 Ga0070662_100268672
795 Ga0070681_10003339
796 Ga0070681_10030554
797 Ga0070681_10386576
798 Ga0070681_10480156
799 Ga0068867_100001461
800 Ga0068867_100002422
801 Ga0068867_100136466
802 Ga0070706_100633279
803 Ga0070707_100095500
804 Ga0070707_100612897
805 Ga0070707_101750112
806 Ga0070698_100013158
807 Ga0070699_100012656
808 Ga0070699_100089413
809 Ga0070699_100639568
810 Ga0070699_101191074
811 Ga0070679_100016118
812 Ga0070679_100041766
813 Ga0070679_101691552
814 Ga0070684_100023971
815 Ga0070697_100013839
816 Ga0070697_100261302
817 Ga0070697_100295805
818 Ga0070697_100404660
819 Ga0068853_100155893
820 Ga0070672_100106815
821 Ga0070672_100343206
822 Ga0070672_100365153
823 Ga0070686_100002118
824 Ga0070686_100034494
825 Ga0070686_100048789
826 Ga0070686_100133755
827 Ga0070686_100406643
828 Ga0070686_100438211
829 Ga0070686_100438266
830 Ga0070695_100017443
831 Ga0070695_100053221
832 Ga0070695_100172235
833 Ga0070695_100422832
834 Ga0070696_100002664
835 Ga0070696_100008574
836 Ga0070696_100035595
837 Ga0070696_100078110
838 Ga0070696_100110338
839 Ga0070696_100263396
840 Ga0070693_100000572
841 Ga0070693_100495498
842 Ga0070665_100239494
843 Ga0070704_100004486
844 Ga0070704_100075985
845 Ga0070704_100077676
846 Ga0070704_100325795
847 Ga0070704_100443939
848 Ga0070704_100447002
849 Ga0070704_100694236
850 Ga0070704_100713115
851 Ga0068855_100021017
852 Ga0068855_102259210
853 Ga0070664_100000001
854 Ga0068857_100200767
855 Ga0068857_101170594
856 Ga0068854_100000060
857 Ga0068854_100001366
858 Ga0068856_100002389
859 Ga0068856_100015255
860 Ga0068856_100274500
861 Ga0070702_100000549
862 Ga0070702_100015630
863 Ga0070702_100109703
864 Ga0070702_100245382
865 Ga0070702_100379389
866 Ga0068859_100006355
867 Ga0068859_100007406
868 Ga0068859_100125553
869 Ga0068859_100875469
870 Ga0068864_100267895
871 Ga0068866_10001404
872 Ga0068861_100001259
873 Ga0068861_100086906
874 Ga0068861_100347441
875 Ga0068861_100819210
876 Ga0068861_101011724
877 Ga0068870_10007073
878 Ga0068870_10050112
879 Ga0068863_101224256
880 Ga0068858_100011076
881 Ga0068858_100093983
882 Ga0068860_100005017
883 Ga0068860_100144908
884 Ga0068860_101549126
885 Ga0068862_100007279
886 Ga0068862_100015960
887 Ga0068862_100043395
888 Ga0081538_10242326
889 Ga0081539_10000178
890 Ga0075364_10547573
891 Ga0070716_100314281
892 Ga0070716_100478497
893 Ga0097621_100001204
894 Ga0068871_100003749
895 Ga0068871_100009875
896 Ga0068871_100500002
897 Ga0075428_100014581
898 Ga0075428_100086635
899 Ga0075428_100196196
900 Ga0075428_101030109
901 Ga0075430_100005177
902 Ga0075430_100007114
903 Ga0075430_100248328
904 Ga0075430_100624836
905 Ga0075431_100013405
906 Ga0075431_100108829
907 Ga0075431_100163533
908 Ga0075431_100265363
909 Ga0075431_100482374
910 Ga0075433_10009792
911 Ga0075433_10307423
912 Ga0075433_10365202
913 Ga0075433_10441785
914 Ga0075433_10520394
915 Ga0075434_100000054
916 Ga0075434_100053762
917 Ga0075434_100211123
918 Ga0075434_100252037
919 Ga0075434_100795991
920 Ga0075434_101192057
921 Ga0075434_101619255
922 Ga0075434_102624560
923 Ga0075429_100001558
924 Ga0075429_100253383
925 Ga0075429_100331477
926 Ga0075429_100648903
927 Ga0075429_100970982
928 Ga0068865_100002272
929 Ga0068865_100033663
930 Ga0075436_100000191
931 Ga0075436_100029700
932 Ga0075436_100040743
933 Ga0075436_100043963
934 Ga0075436_100103158
935 Ga0097620_100006355
936 Ga0097620_100007406
937 Ga0097620_100125549
938 Ga0097620_100308825
939 Ga0097620_100875499
940 Ga0075435_100007703
941 Ga0075435_100016219
942 Ga0075435_100102756
943 Ga0075435_100160379
944 Ga0075435_100576109
945 Ga0099794_10005538
946 Ga0099794_10054797
947 Ga0099794_10127020
948 Ga0099794_10162825
949 Ga0099794_10263053
950 Ga0105240_10042167
951 Ga0111539_10027130
952 Ga0111539_10048892
953 Ga0111539_10056385
954 Ga0111539_10145364
955 Ga0111539_10757746
956 Ga0111539_11858345
957 Ga0105245_10009209
958 Ga0105245_10373278
959 Ga0114129_10019188
960 Ga0114129_10021603
961 Ga0114129_10027991
962 Ga0114129_10148428
963 Ga0114129_10459692
964 Ga0114129_10518389
965 Ga0105243_10005056
966 Ga0105243_10017075
967 Ga0105243_10340543
968 Ga0105243_10698625
969 Ga0105243_11711912
970 Ga0105241_10005421
971 Ga0105241_10127166
972 Ga0105242_10002637
973 Ga0105242_10009274
974 Ga0105242_11951046
975 Ga0105238_12238818
976 Ga0105249_10013999
977 Ga0105249_10017277
978 Ga0105148_104730
979 Ga0105239_10053531
980 Ga0105246_11630363
981 Ga0157373_10023638
982 Ga0157371_10000038
983 Ga0157370_10000235
984 Ga0157369_10005312
985 Ga0157378_10006403
986 Ga0163162_10438172
987 Ga0163162_10925059
988 Ga0157372_10009815
989 Ga0157372_12967030
990 Ga0157380_10042809
991 Ga0157380_10863179
992 Ga0182008_10214848
993 Ga0157379_10051647
994 Ga0157376_10005502
995 Ga0157376_10046433
996 Ga0157376_10751167
997 Ga0157376_12517272
998 Ga0182006_1000822
999 Ga0206355_1334066
1000 Ga0206351_10877710
1001 Ga0154015_1560675
1002 Ga0224712_10040584
1003 Ga0209784_100063
1004 Ga0209566_100048
1005 Ga0209674_100071
1006 Ga0209672_100199
1007 Ga0209672_100339
1008 Ga0209147_100002
1009 Ga0209563_100085
1010 Ga0209258_100002
1011 Ga0209646_1000035
1012 Ga0209026_1007198
1013 Ga0209677_100040
1014 Ga0209148_1000077
1015 Ga0209455_1000009
1016 Ga0207682_10009446
1017 Ga0207692_10144863
1018 Ga0207692_10807205
1019 Ga0207645_10019580
1020 Ga0207643_10147691
1021 Ga0207684_10428912
1022 Ga0207654_10210663
1023 Ga0207654_10972898
1024 Ga0207707_10251237
1025 Ga0207707_10334129
1026 Ga0207695_10014931
1027 Ga0207663_10046647
1028 Ga0207660_10036796
1029 Ga0207660_10068764
1030 Ga0207662_10007715
1031 Ga0207662_10015290
1032 Ga0207662_10219845
1033 Ga0207649_10000390
1034 Ga0207652_10017538
1035 Ga0207646_10060661
1036 Ga0207659_10469401
1037 Ga0207687_10361971
1038 Ga0207700_11618130
1039 Ga0207664_10140534
1040 Ga0207644_10181249
1041 Ga0207690_10009513
1042 Ga0207686_10119849
1043 Ga0207709_10262483
1044 Ga0207709_10445919
1045 Ga0207709_10614161
1046 Ga0207670_10018788
1047 Ga0207670_10611134
1048 Ga0207670_10627901
1049 Ga0207704_10021105
1050 Ga0207665_10679498
1051 Ga0207691_10322472
1052 Ga0207691_10562761
1053 Ga0207689_10032806
1054 Ga0207689_10080433
1055 Ga0207661_10044504
1056 Ga0207679_10000003
1057 Ga0207668_10010656
1058 Ga0207640_10000071
1059 Ga0207677_10225888
1060 Ga0207703_10043469
1061 Ga0207678_10000175
1062 Ga0207708_10041598
1063 Ga0207708_10328789
1064 Ga0207708_10434420
1065 Ga0207702_10000110
1066 Ga0207702_10223684
1067 Ga0207702_10339830
1068 Ga0207648_10019329
1069 Ga0207676_10234898
1070 Ga0207674_10018440
1071 Ga0207674_10204687
1072 Ga0207674_10810947
1073 Ga0207675_100001423
1074 Ga0207675_100801853
1075 Ga0207698_11273131
1076 Ga0209969_1011499
1077 Ga0209969_1032199
1078 Ga0209969_1033102
1079 Ga0209967_1002255
1080 Ga0209981_1008910
1081 Ga0209996_1028329
1082 Ga0209984_1020835
1083 Ga0210000_1049697
1084 Ga0209995_1051575
1085 Ga0209995_1082264
1086 Ga0209968_1018927
1087 Ga0209968_1033458
1088 Ga0209983_1014370
1089 Ga0209588_1034691
1090 Ga0209588_1064050
1091 Ga0209588_1115164
1092 Ga0209971_1028785
1093 Ga0209971_1034418
1094 Ga0209971_1062490
1095 Ga0209966_1084253
1096 Ga0209998_10107977
1097 Ga0209974_10018410
1098 Ga0207428_10090265
1099 Ga0207428_10138730
1100 Ga0207428_10145863
1101 Ga0268266_10225204
1102 Ga0268265_10010401
1103 Ga0268265_11019168
1104 Ga0268264_10163650
1105 Ga0265330_10248899
1106 Ga0307408_100501740
1107 Ga0307408_100555027
1108 Ga0307408_101424408
1109 Ga0316575_10002030
1110 Ga0316575_10008219
1111 Ga0316579_10008523
1112 Ga0316578_10003341
1113 Ga0307405_10208405
1114 Ga0307405_11020413
1115 Ga0307407_10089670
1116 Ga0307409_100058363
1117 Ga0307416_100067333
1118 Ga0307416_100069155
1119 Ga0307416_100433234
1120 Ga0307416_100778301
1121 Ga0307414_10795827
1122 Ga0316583_10004230
1123 Ga0373930_0008402
1124 Ga0373930_0050225
1125 Ga0373948_0027291
1126 Ga0373950_0050977
1127 Ga0373958_0013225
1128 Ga0373959_0198743
1129 Ga0373938_0118743
1130 Ga0373938_0248396
1131 Ga0373929_0016248
1132 Ga0373929_0119955
1133 Ga0373934_0024261
1134 Ga0373949_0004367
1135 Ga0373951_0168636
1136 Ga0373923_0027939
1137 Ga0373923_0259317
1138 Ga0373932_0001506
1139 Ga0373932_0101589
1140 Ga0373936_0107985
1141 Ga0373939_0270459
1142 Ga0373941_0028703
1143 Ga0373941_0047955
1144 Ga0373941_0154887
1145 Ga0373945_0121471
1146 Ga0373954_0013891
1147 Ga0373954_0255825
1148 Ga0373956_0090984
1149 Ga0373957_0006042
1150 Ga0373957_0037986
1151 Ga0373960_0010608
1152 Ga0373960_0034660
1153 Ga0373946_0084563
1154 Ga0373955_0003525
1155 Ga0373942_0197711
1156 Ga0373962_0009261
1157 Ga0373962_0088550
1158 Ga0316574_0020683
1159 Ga0316574_0440768
1160 Ga0373924_0057844
1161 Ga0373924_0122337
1162 Ga0373931_0003664
1163 Ga0373931_0007929
1164 Ga0373931_0108348
1165 Ga0373931_0158918
1166 Ga0373931_0401737
1167 Ga0373935_0008042
1168 Ga0373935_0076433
1169 Ga0373927_0016891
1170 Ga0373933_0162944
1171 Ga0373947_0043198
1172 Ga0373947_0201349
1173 Ga0373937_0033346
1174 Ga0373937_0174309
1175 Ga0373937_0265886
1176 Ga0373937_1710290
1177 Ga0373925_0031887
1178 Ga0373925_0303514
1179 Ga0395905_0061224
1180 Ga0395905_0418532
1181 Ga0316581_0040054
1182 Ga0436360_0367255
1183 Ga0436360_1335703
1184 Ga0439436_0007812
1185 Ga0439439_0013372
1186 Ga0439453_0009699
1187 Ga0439466_0188172
1188 Ga0451807_1338436
1189 Ga0451835_0209263
1190 Ga0439441_000602
1191 Ga0439441_002387
1192 Ga0439441_025085
1193 Ga0439443_085144
1194 Ga0439456_007504
1195 Ga0450913_014481
1196 Ga0450910_053607
1197 Ga0439446_0000284
1198 Ga0439446_0068129
1199 Ga0439434_0001978
1200 Ga0439435_0000115
1201 Ga0439435_0060903
1202 Ga0439444_0001979
1203 Ga0439460_0026202
1204 Ga0451577_0008376
1205 Ga0451577_0422668
1206 Ga0451577_1885511
1207 Ga0466986_0107369
1208 Ga0466969_0024739
1209 Ga0466972_0070829
1210 Ga0453683_0002860
1211 Ga0466961_0015282
1212 Ga0466963_0229864
1213 Ga0466964_0010465
1214 Ga0453684_0027489
1215 Ga0453684_0126636
1216 Ga0453684_0276244
1217 Ga0466970_0002402
1218 Ga0466957_0053022
1219 Ga0466960_0578794
1220 Ga0466959_0020872
1221 Ga0451576_0008921
1222 Ga0451576_0015418
1223 Ga0451576_0024041
1224 Ga0451576_0148441
1225 Ga0451576_0162038
1226 Ga0451576_0374897
1227 Ga0451576_1062916
1228 Ga0451576_1162444
1229 Ga0466967_0025692
1230 Ga0466967_0054089
1231 Ga0466967_0067551
1232 Ga0495592_0004799
1233 Ga0495592_0429221
1234 Ga0495641_0003195
1235 Ga0495651_0008782
1236 Ga0495651_0578846
1237 Ga0495653_0081977
1238 Ga0495580_0044125
1239 Ga0495582_0077789
1240 Ga0495662_0014094
1241 Ga0495664_0065984
1242 Ga0495594_0021119
1243 Ga0495608_0261649
1244 Ga0495608_0605686
1245 Ga0495618_0082530
1246 Ga0495618_0689376
1247 Ga0495628_0014603
1248 Ga0495628_0419936
1249 Ga0495630_0028698
1250 Ga0495630_0416087
1251 Ga0495630_0457606
1252 Ga0495663_0163795
1253 Ga0495666_0007092
1254 Ga0495642_0042873
1255 Ga0495642_0073964
1256 Ga0495652_0023629
1257 Ga0495652_0475407
1258 Ga0495652_0851775
1259 Ga0495665_0027889
1260 Ga0495640_0010072
1261 Ga0495587_0185409
1262 Ga0495598_0164266
1263 Ga0495609_0330278
1264 Ga0495621_0066165
1265 Ga0495622_0011378
1266 Ga0495667_0150380
1267 Ga0495634_0003739
1268 Ga0495635_0041979
1269 Ga0495659_0043419
1270 Ga0495657_0031074
1271 Ga0495623_0450060
1272 Ga0495647_0006231
1273 Ga0495669_0010765
1274 Ga0495613_0028375
1275 Ga0495624_0058072
1276 Ga0495600_0002894
1277 Ga0495600_0778644
1278 Ga0495604_0028704
1279 Ga0495674_0008749
1280 Ga0495680_0007165
1281 Ga0495680_0417695
1282 Ga0495675_0004856
1283 Ga0495684_0030932
1284 Ga0495593_0058632
1285 Ga0496104_1329721
1286 Ga0496125_0065328
1287 Ga0501290_037299
1288 Ga0501291_015307
1289 Ga0501291_029370
1290 Ga0501292_091358
1291 Ga0501298_062509
1292 Ga0501298_075808
1293 Ga0501299_017418
1294 Ga0501031_0048043
1295 Ga0501031_0525465
1296 Ga0501031_0591094
1297 Ga0501032_0040774
1298 Ga0501032_0180066
1299 Ga0501033_0014575
1300 Ga0501036_0057134
1301 Ga0501036_0160882
1302 Ga0501037_0192564
1303 Ga0501037_0459196
1304 Ga0501038_0001514
1305 Ga0501038_1009692
1306 Ga0501039_0012358
1307 Ga0501040_0025733
1308 Ga0501040_0154218
1309 Ga0501040_0480474
1310 Ga0501040_0644125
1311 Ga0501041_0000814
1312 Ga0501042_0000247
1313 Ga0501042_0096937
1314 Ga0501043_0048684
1315 Ga0501043_0646402
1316 Ga0501046_0000518
1317 Ga0501046_0021553
1318 Ga0501046_0304141
1319 Ga0501046_0335663
1320 Ga0501046_0947416
1321 Ga0501048_0043437
1322 Ga0501048_0181597
1323 Ga0501048_0568528
1324 Ga0501048_0672938
1325 Ga0501067_0086038
1326 Ga0501068_0023737
1327 Ga0501068_0531535
1328 Ga0501069_0233341
1329 Ga0501070_0031205
1330 Ga0501071_0036242
1331 Ga0501071_0072410
1332 Ga0501071_0132971
1333 Ga0501071_0439060
1334 Ga0501071_0667651
1335 Ga0501072_0124521
1336 Ga0501072_0636561
1337 Ga0501073_0191253
1338 Ga0501073_0213617
1339 Ga0501073_0505312
1340 Ga0501074_0018228
1341 Ga0501074_0383383
1342 Ga0501075_0026710
1343 Ga0501075_0029151
1344 Ga0501075_0042612
1345 Ga0501075_0573545
1346 Ga0501076_0043736
1347 Ga0501076_0053640
1348 Ga0501076_0488012
1349 Ga0501077_0002988
1350 Ga0501207_050820
1351 Ga0501208_131698
1352 Ga0501211_014420
1353 Ga0501211_049027
1354 Ga0501216_118647
1355 Ga0501217_105135
1356 Ga0501227_171949
1357 Ga0501233_068494
1358 Ga0501233_122567
1359 Ga0501236_044128
1360 Ga0501249_176912
1361 Ga0501079_0018674
1362 Ga0501079_0161813
1363 Ga0501079_0851686
1364 Ga0501080_0001187
1365 Ga0501080_0099974
1366 Ga0501081_0000242
1367 Ga0501081_0105030
1368 Ga0501263_015087
1369 Ga0501283_105219
1370 Ga0501035_0061820
1371 Ga0501035_0451921
1372 Ga0501045_0010748
1373 Ga0501045_0293196
1374 Ga0501045_0742242
1375 nmdc:mga00v17_772477_c1
1376 nmdc:mga0k408_184055_c1
1377 nmdc:mga05p37_1000294_c1
1378 nmdc:mga05p37_14145_c1
1379 nmdc:mga05p37_283135_c1
1380 nmdc:mga05p37_28628_c1
1381 nmdc:mga05p37_510357_c1
1382 nmdc:mga09592_342799_c1
1383 nmdc:mga09592_4216_c1
1384 nmdc:mga09592_902899_c1
1385 nmdc:mga0qj67_13244_c1
1386 nmdc:mga0qj67_18191_c1
1387 nmdc:mga0qj67_345772_c1
1388 nmdc:mga0qj67_94522_c1
1389 nmdc:mga06r32_233807_c1
1390 nmdc:mga06r32_238407_c1
1391 nmdc:mga06r32_260460_c1
1392 nmdc:mga06r32_318875_c1
1393 nmdc:mga06r32_8481_c1
1394 nmdc:mga06r32_96691_c1
1395 nmdc:mga08y16_145604_c1
1396 nmdc:mga08y16_155202_c1
1397 nmdc:mga08y16_27578_c1
1398 nmdc:mga08y16_36800_c1
1399 nmdc:mga08y16_64521_c1
1400 nmdc:mga0n895_123161_c1
1401 nmdc:mga0n895_254963_c1
1402 nmdc:mga0n895_4086_c1
1403 nmdc:mga0n895_5776_c1
1404 nmdc:mga0rr50_1244214_c1
1405 nmdc:mga0rr50_1458490_c1
1406 nmdc:mga0rr50_190046_c1
1407 nmdc:mga0rr50_20110_c1
1408 nmdc:mga0rr50_21407_c1
1409 nmdc:mga0rr50_265625_c1
1410 nmdc:mga0rr50_457525_c1
1411 nmdc:mga0rr50_5238_c1
1412 nmdc:mga0rr50_9340_c1
1413 nmdc:mga08x19_170594_c1
1414 nmdc:mga08x19_28183_c1
1415 nmdc:mga08x19_662_c1
1416 nmdc:mga0a205_1190729_c1
1417 nmdc:mga0a205_23253_c1
1418 nmdc:mga0a205_35527_c2
1419 nmdc:mga0a205_36516_c1
1420 nmdc:mga0a205_383004_c1
1421 nmdc:mga0a205_420427_c1
1422 nmdc:mga0a205_500496_c1
1423 nmdc:mga0a205_895196_c1
1424 Ga0495595_0006295
1425 Ga0495619_0012782
1426 Ga0500607_020374
1427 Ga0500559_0260007
1428 Ga0500636_0000831
1429 Ga0500637_0051975
1430 Ga0500625_006128
1431 Ga0501084_0058218
1432 Ga0501084_0068229
1433 Ga0501084_0192170
1434 Ga0501084_0950490
1435 Ga0590071_019827
1436 Ga0590077_008634
1437 Ga0501082_0009783
1438 Ga0501082_0107962
1439 Ga0501082_0135948
1440 Ga0466962_0074319
1441 Ga0530510_0000121
1442 Ga0530510_0056363

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

38

158

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fu4-assembly1.cif.gz_A crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) 0.9507 4 81
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9137 17 83
2fu4-assembly1.cif.gz_A crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) 0.9063 4 81
5l0p-assembly1.cif.gz_A-2 symmetry-based assembly of a two-dimensional protein lattice 0.904 1 81
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8976 18 81
ID Description Score Start End Superfamily
2fu4B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9545 4 81 1.10.10.10
2w57B02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;Ferric-uptake regulator, C-terminal dimerisarion domain 0.9389 86 132 3.30.1490.190
2o03A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9247 17 80 1.10.10.10
af_A4I343_8_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9193 17 83 1.10.10.10
3mwmB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9137 13 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1T2LA48-F1-model_v4 Ferric uptake regulation protein 0.9689 7 140 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900705
AF-A0A1H9M277-F1-model_v4 Ferric uptake regulation protein 0.963 1 133 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900705
AF-A0A257R194-F1-model_v4 Ferric uptake regulation protein 0.9584 25 133 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900705
AF-A0A378JGA3-F1-model_v4 Ferric uptake regulation protein 0.9556 4 133 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900705
AF-A0A328ZGK3-F1-model_v4 Ferric uptake regulation protein 0.9542 1 142 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900705

Map