F477295

General Info

Members Datasets Scaffolds Average Seq Length
720 388 674 201

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10219672|Ga0068870_102196722
Length 216
Sequence MKKIVIATNNVGKLNEIGAILAPLDIEIVAQSTLGVTEAAEPHCTFIENALAKARHASAQTGLPALADDSGICVDALNGAPGVHSARFAGESAQAAGGRASQDARNNQKLLDALAHETNRNAHYYCVIVLTRRADDPQPLVCEAEWHGEIVKTPRGSGGFGYDPLFLIPALNKTGAELGPEEKNRISHRGQALAALSAKLAGSRIEDRGSRTPRRR

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221658 Variovorax sp. Root411 Isolate Unclassified
9 2643221672 Variovorax sp. Root434 Isolate Unclassified
10 2643221683 Variovorax sp. Root473 Isolate Unclassified
11 2738541277 Variovorax sp. GV051 Isolate Unclassified
12 2738541307 Variovorax sp. GV008 Isolate Unclassified
13 2738543013 Variovorax sp. BT01 Isolate Unclassified
14 2738543019 Variovorax sp. GV040 Isolate Unclassified
15 2818991446 Variovorax sp. 1180 Isolate Unclassified
16 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
17 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
18 2842677519 Variovorax sp. R-72495 Isolate Unclassified
19 2842733646 Variovorax sp. R-72446 Isolate Unclassified
20 2842747753 Variovorax sp. R-72060 Isolate Unclassified
21 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
22 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
23 2885198086 Variovorax sp. 679 Isolate Unclassified
24 2885211737 Variovorax sp. 553 Isolate Unclassified
25 2899924645 Variovorax sp. 369 Isolate Unclassified
26 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
27 2904456579 Variovorax sp. 2002 Isolate Unclassified
28 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
32 2928037797 Variovorax sp. 1126 Isolate Unclassified
33 2928044640 Variovorax sp. 1128 Isolate Unclassified
34 2928051484 Variovorax sp. 1133 Isolate Unclassified
35 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
36 2928070936 Variovorax gossypii 1167 Isolate Unclassified
37 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
38 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
39 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
40 2929520902 Variovorax beijingensis 502 Isolate Unclassified
41 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
42 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
43 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
44 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
45 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
46 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
47 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
48 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
49 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
50 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
56 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
67 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
72 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
73 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
76 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
80 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
81 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
94 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
95 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
107 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
115 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
121 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
127 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
128 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
150 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
159 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
215 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
216 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
230 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
256 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
261 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
262 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
267 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
268 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
269 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
270 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
271 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
272 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
273 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
274 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
275 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
276 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
277 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
278 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
279 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
280 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
281 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
282 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
283 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
284 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
295 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
298 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
306 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
307 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
308 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
316 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
317 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
318 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
319 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
329 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
369 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
370 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
371 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
372 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
373 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
374 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
375 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
376 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
377 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
380 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
381 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
382 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
383 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
384 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
385 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
386 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
387 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
388 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.06
Metatranscriptomes 0.56
Isolates 6.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.53
Nodule 0.56
Rhizoplane 1.94
Rhizosphere 60.69
Stem 0
Stem Tuber 0
Unclassified 10.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014457 3300001979 Bacteria 2911
2 JGI25152J39213_1001872 3300002773 Bacteria 8458
3 JGI25152J39213_1013199 3300002773 Bacteria 1732
4 JGI25150J39212_1000863 3300002774 Bacteria 10077
5 JGI25150J39212_1005077 3300002774 Bacteria 2845
6 JGI25159J45721_1001848 3300002987 Bacteria 8458
7 JGI25159J45721_1011405 3300002987 Bacteria 2181
8 JGI25151J46595_10000224 3300003187 Bacteria 67033
9 JGI25151J46595_10003612 3300003187 Bacteria 8458
10 JGI25151J46595_10055825 3300003187 Bacteria 1300
11 JGI25153J46596_10000570 3300003215 Bacteria 22743
12 JGI25153J46596_10045861 3300003215 Bacteria 1300
13 JGI25160J50197_1002537 3300003354 Bacteria 8458
14 JGI25160J50197_1010940 3300003354 Bacteria 3252
15 JGI25161J50226_1004265 3300003374 Bacteria 3032
16 JGI25161J50226_1004510 3300003374 Bacteria 2903
17 Ga0006562J51391_1130119 3300003578 Bacteria 1680
18 Ga0006562J51391_1130120 3300003578 Bacteria 800
19 Ga0006562J51391_1140775 3300003578 Bacteria 4680
20 Ga0006562J51391_1140777 3300003578 Bacteria 4120
21 Ga0055532_1009987 3300003758 Bacteria 1143
22 Ga0055535_1000750 3300003761 Bacteria 24203
23 Ga0055542_1000583 3300003762 Bacteria 31637
24 Ga0055529_1001011 3300003763 Bacteria 13521
25 Ga0055526_1003328 3300003771 Bacteria 10278
26 Ga0055526_1006106 3300003771 Bacteria 6650
27 Ga0055537_1000049 3300003773 Bacteria 87244
28 Ga0055537_1002248 3300003773 Bacteria 6650
29 Ga0055537_1014400 3300003773 Bacteria 1438
30 Ga0055524_1002965 3300003775 Bacteria 8458
31 Ga0055524_1003751 3300003775 Bacteria 7250
32 Ga0055536_1002470 3300003781 Bacteria 10381
33 Ga0055536_1008143 3300003781 Bacteria 4563
34 Ga0055536_1008959 3300003781 Bacteria 4217
35 Ga0055536_1057229 3300003781 Bacteria 823
36 Ga0055534_1000049 3300003784 Bacteria 92974
37 Ga0055534_1000343 3300003784 Bacteria 30091
38 Ga0055534_1002329 3300003784 Bacteria 6650
39 Ga0055534_1003905 3300003784 Bacteria 4518
40 Ga0055528_1001187 3300003790 Bacteria 16830
41 Ga0055528_1004551 3300003790 Bacteria 6650
42 Ga0055528_1030326 3300003790 Bacteria 1438
43 Ga0055530_10000318 3300003791 Bacteria 43641
44 Ga0055530_10027635 3300003791 Bacteria 1546
45 Ga0055530_10031974 3300003791 Bacteria 1374
46 Ga0055540_1001928 3300003792 Bacteria 11588
47 Ga0055540_1003384 3300003792 Bacteria 7728
48 Ga0055540_1004195 3300003792 Bacteria 6636
49 Ga0055540_1006573 3300003792 Bacteria 4583
50 Ga0055540_1007675 3300003792 Bacteria 4022
51 Ga0055540_1025065 3300003792 Bacteria 1467
52 Ga0055540_1037495 3300003792 Bacteria 1068
53 Ga0055531_10000738 3300003794 Bacteria 27594
54 Ga0055531_10002357 3300003794 Bacteria 12698
55 Ga0055531_10007991 3300003794 Bacteria 5658
56 Ga0055531_10021737 3300003794 Bacteria 2475
57 Ga0055543_1001645 3300004625 Bacteria 8512
58 Ga0055543_1002190 3300004625 Bacteria 6700
59 Ga0065165_1003399 3300005262 Bacteria 11243
60 Ga0065714_10003219 3300005288 Bacteria 12731
61 Ga0065704_10275364 3300005289 Bacteria 934
62 Ga0070658_10220642 3300005327 Bacteria 1603
63 Ga0070676_10304541 3300005328 Bacteria 1081
64 Ga0070670_100194010 3300005331 Bacteria 1764
65 Ga0070670_100465219 3300005331 Bacteria 1122
66 Ga0070670_100570772 3300005331 Bacteria 1010
67 Ga0068869_100821021 3300005334 Bacteria 800
68 Ga0068868_100014255 3300005338 Bacteria 5854
69 Ga0068868_100164794 3300005338 Bacteria 1832
70 Ga0070661_100068133 3300005344 Bacteria 2616
71 Ga0070692_10292517 3300005345 Bacteria 991
72 Ga0070668_100111555 3300005347 Bacteria 2177
73 Ga0070668_100130668 3300005347 Bacteria 2015
74 Ga0070669_100043608 3300005353 Bacteria 3268
75 Ga0070669_100131849 3300005353 Bacteria 1918
76 Ga0070669_100262967 3300005353 Bacteria 1377
77 Ga0070669_100361837 3300005353 Bacteria 1180
78 Ga0070675_100041967 3300005354 Bacteria 3737
79 Ga0070671_100129474 3300005355 Bacteria 2125
80 Ga0070674_100318253 3300005356 Bacteria 1246
81 Ga0070674_100612924 3300005356 Bacteria 921
82 Ga0070673_100365501 3300005364 Bacteria 1283
83 Ga0070667_100290148 3300005367 Bacteria 1471
84 Ga0070701_10007392 3300005438 Bacteria 4691
85 Ga0070700_100612691 3300005441 Bacteria 854
86 Ga0070663_100197648 3300005455 Bacteria 1568
87 Ga0070678_100028025 3300005456 Bacteria 3834
88 Ga0070678_100049560 3300005456 Bacteria 3031
89 Ga0070678_100052297 3300005456 Bacteria 2965
90 Ga0070678_100454674 3300005456 Bacteria 1122
91 Ga0070678_100506453 3300005456 Bacteria 1066
92 Ga0070662_100026306 3300005457 Bacteria 4028
93 Ga0068867_100168784 3300005459 Bacteria 1731
94 Ga0068867_100259949 3300005459 Bacteria 1415
95 Ga0068867_100423233 3300005459 Bacteria 1128
96 Ga0068867_100687106 3300005459 Bacteria 902
97 Ga0070685_10113354 3300005466 Bacteria 1674
98 Ga0070706_100059087 3300005467 Bacteria 3539
99 Ga0070698_100552296 3300005471 Bacteria 1091
100 Ga0068853_100823620 3300005539 Bacteria 889
101 Ga0070672_100295833 3300005543 Bacteria 1371
102 Ga0070693_100830647 3300005547 Bacteria 687
103 Ga0070665_100234720 3300005548 Bacteria 1834
104 Ga0070665_100488021 3300005548 Bacteria 1243
105 Ga0070665_100662473 3300005548 Bacteria 1057
106 Ga0070704_100011744 3300005549 Bacteria 5383
107 Ga0070704_100085589 3300005549 Bacteria 2333
108 Ga0068855_100112017 3300005563 Bacteria 3131
109 Ga0068855_100175809 3300005563 Bacteria 2423
110 Ga0070664_100067201 3300005564 Bacteria 3064
111 Ga0068857_100064951 3300005577 Bacteria 3245
112 Ga0068854_100194092 3300005578 Bacteria 1592
113 Ga0068854_100244746 3300005578 Bacteria 1430
114 Ga0068856_100334978 3300005614 Bacteria 1531
115 Ga0068864_100444163 3300005618 Bacteria 1239
116 Ga0068864_100555712 3300005618 Bacteria 1110
117 Ga0068866_10362257 3300005718 Bacteria 924
118 Ga0068861_100026271 3300005719 Bacteria 4232
119 Ga0068851_10011783 3300005834 Bacteria 4107
120 Ga0068870_10219672 3300005840 Bacteria 1162
121 Ga0068863_100047683 3300005841 Bacteria 4063
122 Ga0068863_100132321 3300005841 Bacteria 2381
123 Ga0068863_100155513 3300005841 Bacteria 2189
124 Ga0068860_100114582 3300005843 Bacteria 2577
125 Ga0068862_100109907 3300005844 Bacteria 2419
126 Ga0068862_100427324 3300005844 Bacteria 1244
127 Ga0075363_100017180 3300006048 Bacteria 3584
128 Ga0075363_100065074 3300006048 Bacteria 1970
129 Ga0075363_100171738 3300006048 Bacteria 1231
130 Ga0075363_100264430 3300006048 Bacteria 993
131 Ga0075363_100280042 3300006048 Bacteria 965
132 Ga0075432_10074273 3300006058 Bacteria 1225
133 Ga0075432_10108319 3300006058 Bacteria 1033
134 Ga0075362_10002978 3300006177 Bacteria 5825
135 Ga0075362_10013006 3300006177 Bacteria 3320
136 Ga0075362_10019237 3300006177 Bacteria 2837
137 Ga0075369_10218994 3300006186 Bacteria 881
138 Ga0075366_10072694 3300006195 Bacteria 2049
139 Ga0075366_10080886 3300006195 Bacteria 1940
140 Ga0075366_10100065 3300006195 Bacteria 1739
141 Ga0075366_10105913 3300006195 Bacteria 1690
142 Ga0075366_10124003 3300006195 Bacteria 1558
143 Ga0075366_10190135 3300006195 Bacteria 1248
144 Ga0097621_100030530 3300006237 Bacteria 4267
145 Ga0097621_100246691 3300006237 Bacteria 1563
146 Ga0097621_100797262 3300006237 Bacteria 875
147 Ga0075370_10001034 3300006353 Bacteria 11554
148 Ga0075370_10003779 3300006353 Bacteria 7244
149 Ga0075370_10023982 3300006353 Bacteria 3365
150 Ga0075370_10065741 3300006353 Bacteria 2068
151 Ga0075370_10071851 3300006353 Bacteria 1980
152 Ga0068871_100033921 3300006358 Bacteria 4045
153 Ga0068871_100615614 3300006358 Bacteria 989
154 Ga0075430_100101548 3300006846 Bacteria 2401
155 Ga0075431_100299414 3300006847 Bacteria 1625
156 Ga0075434_100053749 3300006871 Bacteria 4002
157 Ga0075429_100782157 3300006880 Bacteria 836
158 Ga0075436_100622679 3300006914 Bacteria 796
159 Ga0099826_10114653 3300006948 Bacteria 1599
160 Ga0105244_10036366 3300009036 Bacteria 2580
161 Ga0105244_10166189 3300009036 Bacteria 1052
162 Ga0105245_10033012 3300009098 Bacteria 4584
163 Ga0105243_10001140 3300009148 Bacteria 24116
164 Ga0105243_10014072 3300009148 Bacteria 6054
165 Ga0105243_10030230 3300009148 Bacteria 4168
166 Ga0105241_10031745 3300009174 Bacteria 3955
167 Ga0105242_10283450 3300009176 Bacteria 1506
168 Ga0105242_11564768 3300009176 Bacteria 692
169 Ga0105248_10206365 3300009177 Bacteria 2214
170 Ga0105248_10561826 3300009177 Bacteria 1287
171 Ga0105239_10577955 3300010375 Bacteria 1281
172 Ga0105239_11018428 3300010375 Bacteria 952
173 Ga0105246_10069698 3300011119 Bacteria 2471
174 Ga0157347_1009909 3300012502 Bacteria 993
175 Ga0157373_10095661 3300013100 Bacteria 2091
176 Ga0157370_10002450 3300013104 Bacteria 22388
177 Ga0157370_10240479 3300013104 Bacteria 1675
178 Ga0157374_10180187 3300013296 Bacteria 2063
179 Ga0163162_11125515 3300013306 Bacteria 890
180 Ga0157375_10111027 3300013308 Bacteria 2840
181 Ga0157375_10789500 3300013308 Bacteria 1099
182 Ga0157375_10822204 3300013308 Bacteria 1077
183 Ga0163163_10126096 3300014325 Bacteria 2598
184 Ga0163163_10625101 3300014325 Bacteria 1140
185 Ga0163163_10676364 3300014325 Bacteria 1096
186 Ga0157380_10199150 3300014326 Bacteria 1775
187 Ga0182008_10000225 3300014497 Bacteria 44301
188 Ga0182008_10011230 3300014497 Bacteria 4772
189 Ga0182008_10014507 3300014497 Bacteria 4125
190 Ga0182008_10019854 3300014497 Bacteria 3464
191 Ga0182008_10040078 3300014497 Bacteria 2340
192 Ga0182008_10259584 3300014497 Bacteria 898
193 Ga0157379_10014445 3300014968 Bacteria 6930
194 Ga0157379_10512770 3300014968 Bacteria 1112
195 Ga0157376_10038395 3300014969 Bacteria 3896
196 Ga0157376_10082225 3300014969 Bacteria 2767
197 Ga0157376_10354467 3300014969 Bacteria 1405
198 Ga0157376_10405592 3300014969 Bacteria 1319
199 Ga0157376_10940372 3300014969 Bacteria 884
200 Ga0182006_1010162 3300015261 Bacteria 4195
201 Ga0182006_1041803 3300015261 Bacteria 1798
202 Ga0182007_10003534 3300015262 Bacteria 7361
203 Ga0182007_10020624 3300015262 Bacteria 2353
204 Ga0182005_1016595 3300015265 Bacteria 2046
205 Ga0182005_1039584 3300015265 Bacteria 1282
206 Ga0183362_10005 3300015683 Bacteria 437616
207 Ga0163161_10000114 3300017792 Bacteria 76397
208 Ga0163161_10051863 3300017792 Bacteria 2973
209 Ga0163161_10101427 3300017792 Bacteria 2143
210 Ga0163161_10232667 3300017792 Bacteria 1430
211 Ga0163161_10241309 3300017792 Bacteria 1405
212 Ga0163161_10288442 3300017792 Bacteria 1289
213 Ga0163161_10679700 3300017792 Bacteria 855
214 Ga0163161_11266573 3300017792 Bacteria 640
215 Ga0213872_10005990 3300021361 Bacteria 6162
216 Ga0209672_100477 3300025228 Bacteria 22499
217 Ga0209147_101499 3300025229 Bacteria 8245
218 Ga0209258_100568 3300025242 Bacteria 31666
219 Ga0207425_1000069 3300025245 Bacteria 120895
220 Ga0207425_1007005 3300025245 Bacteria 3028
221 Ga0209148_1000033 3300025254 Bacteria 555508
222 Ga0209129_1000233 3300025258 Bacteria 61174
223 Ga0209129_1001166 3300025258 Bacteria 15152
224 Ga0209129_1006462 3300025258 Bacteria 3778
225 Ga0209565_1000020 3300025263 Bacteria 432627
226 Ga0209565_1000171 3300025263 Bacteria 84566
227 Ga0209565_1007159 3300025263 Bacteria 3038
228 Ga0209565_1047747 3300025263 Bacteria 778
229 Ga0209455_1000819 3300025272 Bacteria 16921
230 Ga0209673_1000295 3300025273 Bacteria 92499
231 Ga0209673_1000301 3300025273 Bacteria 91435
232 Ga0209673_1004394 3300025273 Bacteria 7572
233 Ga0209673_1009432 3300025273 Bacteria 4226
234 Ga0209673_1020108 3300025273 Bacteria 2373
235 Ga0209673_1020941 3300025273 Bacteria 2300
236 Ga0209130_1000193 3300025284 Bacteria 84550
237 Ga0209130_1000366 3300025284 Bacteria 51201
238 Ga0209130_1001843 3300025284 Bacteria 12207
239 Ga0209130_1025709 3300025284 Bacteria 1272
240 Ga0209675_1000014 3300025291 Bacteria 421902
241 Ga0209675_1000236 3300025291 Bacteria 55143
242 Ga0209675_1000582 3300025291 Bacteria 26359
243 Ga0209675_1006428 3300025291 Bacteria 4709
244 Ga0209675_1008038 3300025291 Bacteria 3940
245 Ga0209676_1000048 3300025292 Bacteria 403716
246 Ga0209676_1000098 3300025292 Bacteria 234305
247 Ga0209676_1000123 3300025292 Bacteria 195351
248 Ga0209676_1013512 3300025292 Bacteria 3136
249 Ga0209676_1018047 3300025292 Bacteria 2473
250 Ga0209676_1023673 3300025292 Bacteria 2005
251 Ga0209676_1043481 3300025292 Bacteria 1239
252 Ga0209676_1050949 3300025292 Bacteria 1088
253 Ga0209025_1000204 3300025294 Bacteria 142193
254 Ga0209025_1000264 3300025294 Bacteria 123411
255 Ga0209025_1000348 3300025294 Bacteria 100228
256 Ga0209025_1005823 3300025294 Bacteria 9873
257 Ga0209025_1019355 3300025294 Bacteria 3789
258 Ga0209025_1019870 3300025294 Bacteria 3710
259 Ga0209564_1000231 3300025295 Bacteria 123417
260 Ga0209564_1002077 3300025295 Bacteria 17219
261 Ga0209758_1000222 3300025297 Bacteria 123411
262 Ga0209758_1051551 3300025297 Bacteria 1431
263 Ga0209050_1000012 3300025298 Bacteria 813717
264 Ga0209050_1001339 3300025298 Bacteria 27306
265 Ga0209050_1033105 3300025298 Bacteria 1574
266 Ga0209050_1035197 3300025298 Bacteria 1484
267 Ga0209256_1000095 3300025299 Bacteria 206120
268 Ga0209256_1000284 3300025299 Bacteria 89178
269 Ga0209256_1016014 3300025299 Bacteria 2583
270 Ga0207426_1000058 3300025302 Bacteria 363857
271 Ga0207426_1000349 3300025302 Bacteria 84546
272 Ga0209051_1000019 3300025303 Bacteria 511268
273 Ga0209051_1000091 3300025303 Bacteria 173683
274 Ga0209051_1000098 3300025303 Bacteria 165284
275 Ga0209051_1000099 3300025303 Bacteria 165161
276 Ga0209051_1000342 3300025303 Bacteria 70022
277 Ga0209051_1001310 3300025303 Bacteria 21859
278 Ga0209051_1025182 3300025303 Bacteria 2428
279 Ga0209257_1000024 3300025304 Bacteria 726068
280 Ga0209257_1000497 3300025304 Bacteria 70185
281 Ga0209257_1000677 3300025304 Bacteria 53181
282 Ga0209257_1003804 3300025304 Bacteria 12416
283 Ga0209257_1004226 3300025304 Bacteria 11372
284 Ga0209257_1052704 3300025304 Bacteria 1141
285 Ga0207656_10015819 3300025321 Bacteria 2926
286 Ga0207655_1000675 3300025728 Bacteria 39901
287 Ga0207682_10002543 3300025893 Bacteria 8137
288 Ga0207682_10146311 3300025893 Bacteria 1063
289 Ga0207688_10016415 3300025901 Bacteria 4016
290 Ga0207680_10126640 3300025903 Bacteria 1677
291 Ga0207645_10002306 3300025907 Bacteria 15080
292 Ga0207645_10135701 3300025907 Bacteria 1602
293 Ga0207643_10002326 3300025908 Bacteria 10344
294 Ga0207662_10009379 3300025918 Bacteria 5382
295 Ga0207652_10416497 3300025921 Bacteria 1212
296 Ga0207681_10083126 3300025923 Bacteria 2265
297 Ga0207681_10312177 3300025923 Bacteria 1247
298 Ga0207681_10475956 3300025923 Bacteria 1019
299 Ga0207650_10018089 3300025925 Bacteria 4941
300 Ga0207650_10691507 3300025925 Bacteria 861
301 Ga0207644_10127309 3300025931 Bacteria 1945
302 Ga0207706_10015483 3300025933 Bacteria 6890
303 Ga0207706_10035041 3300025933 Bacteria 4465
304 Ga0207686_10335459 3300025934 Bacteria 1134
305 Ga0207709_10000331 3300025935 Bacteria 50983
306 Ga0207709_10000464 3300025935 Bacteria 37316
307 Ga0207709_10008913 3300025935 Bacteria 5539
308 Ga0207709_10100531 3300025935 Bacteria 1911
309 Ga0207669_10102702 3300025937 Bacteria 1894
310 Ga0207704_10797581 3300025938 Bacteria 788
311 Ga0207691_10015351 3300025940 Bacteria 7286
312 Ga0207691_10633910 3300025940 Bacteria 904
313 Ga0207711_10129776 3300025941 Bacteria 2259
314 Ga0207711_10285186 3300025941 Bacteria 1521
315 Ga0207689_10007489 3300025942 Bacteria 9568
316 Ga0207689_10100011 3300025942 Bacteria 2383
317 Ga0207689_10588989 3300025942 Bacteria 935
318 Ga0207679_10074547 3300025945 Bacteria 2572
319 Ga0207667_10099672 3300025949 Bacteria 2997
320 Ga0207667_10109713 3300025949 Bacteria 2846
321 Ga0207651_10019609 3300025960 Bacteria 4058
322 Ga0207651_10072831 3300025960 Bacteria 2441
323 Ga0207651_10206224 3300025960 Bacteria 1579
324 Ga0207640_10482424 3300025981 Bacteria 1029
325 Ga0207658_10116126 3300025986 Bacteria 2125
326 Ga0207658_10255627 3300025986 Bacteria 1490
327 Ga0207658_10865360 3300025986 Bacteria 822
328 Ga0207677_10018143 3300026023 Bacteria 4217
329 Ga0207677_10288768 3300026023 Bacteria 1350
330 Ga0207639_10020870 3300026041 Bacteria 4697
331 Ga0207708_10002353 3300026075 Bacteria 13889
332 Ga0207702_10667621 3300026078 Bacteria 1023
333 Ga0207702_10725298 3300026078 Bacteria 980
334 Ga0207641_10129708 3300026088 Bacteria 2262
335 Ga0207641_10434966 3300026088 Bacteria 1265
336 Ga0207648_10003860 3300026089 Bacteria 15650
337 Ga0207676_10681670 3300026095 Bacteria 994
338 Ga0207674_10100238 3300026116 Bacteria 2878
339 Ga0207674_10122845 3300026116 Bacteria 2562
340 Ga0207674_10269315 3300026116 Bacteria 1651
341 Ga0207674_10328358 3300026116 Bacteria 1479
342 Ga0207675_100010756 3300026118 Bacteria 8574
343 Ga0207683_10003766 3300026121 Bacteria 13151
344 Ga0207683_10085145 3300026121 Bacteria 2810
345 Ga0207683_10092950 3300026121 Bacteria 2688
346 Ga0207683_10377433 3300026121 Bacteria 1303
347 Ga0207683_10427315 3300026121 Bacteria 1220
348 Ga0207698_10219338 3300026142 Bacteria 1717
349 Ga0209282_1005738 3300027666 Bacteria 7658
350 Ga0209282_1093813 3300027666 Bacteria 1565
351 Ga0268266_10200059 3300028379 Bacteria 1828
352 Ga0268266_10313833 3300028379 Bacteria 1465
353 Ga0268265_10021322 3300028380 Bacteria 4537
354 Ga0265318_10005954 3300028577 Bacteria 5667
355 Ga0307515_10000040 3300028794 Bacteria 322704
356 Ga0307515_10099599 3300028794 Bacteria 3527
357 Ga0316177_1099357 3300030731 Bacteria 1064
358 Ga0316176_1067430 3300030732 Bacteria 2291
359 Ga0316183_1086557 3300030742 Bacteria 14600
360 Ga0265330_10019471 3300031235 Bacteria 3110
361 Ga0265330_10025206 3300031235 Bacteria 2696
362 Ga0265332_10000029 3300031238 Bacteria 180902
363 Ga0265332_10000398 3300031238 Bacteria 31536
364 Ga0265328_10000020 3300031239 Bacteria 125715
365 Ga0265328_10011318 3300031239 Bacteria 3569
366 Ga0265328_10040694 3300031239 Bacteria 1712
367 Ga0265320_10033514 3300031240 Bacteria 2622
368 Ga0265320_10141019 3300031240 Bacteria 1092
369 Ga0265329_10004474 3300031242 Bacteria 5803
370 Ga0265329_10034834 3300031242 Unclassified 1626
371 Ga0265340_10217061 3300031247 Bacteria 857
372 Ga0265339_10060614 3300031249 Bacteria 2039
373 Ga0265331_10021074 3300031250 Bacteria 3338
374 Ga0265331_10053388 3300031250 Bacteria 1928
375 Ga0265327_10000746 3300031251 Bacteria 50605
376 Ga0265327_10001767 3300031251 Bacteria 25537
377 Ga0265327_10021084 3300031251 Bacteria 3944
378 Ga0265327_10044923 3300031251 Bacteria 2351
379 Ga0265327_10052990 3300031251 Bacteria 2108
380 Ga0265316_10030433 3300031344 Bacteria 4425
381 Ga0265316_10048756 3300031344 Bacteria 3341
382 Ga0265316_10139021 3300031344 Bacteria 1826
383 Ga0265316_10141935 3300031344 Bacteria 1803
384 Ga0307513_10113647 3300031456 Bacteria 2695
385 Ga0307513_10175863 3300031456 Bacteria 2011
386 Ga0307513_10313467 3300031456 Bacteria 1330
387 Ga0307408_100003650 3300031548 Bacteria 10489
388 Ga0307408_100051116 3300031548 Bacteria 2975
389 Ga0307408_100053852 3300031548 Bacteria 2907
390 Ga0307408_100076112 3300031548 Bacteria 2495
391 Ga0307408_101162263 3300031548 Bacteria 718
392 Ga0265313_10075381 3300031595 Bacteria 1544
393 Ga0307514_10008104 3300031649 Bacteria 8984
394 Ga0265314_10005578 3300031711 Bacteria 11314
395 Ga0265342_10008414 3300031712 Bacteria 7396
396 Ga0307516_10077116 3300031730 Bacteria 3182
397 Ga0307516_10126631 3300031730 Bacteria 2338
398 Ga0307405_10012930 3300031731 Bacteria 4438
399 Ga0307405_10027530 3300031731 Bacteria 3297
400 Ga0307405_10280752 3300031731 Bacteria 1253
401 Ga0307405_10546594 3300031731 Bacteria 936
402 Ga0307405_10641943 3300031731 Bacteria 872
403 Ga0307405_10695234 3300031731 Bacteria 841
404 Ga0307405_11133808 3300031731 Bacteria 673
405 Ga0307413_10055028 3300031824 Bacteria 2418
406 Ga0307413_10434456 3300031824 Bacteria 1038
407 Ga0307406_10000324 3300031901 Bacteria 27796
408 Ga0307406_10059024 3300031901 Bacteria 2468
409 Ga0307406_10235516 3300031901 Bacteria 1370
410 Ga0307406_10260938 3300031901 Bacteria 1311
411 Ga0307406_10316864 3300031901 Bacteria 1205
412 Ga0307406_10750741 3300031901 Bacteria 819
413 Ga0307407_10445024 3300031903 Bacteria 939
414 Ga0307412_10030197 3300031911 Bacteria 3409
415 Ga0307412_10043892 3300031911 Bacteria 2914
416 Ga0307412_10077823 3300031911 Bacteria 2282
417 Ga0307412_10102742 3300031911 Bacteria 2024
418 Ga0307412_10247791 3300031911 Bacteria 1382
419 Ga0307409_101043332 3300031995 Bacteria 837
420 Ga0307416_100010896 3300032002 Bacteria 6030
421 Ga0307414_10078062 3300032004 Bacteria 2412
422 Ga0307414_10610220 3300032004 Bacteria 979
423 Ga0307414_10710933 3300032004 Bacteria 910
424 Ga0307411_10001615 3300032005 Bacteria 9387
425 Ga0307411_10027661 3300032005 Bacteria 3435
426 Ga0307411_10578154 3300032005 Bacteria 963
427 Ga0307415_100393587 3300032126 Bacteria 1181
428 Ga0316583_10017757 3300032133 Bacteria 2556
429 Ga0373932_0127620 3300035112 Bacteria 854
430 Ga0373931_0032340 3300035691 Bacteria 2707
431 Ga0373931_0059932 3300035691 Bacteria 2048
432 Ga0373933_0563865 3300035724 Bacteria 747
433 Ga0373937_0627494 3300036401 Bacteria 1020
434 Ga0373925_0280497 3300037068 Bacteria 1342
435 Ga0395899_0001018 3300037312 Bacteria 25619
436 Ga0395899_0322141 3300037312 Bacteria 1041
437 Ga0395899_0455726 3300037312 Bacteria 837
438 Ga0395900_0040394 3300037418 Bacteria 4808
439 Ga0395900_0216421 3300037418 Bacteria 1933
440 Ga0395898_0008698 3300037466 Bacteria 10712
441 Ga0395898_0107645 3300037466 Bacteria 2673
442 Ga0395898_0199014 3300037466 Bacteria 1913
443 Ga0395905_0002817 3300037471 Bacteria 19057
444 Ga0395905_0004508 3300037471 Bacteria 14433
445 Ga0395905_0008661 3300037471 Bacteria 10021
446 Ga0395905_0052347 3300037471 Bacteria 3822
447 Ga0395905_0065940 3300037471 Bacteria 3390
448 Ga0395905_0089643 3300037471 Bacteria 2882
449 Ga0395905_0206749 3300037471 Bacteria 1840
450 Ga0395905_0228685 3300037471 Bacteria 1739
451 Ga0395905_0795698 3300037471 Bacteria 848
452 Ga0395905_0834446 3300037471 Bacteria 824
453 Ga0395901_0022637 3300038443 Bacteria 6441
454 Ga0395901_0097141 3300038443 Bacteria 3087
455 Ga0395901_0366817 3300038443 Bacteria 1484
456 Ga0400490_08919 3300038726 Bacteria 7346
457 Ga0400483_079146 3300039062 Bacteria 1018
458 Ga0436361_0837231 3300039447 Bacteria 44100
459 Ga0439436_0000586 3300041404 Bacteria 9641
460 Ga0439436_0003260 3300041404 Bacteria 4920
461 Ga0439436_0053662 3300041404 Bacteria 1135
462 Ga0439439_0007617 3300041406 Bacteria 2537
463 Ga0439439_0012633 3300041406 Bacteria 2044
464 Ga0439447_031943 3300041407 Bacteria 1319
465 Ga0439447_074976 3300041407 Bacteria 784
466 Ga0439447_080230 3300041407 Bacteria 754
467 Ga0439461_0001667 3300041410 Bacteria 3459
468 Ga0439466_0016222 3300041411 Bacteria 2696
469 Ga0439466_0093318 3300041411 Bacteria 942
470 Ga0439465_0000571 3300041413 Bacteria 11082
471 Ga0451841_1087416 3300041498 Bacteria 708
472 Ga0439431_0000218 3300041997 Bacteria 11553
473 Ga0439431_0023674 3300041997 Bacteria 1489
474 Ga0439431_0045506 3300041997 Bacteria 1127
475 Ga0439437_023326 3300042000 Bacteria 756
476 Ga0439442_014583 3300042002 Bacteria 1618
477 Ga0439445_0005073 3300042004 Bacteria 2991
478 Ga0439445_0060743 3300042004 Bacteria 1033
479 Ga0439445_0100640 3300042004 Bacteria 819
480 Ga0439432_000464 3300042006 Bacteria 15181
481 Ga0439432_013370 3300042006 Bacteria 2793
482 Ga0439449_0001782 3300042007 Bacteria 8471
483 Ga0439449_0002685 3300042007 Bacteria 6926
484 Ga0439449_0232706 3300042007 Bacteria 692
485 Ga0439452_009991 3300042010 Bacteria 2776
486 Ga0439455_0031067 3300042012 Bacteria 1328
487 Ga0439457_021851 3300042014 Bacteria 1417
488 Ga0439457_039645 3300042014 Bacteria 1049
489 Ga0439457_045282 3300042014 Bacteria 983
490 Ga0439457_067131 3300042014 Bacteria 815
491 Ga0439462_0001912 3300042015 Bacteria 4743
492 Ga0439462_0006154 3300042015 Bacteria 2976
493 Ga0439462_0007329 3300042015 Bacteria 2759
494 Ga0439462_0029151 3300042015 Bacteria 1460
495 Ga0439462_0033550 3300042015 Bacteria 1361
496 Ga0450911_000496 3300042115 Bacteria 12520
497 Ga0450919_008525 3300042121 Bacteria 1184
498 Ga0450894_011246 3300042131 Bacteria 1165
499 Ga0450906_014085 3300042145 Bacteria 1467
500 Ga0450910_001247 3300042147 Bacteria 3169
501 Ga0439446_0088038 3300042156 Bacteria 969
502 Ga0439446_0219893 3300042156 Bacteria 647
503 Ga0450908_004376 3300042184 Bacteria 2724
504 Ga0450909_014761 3300042185 Bacteria 1150
505 Ga0450909_026382 3300042185 Bacteria 876
506 Ga0439434_0000517 3300042435 Bacteria 10981
507 Ga0439434_0009050 3300042435 Bacteria 2927
508 Ga0439460_0030740 3300042461 Bacteria 1529
509 Ga0450918_006667 3300042531 Bacteria 2054
510 Ga0450918_024708 3300042531 Bacteria 1051
511 Ga0451577_0035717 3300042876 Bacteria 4477
512 Ga0451577_0073800 3300042876 Bacteria 3044
513 Ga0451577_0101455 3300042876 Bacteria 2571
514 Ga0466969_0021587 3300044656 Bacteria 3328
515 Ga0466969_0038894 3300044656 Bacteria 2391
516 Ga0453683_0006241 3300044673 Bacteria 8196
517 Ga0466965_0370169 3300044683 Bacteria 787
518 Ga0466966_0138717 3300044684 Bacteria 1487
519 Ga0466961_0099502 3300044693 Bacteria 1832
520 Ga0453684_0449119 3300044712 Bacteria 1435
521 Ga0453684_1575430 3300044712 Bacteria 675
522 Ga0466970_0037823 3300044765 Bacteria 2559
523 Ga0466957_0396785 3300044842 Bacteria 943
524 Ga0466960_0265159 3300044901 Bacteria 958
525 Ga0466960_0539891 3300044901 Bacteria 687
526 Ga0466959_0036604 3300045049 Bacteria 3626
527 Ga0466959_0454665 3300045049 Bacteria 868
528 Ga0451576_0000006 3300045051 Bacteria 949698
529 Ga0451576_0017383 3300045051 Bacteria 7907
530 Ga0451576_0609279 3300045051 Bacteria 1148
531 Ga0495627_057008 3300046453 Bacteria 1163
532 Ga0495590_0080524 3300046457 Bacteria 1147
533 Ga0495629_0211632 3300046459 Bacteria 1339
534 Ga0495638_0019572 3300046460 Bacteria 4478
535 Ga0495610_0021660 3300046512 Bacteria 3528
536 Ga0495616_0003870 3300046513 Bacteria 9542
537 Ga0495631_0000163 3300046518 Bacteria 45348
538 Ga0495637_0006475 3300046520 Bacteria 5874
539 Ga0495663_0037328 3300046525 Bacteria 1465
540 Ga0495642_0081622 3300046528 Bacteria 1362
541 Ga0495654_0022427 3300046530 Bacteria 3279
542 Ga0495654_0201393 3300046530 Bacteria 852
543 Ga0495622_0262361 3300046557 Bacteria 758
544 Ga0495633_0148210 3300046558 Bacteria 1084
545 Ga0495656_0000163 3300046615 Bacteria 24459
546 Ga0495656_0111103 3300046615 Bacteria 1282
547 Ga0495656_0124913 3300046615 Bacteria 1219
548 Ga0495625_0000045 3300046660 Bacteria 202475
549 Ga0495625_0060501 3300046660 Bacteria 2683
550 Ga0495588_0255079 3300046674 Bacteria 924
551 Ga0495658_0115048 3300046683 Bacteria 1621
552 Ga0495670_0100652 3300046691 Bacteria 1488
553 Ga0495671_0015415 3300046692 Bacteria 4093
554 Ga0495660_0045443 3300046810 Bacteria 2411
555 Ga0495676_0058877 3300047321 Bacteria 3020
556 Ga0495681_0253262 3300047470 Bacteria 694
557 Ga0495593_0002104 3300047673 Bacteria 11902
558 Ga0495614_0088545 3300048089 Bacteria 1345
559 Ga0496100_0099001 3300048903 Bacteria 2005
560 Ga0496101_0003542 3300048904 Bacteria 9742
561 Ga0496101_0059835 3300048904 Bacteria 2762
562 Ga0496102_0008409 3300048905 Bacteria 8842
563 Ga0496102_0266002 3300048905 Bacteria 1617
564 Ga0496104_0116799 3300048907 Bacteria 2560
565 Ga0496105_0050318 3300048908 Bacteria 3441
566 Ga0496108_0221492 3300048911 Bacteria 1644
567 Ga0496110_0013319 3300048913 Bacteria 6795
568 Ga0496111_0400359 3300048914 Bacteria 1014
569 Ga0496114_0371118 3300048917 Bacteria 1266
570 Ga0496116_0064554 3300048919 Bacteria 2353
571 Ga0496116_0158318 3300048919 Bacteria 1246
572 Ga0496117_0028929 3300048920 Bacteria 4281
573 Ga0496117_0059066 3300048920 Bacteria 2652
574 Ga0496117_0112317 3300048920 Bacteria 1694
575 Ga0496118_0032009 3300048921 Bacteria 4344
576 Ga0496118_0282758 3300048921 Bacteria 922
577 Ga0496118_0297641 3300048921 Bacteria 888
578 Ga0496119_0162441 3300048922 Bacteria 1186
579 Ga0496121_0006773 3300048924 Bacteria 14053
580 Ga0496121_0094623 3300048924 Bacteria 2323
581 Ga0496121_0146946 3300048924 Bacteria 1740
582 Ga0496121_0269007 3300048924 Bacteria 1172
583 Ga0496121_0316496 3300048924 Bacteria 1052
584 Ga0496122_0000331 3300048925 Bacteria 102617
585 Ga0496122_0133772 3300048925 Bacteria 1568
586 Ga0496122_0162021 3300048925 Bacteria 1362
587 Ga0496122_0367184 3300048925 Bacteria 744
588 Ga0496122_0367425 3300048925 Bacteria 744
589 Ga0496123_0000124 3300048926 Bacteria 158327
590 Ga0496123_0040092 3300048926 Bacteria 3268
591 Ga0496123_0042013 3300048926 Bacteria 3162
592 Ga0496123_0161843 3300048926 Bacteria 1192
593 Ga0496124_0052777 3300048927 Bacteria 3452
594 Ga0496124_0141472 3300048927 Bacteria 1898
595 Ga0496124_0183400 3300048927 Bacteria 1608
596 Ga0496125_0014888 3300048928 Bacteria 7553
597 Ga0496125_0032434 3300048928 Bacteria 4640
598 Ga0496125_0032803 3300048928 Bacteria 4607
599 Ga0496125_0056027 3300048928 Bacteria 3205
600 Ga0496125_0128324 3300048928 Bacteria 1791
601 Ga0496125_0202642 3300048928 Bacteria 1297
602 Ga0496126_0385908 3300048929 Bacteria 1139
603 Ga0496126_0427765 3300048929 Bacteria 1069
604 Ga0495678_120977 3300049459 Bacteria 879
605 Ga0501032_0279026 3300049569 Bacteria 1082
606 Ga0501033_0179328 3300049570 Bacteria 1519
607 Ga0501033_0222049 3300049570 Bacteria 1345
608 Ga0501034_0028787 3300049571 Bacteria 5652
609 Ga0501034_0957112 3300049571 Bacteria 742
610 Ga0501036_0544306 3300049572 Bacteria 965
611 Ga0501043_0493917 3300049579 Bacteria 915
612 Ga0501047_0050858 3300049581 Bacteria 4002
613 Ga0501047_0072718 3300049581 Bacteria 3309
614 Ga0501047_0360049 3300049581 Bacteria 1291
615 Ga0501072_0702415 3300049588 Bacteria 795
616 Ga0501080_0122319 3300049742 Bacteria 2411
617 Ga0501262_000120 3300049759 Bacteria 9771
618 Ga0501035_0009745 3300049822 Bacteria 8934
619 Ga0501035_0166450 3300049822 Bacteria 1906
620 Ga0501044_0005907 3300049823 Bacteria 13556
621 Ga0501044_0504748 3300049823 Bacteria 1110
622 nmdc:mga03683_3109_c1 3300050489 Bacteria 5281
623 nmdc:mga03n38_221925_c1 3300050490 Bacteria 987
624 nmdc:mga03n38_97708_c1 3300050490 Bacteria 1411
625 nmdc:mga00v17_193484_c1 3300050491 Bacteria 1314
626 nmdc:mga0yw44_22552_c1 3300050492 Bacteria 3532
627 nmdc:mga0yw44_284841_c1 3300050492 Bacteria 1105
628 nmdc:mga0k408_290334_c1 3300050493 Bacteria 976
629 nmdc:mga0k408_78444_c1 3300050493 Bacteria 1932
630 nmdc:mga0k408_79978_c1 3300050493 Bacteria 1913
631 nmdc:mga06z11_193123_c1 3300050494 Bacteria 1179
632 nmdc:mga06z11_301054_c1 3300050494 Bacteria 953
633 nmdc:mga06z11_459275_c1 3300050494 Bacteria 770
634 nmdc:mga07m45_17711_c1 3300050496 Bacteria 3832
635 nmdc:mga07m45_29343_c2 3300050496 Bacteria 2027
636 nmdc:mga07m45_297175_c1 3300050496 Bacteria 939
637 nmdc:mga07m45_5781_c1 3300050496 Bacteria 6196
638 nmdc:mga07m45_605_c1 3300050496 Bacteria 15256
639 nmdc:mga07m45_62136_c1 3300050496 Bacteria 2116
640 nmdc:mga07m45_8102_c1 3300050496 Bacteria 5387
641 nmdc:mga09592_673856_c1 3300050508 Bacteria 882
642 nmdc:mga0qj67_671149_c1 3300050509 Bacteria 826
643 nmdc:mga0n895_950962_c1 3300050512 Bacteria 842
644 nmdc:mga08x19_556076_c1 3300050514 Bacteria 812
645 Ga0500610_0000014 3300053079 Bacteria 84868
646 Ga0500610_0000021 3300053079 Bacteria 66361
647 Ga0500643_025509 3300053087 Bacteria 1862
648 Ga0500651_0000560 3300053093 Bacteria 18911
649 Ga0500566_0176662 3300053094 Bacteria 1099
650 Ga0500571_026455 3300053110 Bacteria 3212
651 Ga0500572_061989 3300053111 Bacteria 1139
652 Ga0500593_000644 3300053117 Bacteria 13420
653 Ga0500594_0000473 3300053118 Bacteria 8831
654 Ga0500607_000674 3300053121 Bacteria 32958
655 Ga0500607_125994 3300053121 Bacteria 1230
656 Ga0500608_116280 3300053122 Bacteria 1219
657 Ga0500626_036089 3300053128 Bacteria 2235
658 Ga0500658_0000034 3300053134 Bacteria 87668
659 Ga0500658_0001015 3300053134 Bacteria 11448
660 Ga0500559_0000367 3300053136 Bacteria 33241
661 Ga0500564_151480 3300053138 Bacteria 988
662 Ga0500568_0000490 3300053139 Bacteria 29149
663 Ga0500604_0148557 3300053151 Bacteria 795
664 Ga0500616_0119166 3300053153 Bacteria 1263
665 Ga0500627_0001528 3300053158 Bacteria 6510
666 Ga0500627_0175674 3300053158 Bacteria 964
667 Ga0500634_0006252 3300053161 Bacteria 5745
668 Ga0500634_0122059 3300053161 Bacteria 1266
669 Ga0500638_132157 3300053162 Bacteria 1130
670 Ga0500636_0046985 3300053177 Bacteria 2544
671 Ga0500567_099967 3300053723 Bacteria 1207
672 Ga0500565_002430 3300053734 Bacteria 1391
673 Ga0590075_007587 3300059424 Bacteria 2582
674 Ga0466962_0250788 3300061719 Bacteria 870

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0367425 Ga0496122_0367425_95_613 172
2 3300035691 Ga0373931_0059932 Ga0373931_0059932_584_1114 174
3 3300039062 Ga0400483_079146 Ga0400483_079146_393_986 179
4 3300044901 Ga0466960_0539891 Ga0466960_0539891_11_556 181
5 3300049588 Ga0501072_0702415 Ga0501072_0702415_21_614 181
6 3300050509 nmdc:mga0qj67_671149_c1 nmdc:mga0qj67_671149_c1_269_814 181
7 3300038726 Ga0400490_08919 Ga0400490_08919_345_941 185
8 3300049571 Ga0501034_0957112 Ga0501034_0957112_164_727 187
9 3300005467 Ga0070706_100059087 Ga0070706_1000590872 189
10 3300005471 Ga0070698_100552296 Ga0070698_1005522962 189
11 3300005549 Ga0070704_100011744 Ga0070704_1000117445 189
12 3300006871 Ga0075434_100053749 Ga0075434_1000537496 189
13 3300006914 Ga0075436_100622679 Ga0075436_1006226791 189
14 3300050512 nmdc:mga0n895_950962_c1 nmdc:mga0n895_950962_c1_70_708 189
15 3300050514 nmdc:mga08x19_556076_c1 nmdc:mga08x19_556076_c1_29_667 189
16 iso_pu_bacteria 2526164512 2526211396 189
17 3300031595 Ga0265313_10075381 Ga0265313_100753812 191
18 3300042876 Ga0451577_0073800 Ga0451577_0073800_1911_2495 191
19 3300044712 Ga0453684_1575430 Ga0453684_1575430_67_651 191
20 3300031239 Ga0265328_10040694 Ga0265328_100406942 192
21 3300031240 Ga0265320_10141019 Ga0265320_101410192 192
22 3300031250 Ga0265331_10021074 Ga0265331_100210743 192
23 3300031251 Ga0265327_10001767 Ga0265327_1000176724 192
24 3300031251 Ga0265327_10021084 Ga0265327_100210843 192
25 3300031251 Ga0265327_10052990 Ga0265327_100529902 192
26 3300031344 Ga0265316_10030433 Ga0265316_100304335 192
27 3300031344 Ga0265316_10141935 Ga0265316_101419352 192
28 3300031730 Ga0307516_10126631 Ga0307516_101266314 192
29 3300035112 Ga0373932_0127620 Ga0373932_0127620_68_655 192
30 3300035724 Ga0373933_0563865 Ga0373933_0563865_127_735 192
31 3300042876 Ga0451577_0035717 Ga0451577_0035717_3775_4368 192
32 3300044712 Ga0453684_0449119 Ga0453684_0449119_160_747 192
33 3300026116 Ga0207674_10100238 Ga0207674_101002381 193
34 3300031238 Ga0265332_10000029 Ga0265332_1000002969 193
35 3300031344 Ga0265316_10048756 Ga0265316_100487564 193
36 3300032133 Ga0316583_10017757 Ga0316583_100177573 193
37 3300045051 Ga0451576_0000006 Ga0451576_0000006_125702_126295 193
38 3300045051 Ga0451576_0609279 Ga0451576_0609279_16_606 193
39 3300003763 Ga0055529_1001011 Ga0055529_10010119 195
40 3300005328 Ga0070676_10304541 Ga0070676_103045411 195
41 3300005331 Ga0070670_100194010 Ga0070670_1001940102 195
42 3300005331 Ga0070670_100570772 Ga0070670_1005707722 195
43 3300005345 Ga0070692_10292517 Ga0070692_102925172 195
44 3300005347 Ga0070668_100130668 Ga0070668_1001306682 195
45 3300005353 Ga0070669_100131849 Ga0070669_1001318492 195
46 3300005353 Ga0070669_100262967 Ga0070669_1002629672 195
47 3300005354 Ga0070675_100041967 Ga0070675_1000419675 195
48 3300005355 Ga0070671_100129474 Ga0070671_1001294742 195
49 3300005356 Ga0070674_100318253 Ga0070674_1003182532 195
50 3300005364 Ga0070673_100365501 Ga0070673_1003655012 195
51 3300005438 Ga0070701_10007392 Ga0070701_100073926 195
52 3300005441 Ga0070700_100612691 Ga0070700_1006126911 195
53 3300005456 Ga0070678_100028025 Ga0070678_1000280252 195
54 3300005459 Ga0068867_100168784 Ga0068867_1001687841 195
55 3300005459 Ga0068867_100423233 Ga0068867_1004232332 195
56 3300005466 Ga0070685_10113354 Ga0070685_101133542 195
57 3300005543 Ga0070672_100295833 Ga0070672_1002958332 195
58 3300005549 Ga0070704_100085589 Ga0070704_1000855893 195
59 3300005578 Ga0068854_100244746 Ga0068854_1002447462 195
60 3300005618 Ga0068864_100444163 Ga0068864_1004441632 195
61 3300005718 Ga0068866_10362257 Ga0068866_103622572 195
62 3300005719 Ga0068861_100026271 Ga0068861_1000262716 195
63 3300005840 Ga0068870_10219672 Ga0068870_102196722 195
64 3300005841 Ga0068863_100047683 Ga0068863_1000476835 195
65 3300005841 Ga0068863_100132321 Ga0068863_1001323212 195
66 3300005843 Ga0068860_100114582 Ga0068860_1001145822 195
67 3300005844 Ga0068862_100427324 Ga0068862_1004273242 195
68 3300006237 Ga0097621_100030530 Ga0097621_1000305304 195
69 3300006358 Ga0068871_100033921 Ga0068871_1000339214 195
70 3300009098 Ga0105245_10033012 Ga0105245_100330126 195
71 3300009148 Ga0105243_10030230 Ga0105243_100302305 195
72 3300009176 Ga0105242_10283450 Ga0105242_102834502 195
73 3300009177 Ga0105248_10561826 Ga0105248_105618261 195
74 3300011119 Ga0105246_10069698 Ga0105246_100696983 195
75 3300013296 Ga0157374_10180187 Ga0157374_101801872 195
76 3300013308 Ga0157375_10111027 Ga0157375_101110274 195
77 3300013308 Ga0157375_10789500 Ga0157375_107895001 195
78 3300014325 Ga0163163_10126096 Ga0163163_101260962 195
79 3300014325 Ga0163163_10676364 Ga0163163_106763641 195
80 3300014326 Ga0157380_10199150 Ga0157380_101991502 195
81 3300014968 Ga0157379_10014445 Ga0157379_100144452 195
82 3300014969 Ga0157376_10082225 Ga0157376_100822253 195
83 3300014969 Ga0157376_10354467 Ga0157376_103544672 195
84 3300017792 Ga0163161_10288442 Ga0163161_102884422 195
85 3300025272 Ga0209455_1000819 Ga0209455_100081911 195
86 3300025893 Ga0207682_10002543 Ga0207682_100025434 195
87 3300025901 Ga0207688_10016415 Ga0207688_100164156 195
88 3300025903 Ga0207680_10126640 Ga0207680_101266402 195
89 3300025907 Ga0207645_10002306 Ga0207645_100023069 195
90 3300025908 Ga0207643_10002326 Ga0207643_100023268 195
91 3300025918 Ga0207662_10009379 Ga0207662_100093797 195
92 3300025923 Ga0207681_10312177 Ga0207681_103121772 195
93 3300025925 Ga0207650_10018089 Ga0207650_100180891 195
94 3300025925 Ga0207650_10691507 Ga0207650_106915072 195
95 3300025931 Ga0207644_10127309 Ga0207644_101273092 195
96 3300025933 Ga0207706_10015483 Ga0207706_100154836 195
97 3300025934 Ga0207686_10335459 Ga0207686_103354592 195
98 3300025935 Ga0207709_10100531 Ga0207709_101005312 195
99 3300025937 Ga0207669_10102702 Ga0207669_101027022 195
100 3300025940 Ga0207691_10015351 Ga0207691_100153512 195
101 3300025941 Ga0207711_10285186 Ga0207711_102851862 195
102 3300025942 Ga0207689_10007489 Ga0207689_1000748911 195
103 3300025960 Ga0207651_10019609 Ga0207651_100196096 195
104 3300025986 Ga0207658_10116126 Ga0207658_101161262 195
105 3300026075 Ga0207708_10002353 Ga0207708_100023532 195
106 3300026088 Ga0207641_10434966 Ga0207641_104349662 195
107 3300026089 Ga0207648_10003860 Ga0207648_1000386017 195
108 3300026118 Ga0207675_100010756 Ga0207675_1000107566 195
109 3300026121 Ga0207683_10003766 Ga0207683_1000376611 195
110 3300026142 Ga0207698_10219338 Ga0207698_102193381 195
111 3300028577 Ga0265318_10005954 Ga0265318_100059543 195
112 3300031235 Ga0265330_10025206 Ga0265330_100252062 195
113 3300031238 Ga0265332_10000398 Ga0265332_100003983 195
114 3300031239 Ga0265328_10000020 Ga0265328_10000020103 195
115 3300031239 Ga0265328_10011318 Ga0265328_100113182 195
116 3300031240 Ga0265320_10033514 Ga0265320_100335143 195
117 3300031242 Ga0265329_10004474 Ga0265329_100044745 195
118 3300031242 Ga0265329_10034834 Ga0265329_100348343 195
119 3300031249 Ga0265339_10060614 Ga0265339_100606142 195
120 3300031250 Ga0265331_10053388 Ga0265331_100533882 195
121 3300031344 Ga0265316_10139021 Ga0265316_101390213 195
122 3300031711 Ga0265314_10005578 Ga0265314_100055783 195
123 3300031712 Ga0265342_10008414 Ga0265342_100084142 195
124 3300037068 Ga0373925_0280497 Ga0373925_0280497_144_773 195
125 3300048911 Ga0496108_0221492 Ga0496108_0221492_520_1167 195
126 3300049570 Ga0501033_0179328 Ga0501033_0179328_294_914 195
127 3300049822 Ga0501035_0009745 Ga0501035_0009745_4834_5454 195
128 3300049823 Ga0501044_0005907 Ga0501044_0005907_7677_8297 195
129 iso_pu_bacteria 2513020051 2513230376 195
130 iso_pu_bacteria 2599185214 2599627959 195
131 iso_pu_bacteria 2599185226 2599677770 195
132 iso_pu_bacteria 2599185227 2599685589 195
133 iso_pu_bacteria 2599185229 2599697491 195
134 iso_pu_bacteria 2643221628 2644161788 195
135 iso_pu_bacteria 2643221658 2644325808 195
136 iso_pu_bacteria 2643221672 2644399649 195
137 iso_pu_bacteria 2643221683 2644465161 195
138 iso_pu_bacteria 2738541277 2738724022 195
139 iso_pu_bacteria 2738541307 2738880576 195
140 iso_pu_bacteria 2738543013 2739247912 195
141 iso_pu_bacteria 2738543019 2739284707 195
142 iso_pu_bacteria 2818991446 2819600673 195
143 iso_pu_bacteria 2831265667 2831268084 195
144 iso_pu_bacteria 2838054893 2838061719 195
145 iso_pu_bacteria 2842677519 2842679760 195
146 iso_pu_bacteria 2842733646 2842734097 195
147 iso_pu_bacteria 2842747753 2842752527 195
148 iso_pu_bacteria 2885192300 2885193061 195
149 iso_pu_bacteria 2885198086 2885203153 195
150 iso_pu_bacteria 2885211737 2885216450 195
151 iso_pu_bacteria 2899924645 2899928073 195
152 iso_pu_bacteria 2904541872 2904545224 195
153 iso_pu_bacteria 2919462493 2919463860 195
154 iso_pu_bacteria 2919704043 2919704165 195
155 iso_pu_bacteria 2928037797 2928041077 195
156 iso_pu_bacteria 2928044640 2928047919 195
157 iso_pu_bacteria 2928051484 2928055814 195
158 iso_pu_bacteria 2928064002 2928066712 195
159 iso_pu_bacteria 2928070936 2928075218 195
160 iso_pu_bacteria 2928084124 2928088611 195
161 iso_pu_bacteria 2928115317 2928115563 195
162 iso_pu_bacteria 2929160207 2929165416 195
163 iso_pu_bacteria 2929520902 2929522856 195
164 iso_pu_bacteria 2939631187 2939636115 195
165 iso_pu_bacteria 2945909444 2945909940 195
166 iso_pu_bacteria 2945945610 2945945983 195
167 iso_pu_bacteria 2945984333 2945988099 195
168 iso_pu_bacteria 2881101125 2881102712 197
169 iso_pu_bacteria 2904449895 2904452511 197
170 iso_pu_bacteria 2904456579 2904460890 197
171 iso_pu_bacteria 2904479285 2904480013 197
172 iso_pu_bacteria 2945972063 2945975601 197
173 iso_pu_bacteria 2954767861 2954768954 197
174 3300005353 Ga0070669_100361837 Ga0070669_1003618372 198
175 3300005456 Ga0070678_100049560 Ga0070678_1000495602 198
176 3300025921 Ga0207652_10416497 Ga0207652_104164972 198
177 3300025923 Ga0207681_10475956 Ga0207681_104759562 198
178 3300025960 Ga0207651_10072831 Ga0207651_100728312 198
179 3300026121 Ga0207683_10085145 Ga0207683_100851452 198
180 3300028379 Ga0268266_10313833 Ga0268266_103138332 198
181 3300001979 JGI24740J21852_10014457 JGI24740J21852_100144574 199
182 3300002773 JGI25152J39213_1001872 JGI25152J39213_10018724 199
183 3300002773 JGI25152J39213_1013199 JGI25152J39213_10131992 199
184 3300002774 JGI25150J39212_1000863 JGI25150J39212_10008632 199
185 3300002774 JGI25150J39212_1005077 JGI25150J39212_10050774 199
186 3300002987 JGI25159J45721_1001848 JGI25159J45721_10018489 199
187 3300002987 JGI25159J45721_1011405 JGI25159J45721_10114052 199
188 3300003187 JGI25151J46595_10000224 JGI25151J46595_100002242 199
189 3300003187 JGI25151J46595_10003612 JGI25151J46595_100036124 199
190 3300003187 JGI25151J46595_10055825 JGI25151J46595_100558252 199
191 3300003215 JGI25153J46596_10000570 JGI25153J46596_100005704 199
192 3300003215 JGI25153J46596_10045861 JGI25153J46596_100458612 199
193 3300003354 JGI25160J50197_1002537 JGI25160J50197_10025379 199
194 3300003354 JGI25160J50197_1010940 JGI25160J50197_10109402 199
195 3300003374 JGI25161J50226_1004265 JGI25161J50226_10042652 199
196 3300003374 JGI25161J50226_1004510 JGI25161J50226_10045102 199
197 3300003578 Ga0006562J51391_1130119 Ga0006562J51391_11301191 199
198 3300003578 Ga0006562J51391_1130120 Ga0006562J51391_11301201 199
199 3300003578 Ga0006562J51391_1140775 Ga0006562J51391_11407754 199
200 3300003578 Ga0006562J51391_1140777 Ga0006562J51391_11407773 199
201 3300003758 Ga0055532_1009987 Ga0055532_10099871 199
202 3300003761 Ga0055535_1000750 Ga0055535_100075011 199
203 3300003762 Ga0055542_1000583 Ga0055542_100058311 199
204 3300003771 Ga0055526_1003328 Ga0055526_100332812 199
205 3300003771 Ga0055526_1006106 Ga0055526_10061069 199
206 3300003773 Ga0055537_1000049 Ga0055537_100004917 199
207 3300003773 Ga0055537_1002248 Ga0055537_10022489 199
208 3300003773 Ga0055537_1014400 Ga0055537_10144002 199
209 3300003775 Ga0055524_1002965 Ga0055524_10029659 199
210 3300003775 Ga0055524_1003751 Ga0055524_10037514 199
211 3300003781 Ga0055536_1002470 Ga0055536_10024703 199
212 3300003781 Ga0055536_1008143 Ga0055536_10081433 199
213 3300003781 Ga0055536_1008959 Ga0055536_10089594 199
214 3300003781 Ga0055536_1057229 Ga0055536_10572291 199
215 3300003784 Ga0055534_1000049 Ga0055534_100004982 199
216 3300003784 Ga0055534_1000343 Ga0055534_10003436 199
217 3300003784 Ga0055534_1002329 Ga0055534_10023299 199
218 3300003784 Ga0055534_1003905 Ga0055534_10039052 199
219 3300003790 Ga0055528_1001187 Ga0055528_100118716 199
220 3300003790 Ga0055528_1004551 Ga0055528_10045519 199
221 3300003790 Ga0055528_1030326 Ga0055528_10303262 199
222 3300003791 Ga0055530_10000318 Ga0055530_1000031843 199
223 3300003791 Ga0055530_10027635 Ga0055530_100276352 199
224 3300003791 Ga0055530_10031974 Ga0055530_100319742 199
225 3300003792 Ga0055540_1001928 Ga0055540_100192812 199
226 3300003792 Ga0055540_1003384 Ga0055540_10033843 199
227 3300003792 Ga0055540_1004195 Ga0055540_10041953 199
228 3300003792 Ga0055540_1006573 Ga0055540_10065735 199
229 3300003792 Ga0055540_1007675 Ga0055540_10076752 199
230 3300003792 Ga0055540_1025065 Ga0055540_10250652 199
231 3300003792 Ga0055540_1037495 Ga0055540_10374952 199
232 3300003794 Ga0055531_10000738 Ga0055531_1000073814 199
233 3300003794 Ga0055531_10002357 Ga0055531_100023574 199
234 3300003794 Ga0055531_10007991 Ga0055531_100079914 199
235 3300003794 Ga0055531_10021737 Ga0055531_100217372 199
236 3300004625 Ga0055543_1001645 Ga0055543_10016459 199
237 3300004625 Ga0055543_1002190 Ga0055543_10021901 199
238 3300005262 Ga0065165_1003399 Ga0065165_10033994 199
239 3300005288 Ga0065714_10003219 Ga0065714_1000321912 199
240 3300005289 Ga0065704_10275364 Ga0065704_102753641 199
241 3300005327 Ga0070658_10220642 Ga0070658_102206422 199
242 3300005331 Ga0070670_100465219 Ga0070670_1004652191 199
243 3300005334 Ga0068869_100821021 Ga0068869_1008210212 199
244 3300005338 Ga0068868_100014255 Ga0068868_1000142553 199
245 3300005338 Ga0068868_100164794 Ga0068868_1001647942 199
246 3300005344 Ga0070661_100068133 Ga0070661_1000681333 199
247 3300005347 Ga0070668_100111555 Ga0070668_1001115552 199
248 3300005353 Ga0070669_100043608 Ga0070669_1000436082 199
249 3300005356 Ga0070674_100612924 Ga0070674_1006129242 199
250 3300005367 Ga0070667_100290148 Ga0070667_1002901482 199
251 3300005455 Ga0070663_100197648 Ga0070663_1001976482 199
252 3300005456 Ga0070678_100052297 Ga0070678_1000522974 199
253 3300005456 Ga0070678_100454674 Ga0070678_1004546742 199
254 3300005456 Ga0070678_100506453 Ga0070678_1005064532 199
255 3300005457 Ga0070662_100026306 Ga0070662_1000263064 199
256 3300005459 Ga0068867_100259949 Ga0068867_1002599492 199
257 3300005459 Ga0068867_100687106 Ga0068867_1006871062 199
258 3300005539 Ga0068853_100823620 Ga0068853_1008236201 199
259 3300005547 Ga0070693_100830647 Ga0070693_1008306471 199
260 3300005548 Ga0070665_100234720 Ga0070665_1002347202 199
261 3300005548 Ga0070665_100488021 Ga0070665_1004880212 199
262 3300005548 Ga0070665_100662473 Ga0070665_1006624732 199
263 3300005563 Ga0068855_100112017 Ga0068855_1001120172 199
264 3300005563 Ga0068855_100175809 Ga0068855_1001758092 199
265 3300005564 Ga0070664_100067201 Ga0070664_1000672012 199
266 3300005577 Ga0068857_100064951 Ga0068857_1000649512 199
267 3300005578 Ga0068854_100194092 Ga0068854_1001940923 199
268 3300005614 Ga0068856_100334978 Ga0068856_1003349782 199
269 3300005618 Ga0068864_100555712 Ga0068864_1005557122 199
270 3300005834 Ga0068851_10011783 Ga0068851_100117834 199
271 3300005841 Ga0068863_100155513 Ga0068863_1001555133 199
272 3300005844 Ga0068862_100109907 Ga0068862_1001099073 199
273 3300006048 Ga0075363_100017180 Ga0075363_1000171803 199
274 3300006048 Ga0075363_100065074 Ga0075363_1000650742 199
275 3300006048 Ga0075363_100171738 Ga0075363_1001717382 199
276 3300006048 Ga0075363_100264430 Ga0075363_1002644302 199
277 3300006048 Ga0075363_100280042 Ga0075363_1002800422 199
278 3300006058 Ga0075432_10074273 Ga0075432_100742732 199
279 3300006058 Ga0075432_10108319 Ga0075432_101083192 199
280 3300006177 Ga0075362_10002978 Ga0075362_100029787 199
281 3300006177 Ga0075362_10013006 Ga0075362_100130062 199
282 3300006177 Ga0075362_10019237 Ga0075362_100192373 199
283 3300006186 Ga0075369_10218994 Ga0075369_102189942 199
284 3300006195 Ga0075366_10072694 Ga0075366_100726942 199
285 3300006195 Ga0075366_10080886 Ga0075366_100808862 199
286 3300006195 Ga0075366_10100065 Ga0075366_101000652 199
287 3300006195 Ga0075366_10105913 Ga0075366_101059132 199
288 3300006195 Ga0075366_10124003 Ga0075366_101240032 199
289 3300006195 Ga0075366_10190135 Ga0075366_101901352 199
290 3300006237 Ga0097621_100246691 Ga0097621_1002466912 199
291 3300006237 Ga0097621_100797262 Ga0097621_1007972622 199
292 3300006353 Ga0075370_10001034 Ga0075370_100010347 199
293 3300006353 Ga0075370_10003779 Ga0075370_100037794 199
294 3300006353 Ga0075370_10023982 Ga0075370_100239823 199
295 3300006353 Ga0075370_10065741 Ga0075370_100657413 199
296 3300006353 Ga0075370_10071851 Ga0075370_100718512 199
297 3300006358 Ga0068871_100615614 Ga0068871_1006156142 199
298 3300006846 Ga0075430_100101548 Ga0075430_1001015483 199
299 3300006847 Ga0075431_100299414 Ga0075431_1002994142 199
300 3300006880 Ga0075429_100782157 Ga0075429_1007821572 199
301 3300006948 Ga0099826_10114653 Ga0099826_101146532 199
302 3300009036 Ga0105244_10036366 Ga0105244_100363662 199
303 3300009036 Ga0105244_10166189 Ga0105244_101661892 199
304 3300009148 Ga0105243_10001140 Ga0105243_100011404 199
305 3300009148 Ga0105243_10014072 Ga0105243_100140725 199
306 3300009174 Ga0105241_10031745 Ga0105241_100317453 199
307 3300009176 Ga0105242_11564768 Ga0105242_115647681 199
308 3300009177 Ga0105248_10206365 Ga0105248_102063653 199
309 3300010375 Ga0105239_10577955 Ga0105239_105779552 199
310 3300010375 Ga0105239_11018428 Ga0105239_110184281 199
311 3300012502 Ga0157347_1009909 Ga0157347_10099092 199
312 3300013100 Ga0157373_10095661 Ga0157373_100956612 199
313 3300013104 Ga0157370_10002450 Ga0157370_100024504 199
314 3300013104 Ga0157370_10240479 Ga0157370_102404792 199
315 3300013306 Ga0163162_11125515 Ga0163162_111255151 199
316 3300013308 Ga0157375_10822204 Ga0157375_108222042 199
317 3300014325 Ga0163163_10625101 Ga0163163_106251012 199
318 3300014497 Ga0182008_10000225 Ga0182008_100002258 199
319 3300014497 Ga0182008_10011230 Ga0182008_100112302 199
320 3300014497 Ga0182008_10014507 Ga0182008_100145073 199
321 3300014497 Ga0182008_10019854 Ga0182008_100198542 199
322 3300014497 Ga0182008_10040078 Ga0182008_100400783 199
323 3300014497 Ga0182008_10259584 Ga0182008_102595842 199
324 3300014968 Ga0157379_10512770 Ga0157379_105127702 199
325 3300014969 Ga0157376_10038395 Ga0157376_100383954 199
326 3300014969 Ga0157376_10405592 Ga0157376_104055922 199
327 3300014969 Ga0157376_10940372 Ga0157376_109403722 199
328 3300015261 Ga0182006_1010162 Ga0182006_10101623 199
329 3300015261 Ga0182006_1041803 Ga0182006_10418032 199
330 3300015262 Ga0182007_10003534 Ga0182007_100035345 199
331 3300015262 Ga0182007_10020624 Ga0182007_100206242 199
332 3300015265 Ga0182005_1016595 Ga0182005_10165953 199
333 3300015265 Ga0182005_1039584 Ga0182005_10395841 199
334 3300015683 Ga0183362_10005 Ga0183362_10005340 199
335 3300017792 Ga0163161_10000114 Ga0163161_1000011438 199
336 3300017792 Ga0163161_10051863 Ga0163161_100518632 199
337 3300017792 Ga0163161_10101427 Ga0163161_101014272 199
338 3300017792 Ga0163161_10232667 Ga0163161_102326672 199
339 3300017792 Ga0163161_10241309 Ga0163161_102413092 199
340 3300017792 Ga0163161_10679700 Ga0163161_106797002 199
341 3300017792 Ga0163161_11266573 Ga0163161_112665731 199
342 3300021361 Ga0213872_10005990 Ga0213872_100059905 199
343 3300025228 Ga0209672_100477 Ga0209672_10047717 199
344 3300025229 Ga0209147_101499 Ga0209147_1014994 199
345 3300025242 Ga0209258_100568 Ga0209258_10056829 199
346 3300025245 Ga0207425_1000069 Ga0207425_100006998 199
347 3300025245 Ga0207425_1007005 Ga0207425_10070054 199
348 3300025254 Ga0209148_1000033 Ga0209148_1000033101 199
349 3300025258 Ga0209129_1000233 Ga0209129_100023367 199
350 3300025258 Ga0209129_1001166 Ga0209129_10011662 199
351 3300025258 Ga0209129_1006462 Ga0209129_10064624 199
352 3300025263 Ga0209565_1000020 Ga0209565_1000020387 199
353 3300025263 Ga0209565_1000171 Ga0209565_100017167 199
354 3300025263 Ga0209565_1007159 Ga0209565_10071592 199
355 3300025263 Ga0209565_1047747 Ga0209565_10477472 199
356 3300025273 Ga0209673_1000295 Ga0209673_100029581 199
357 3300025273 Ga0209673_1000301 Ga0209673_100030156 199
358 3300025273 Ga0209673_1004394 Ga0209673_10043947 199
359 3300025273 Ga0209673_1009432 Ga0209673_10094324 199
360 3300025273 Ga0209673_1020108 Ga0209673_10201082 199
361 3300025273 Ga0209673_1020941 Ga0209673_10209412 199
362 3300025284 Ga0209130_1000193 Ga0209130_100019344 199
363 3300025284 Ga0209130_1000366 Ga0209130_100036645 199
364 3300025284 Ga0209130_1001843 Ga0209130_10018435 199
365 3300025284 Ga0209130_1025709 Ga0209130_10257092 199
366 3300025291 Ga0209675_1000014 Ga0209675_1000014376 199
367 3300025291 Ga0209675_1000236 Ga0209675_100023667 199
368 3300025291 Ga0209675_1000582 Ga0209675_10005826 199
369 3300025291 Ga0209675_1006428 Ga0209675_10064284 199
370 3300025291 Ga0209675_1008038 Ga0209675_10080384 199
371 3300025292 Ga0209676_1000048 Ga0209676_1000048228 199
372 3300025292 Ga0209676_1000098 Ga0209676_100009845 199
373 3300025292 Ga0209676_1000123 Ga0209676_100012334 199
374 3300025292 Ga0209676_1013512 Ga0209676_10135123 199
375 3300025292 Ga0209676_1018047 Ga0209676_10180473 199
376 3300025292 Ga0209676_1023673 Ga0209676_10236733 199
377 3300025292 Ga0209676_1043481 Ga0209676_10434812 199
378 3300025292 Ga0209676_1050949 Ga0209676_10509492 199
379 3300025294 Ga0209025_1000204 Ga0209025_100020462 199
380 3300025294 Ga0209025_1000264 Ga0209025_100026467 199
381 3300025294 Ga0209025_1000348 Ga0209025_100034830 199
382 3300025294 Ga0209025_1005823 Ga0209025_10058232 199
383 3300025294 Ga0209025_1019355 Ga0209025_10193554 199
384 3300025294 Ga0209025_1019870 Ga0209025_10198704 199
385 3300025295 Ga0209564_1000231 Ga0209564_100023167 199
386 3300025295 Ga0209564_1002077 Ga0209564_100207715 199
387 3300025297 Ga0209758_1000222 Ga0209758_100022267 199
388 3300025297 Ga0209758_1051551 Ga0209758_10515512 199
389 3300025298 Ga0209050_1000012 Ga0209050_1000012228 199
390 3300025298 Ga0209050_1001339 Ga0209050_10013394 199
391 3300025298 Ga0209050_1033105 Ga0209050_10331052 199
392 3300025298 Ga0209050_1035197 Ga0209050_10351972 199
393 3300025299 Ga0209256_1000095 Ga0209256_100009559 199
394 3300025299 Ga0209256_1000284 Ga0209256_100028455 199
395 3300025299 Ga0209256_1016014 Ga0209256_10160142 199
396 3300025302 Ga0207426_1000058 Ga0207426_100005835 199
397 3300025302 Ga0207426_1000349 Ga0207426_100034944 199
398 3300025303 Ga0209051_1000019 Ga0209051_1000019147 199
399 3300025303 Ga0209051_1000091 Ga0209051_100009134 199
400 3300025303 Ga0209051_1000098 Ga0209051_100009845 199
401 3300025303 Ga0209051_1000099 Ga0209051_100009969 199
402 3300025303 Ga0209051_1000342 Ga0209051_100034232 199
403 3300025303 Ga0209051_1001310 Ga0209051_10013103 199
404 3300025303 Ga0209051_1025182 Ga0209051_10251822 199
405 3300025304 Ga0209257_1000024 Ga0209257_1000024174 199
406 3300025304 Ga0209257_1000497 Ga0209257_100049728 199
407 3300025304 Ga0209257_1000677 Ga0209257_100067767 199
408 3300025304 Ga0209257_1003804 Ga0209257_100380410 199
409 3300025304 Ga0209257_1004226 Ga0209257_10042262 199
410 3300025304 Ga0209257_1052704 Ga0209257_10527042 199
411 3300025321 Ga0207656_10015819 Ga0207656_100158193 199
412 3300025728 Ga0207655_1000675 Ga0207655_10006754 199
413 3300025893 Ga0207682_10146311 Ga0207682_101463112 199
414 3300025907 Ga0207645_10135701 Ga0207645_101357012 199
415 3300025923 Ga0207681_10083126 Ga0207681_100831262 199
416 3300025933 Ga0207706_10035041 Ga0207706_100350415 199
417 3300025935 Ga0207709_10000331 Ga0207709_1000033133 199
418 3300025935 Ga0207709_10000464 Ga0207709_1000046420 199
419 3300025935 Ga0207709_10008913 Ga0207709_100089136 199
420 3300025938 Ga0207704_10797581 Ga0207704_107975812 199
421 3300025940 Ga0207691_10633910 Ga0207691_106339102 199
422 3300025941 Ga0207711_10129776 Ga0207711_101297762 199
423 3300025942 Ga0207689_10100011 Ga0207689_101000113 199
424 3300025942 Ga0207689_10588989 Ga0207689_105889891 199
425 3300025945 Ga0207679_10074547 Ga0207679_100745474 199
426 3300025949 Ga0207667_10099672 Ga0207667_100996722 199
427 3300025949 Ga0207667_10109713 Ga0207667_101097134 199
428 3300025960 Ga0207651_10206224 Ga0207651_102062242 199
429 3300025981 Ga0207640_10482424 Ga0207640_104824242 199
430 3300025986 Ga0207658_10255627 Ga0207658_102556272 199
431 3300025986 Ga0207658_10865360 Ga0207658_108653601 199
432 3300026023 Ga0207677_10018143 Ga0207677_100181433 199
433 3300026023 Ga0207677_10288768 Ga0207677_102887682 199
434 3300026041 Ga0207639_10020870 Ga0207639_100208704 199
435 3300026078 Ga0207702_10667621 Ga0207702_106676212 199
436 3300026078 Ga0207702_10725298 Ga0207702_107252981 199
437 3300026088 Ga0207641_10129708 Ga0207641_101297083 199
438 3300026095 Ga0207676_10681670 Ga0207676_106816702 199
439 3300026116 Ga0207674_10122845 Ga0207674_101228452 199
440 3300026116 Ga0207674_10269315 Ga0207674_102693152 199
441 3300026116 Ga0207674_10328358 Ga0207674_103283582 199
442 3300026121 Ga0207683_10092950 Ga0207683_100929503 199
443 3300026121 Ga0207683_10377433 Ga0207683_103774332 199
444 3300026121 Ga0207683_10427315 Ga0207683_104273152 199
445 3300027666 Ga0209282_1005738 Ga0209282_10057384 199
446 3300027666 Ga0209282_1093813 Ga0209282_10938132 199
447 3300028379 Ga0268266_10200059 Ga0268266_102000592 199
448 3300028380 Ga0268265_10021322 Ga0268265_100213225 199
449 3300028794 Ga0307515_10000040 Ga0307515_10000040148 199
450 3300028794 Ga0307515_10099599 Ga0307515_100995992 199
451 3300030731 Ga0316177_1099357 Ga0316177_10993572 199
452 3300030732 Ga0316176_1067430 Ga0316176_10674302 199
453 3300030742 Ga0316183_1086557 Ga0316183_108655717 199
454 3300031235 Ga0265330_10019471 Ga0265330_100194713 199
455 3300031247 Ga0265340_10217061 Ga0265340_102170611 199
456 3300031251 Ga0265327_10000746 Ga0265327_1000074621 199
457 3300031251 Ga0265327_10044923 Ga0265327_100449232 199
458 3300031456 Ga0307513_10113647 Ga0307513_101136474 199
459 3300031456 Ga0307513_10175863 Ga0307513_101758632 199
460 3300031456 Ga0307513_10313467 Ga0307513_103134672 199
461 3300031548 Ga0307408_100003650 Ga0307408_1000036503 199
462 3300031548 Ga0307408_100051116 Ga0307408_1000511162 199
463 3300031548 Ga0307408_100053852 Ga0307408_1000538524 199
464 3300031548 Ga0307408_100076112 Ga0307408_1000761122 199
465 3300031548 Ga0307408_101162263 Ga0307408_1011622631 199
466 3300031649 Ga0307514_10008104 Ga0307514_100081045 199
467 3300031730 Ga0307516_10077116 Ga0307516_100771163 199
468 3300031731 Ga0307405_10012930 Ga0307405_100129305 199
469 3300031731 Ga0307405_10027530 Ga0307405_100275303 199
470 3300031731 Ga0307405_10280752 Ga0307405_102807522 199
471 3300031731 Ga0307405_10546594 Ga0307405_105465942 199
472 3300031731 Ga0307405_10641943 Ga0307405_106419432 199
473 3300031731 Ga0307405_10695234 Ga0307405_106952342 199
474 3300031731 Ga0307405_11133808 Ga0307405_111338081 199
475 3300031824 Ga0307413_10055028 Ga0307413_100550282 199
476 3300031824 Ga0307413_10434456 Ga0307413_104344562 199
477 3300031901 Ga0307406_10000324 Ga0307406_1000032427 199
478 3300031901 Ga0307406_10059024 Ga0307406_100590242 199
479 3300031901 Ga0307406_10235516 Ga0307406_102355162 199
480 3300031901 Ga0307406_10260938 Ga0307406_102609382 199
481 3300031901 Ga0307406_10316864 Ga0307406_103168642 199
482 3300031901 Ga0307406_10750741 Ga0307406_107507412 199
483 3300031903 Ga0307407_10445024 Ga0307407_104450242 199
484 3300031911 Ga0307412_10030197 Ga0307412_100301972 199
485 3300031911 Ga0307412_10043892 Ga0307412_100438924 199
486 3300031911 Ga0307412_10077823 Ga0307412_100778234 199
487 3300031911 Ga0307412_10102742 Ga0307412_101027422 199
488 3300031911 Ga0307412_10247791 Ga0307412_102477912 199
489 3300031995 Ga0307409_101043332 Ga0307409_1010433322 199
490 3300032002 Ga0307416_100010896 Ga0307416_1000108963 199
491 3300032004 Ga0307414_10078062 Ga0307414_100780621 199
492 3300032004 Ga0307414_10610220 Ga0307414_106102202 199
493 3300032004 Ga0307414_10710933 Ga0307414_107109332 199
494 3300032005 Ga0307411_10001615 Ga0307411_100016152 199
495 3300032005 Ga0307411_10027661 Ga0307411_100276612 199
496 3300032005 Ga0307411_10578154 Ga0307411_105781542 199
497 3300032126 Ga0307415_100393587 Ga0307415_1003935872 199
498 3300035691 Ga0373931_0032340 Ga0373931_0032340_313_915 199
499 3300036401 Ga0373937_0627494 Ga0373937_0627494_16_621 199
500 3300037312 Ga0395899_0001018 Ga0395899_0001018_18744_19349 199
501 3300037312 Ga0395899_0322141 Ga0395899_0322141_243_848 199
502 3300037312 Ga0395899_0455726 Ga0395899_0455726_144_746 199
503 3300037418 Ga0395900_0040394 Ga0395900_0040394_3306_3911 199
504 3300037418 Ga0395900_0216421 Ga0395900_0216421_1032_1637 199
505 3300037466 Ga0395898_0008698 Ga0395898_0008698_6272_6877 199
506 3300037466 Ga0395898_0107645 Ga0395898_0107645_578_1183 199
507 3300037466 Ga0395898_0199014 Ga0395898_0199014_64_666 199
508 3300037471 Ga0395905_0002817 Ga0395905_0002817_1883_2494 199
509 3300037471 Ga0395905_0004508 Ga0395905_0004508_6637_7242 199
510 3300037471 Ga0395905_0008661 Ga0395905_0008661_8556_9161 199
511 3300037471 Ga0395905_0052347 Ga0395905_0052347_1780_2385 199
512 3300037471 Ga0395905_0065940 Ga0395905_0065940_2650_3276 199
513 3300037471 Ga0395905_0089643 Ga0395905_0089643_589_1194 199
514 3300037471 Ga0395905_0206749 Ga0395905_0206749_846_1454 199
515 3300037471 Ga0395905_0228685 Ga0395905_0228685_543_1148 199
516 3300037471 Ga0395905_0795698 Ga0395905_0795698_124_729 199
517 3300037471 Ga0395905_0834446 Ga0395905_0834446_185_793 199
518 3300038443 Ga0395901_0022637 Ga0395901_0022637_998_1603 199
519 3300038443 Ga0395901_0097141 Ga0395901_0097141_664_1269 199
520 3300038443 Ga0395901_0366817 Ga0395901_0366817_113_718 199
521 3300039447 Ga0436361_0837231 Ga0436361_0837231_542_1150 199
522 3300041404 Ga0439436_0000586 Ga0439436_0000586_8777_9376 199
523 3300041404 Ga0439436_0003260 Ga0439436_0003260_286_885 199
524 3300041404 Ga0439436_0053662 Ga0439436_0053662_63_662 199
525 3300041406 Ga0439439_0007617 Ga0439439_0007617_1493_2092 199
526 3300041406 Ga0439439_0012633 Ga0439439_0012633_1252_1851 199
527 3300041407 Ga0439447_031943 Ga0439447_031943_516_1115 199
528 3300041407 Ga0439447_074976 Ga0439447_074976_86_715 199
529 3300041407 Ga0439447_080230 Ga0439447_080230_29_628 199
530 3300041410 Ga0439461_0001667 Ga0439461_0001667_1647_2246 199
531 3300041411 Ga0439466_0016222 Ga0439466_0016222_425_1024 199
532 3300041411 Ga0439466_0093318 Ga0439466_0093318_217_816 199
533 3300041413 Ga0439465_0000571 Ga0439465_0000571_2276_2875 199
534 3300041498 Ga0451841_1087416 Ga0451841_1087416_47_646 199
535 3300041997 Ga0439431_0000218 Ga0439431_0000218_4433_5032 199
536 3300041997 Ga0439431_0023674 Ga0439431_0023674_135_734 199
537 3300041997 Ga0439431_0045506 Ga0439431_0045506_56_655 199
538 3300042000 Ga0439437_023326 Ga0439437_023326_74_691 199
539 3300042002 Ga0439442_014583 Ga0439442_014583_718_1317 199
540 3300042004 Ga0439445_0005073 Ga0439445_0005073_564_1163 199
541 3300042004 Ga0439445_0060743 Ga0439445_0060743_348_947 199
542 3300042004 Ga0439445_0100640 Ga0439445_0100640_17_616 199
543 3300042006 Ga0439432_000464 Ga0439432_000464_4197_4796 199
544 3300042006 Ga0439432_013370 Ga0439432_013370_2039_2638 199
545 3300042007 Ga0439449_0001782 Ga0439449_0001782_5897_6502 199
546 3300042007 Ga0439449_0002685 Ga0439449_0002685_2010_2609 199
547 3300042007 Ga0439449_0232706 Ga0439449_0232706_37_645 199
548 3300042010 Ga0439452_009991 Ga0439452_009991_402_1001 199
549 3300042012 Ga0439455_0031067 Ga0439455_0031067_109_708 199
550 3300042014 Ga0439457_021851 Ga0439457_021851_175_774 199
551 3300042014 Ga0439457_039645 Ga0439457_039645_146_745 199
552 3300042014 Ga0439457_045282 Ga0439457_045282_71_676 199
553 3300042014 Ga0439457_067131 Ga0439457_067131_174_773 199
554 3300042015 Ga0439462_0001912 Ga0439462_0001912_2069_2668 199
555 3300042015 Ga0439462_0006154 Ga0439462_0006154_264_863 199
556 3300042015 Ga0439462_0007329 Ga0439462_0007329_1568_2173 199
557 3300042015 Ga0439462_0029151 Ga0439462_0029151_135_734 199
558 3300042015 Ga0439462_0033550 Ga0439462_0033550_124_723 199
559 3300042115 Ga0450911_000496 Ga0450911_000496_5571_6170 199
560 3300042121 Ga0450919_008525 Ga0450919_008525_62_661 199
561 3300042131 Ga0450894_011246 Ga0450894_011246_461_1060 199
562 3300042145 Ga0450906_014085 Ga0450906_014085_280_879 199
563 3300042147 Ga0450910_001247 Ga0450910_001247_1230_1829 199
564 3300042156 Ga0439446_0088038 Ga0439446_0088038_250_849 199
565 3300042156 Ga0439446_0219893 Ga0439446_0219893_18_623 199
566 3300042184 Ga0450908_004376 Ga0450908_004376_1957_2556 199
567 3300042185 Ga0450909_014761 Ga0450909_014761_284_883 199
568 3300042185 Ga0450909_026382 Ga0450909_026382_169_774 199
569 3300042435 Ga0439434_0000517 Ga0439434_0000517_453_1052 199
570 3300042435 Ga0439434_0009050 Ga0439434_0009050_1846_2445 199
571 3300042461 Ga0439460_0030740 Ga0439460_0030740_255_860 199
572 3300042531 Ga0450918_006667 Ga0450918_006667_61_660 199
573 3300042531 Ga0450918_024708 Ga0450918_024708_228_827 199
574 3300042876 Ga0451577_0101455 Ga0451577_0101455_134_739 199
575 3300044656 Ga0466969_0021587 Ga0466969_0021587_2689_3294 199
576 3300044656 Ga0466969_0038894 Ga0466969_0038894_677_1282 199
577 3300044673 Ga0453683_0006241 Ga0453683_0006241_6127_6732 199
578 3300044683 Ga0466965_0370169 Ga0466965_0370169_37_636 199
579 3300044684 Ga0466966_0138717 Ga0466966_0138717_153_758 199
580 3300044693 Ga0466961_0099502 Ga0466961_0099502_246_851 199
581 3300044765 Ga0466970_0037823 Ga0466970_0037823_1020_1625 199
582 3300044842 Ga0466957_0396785 Ga0466957_0396785_147_752 199
583 3300044901 Ga0466960_0265159 Ga0466960_0265159_320_919 199
584 3300045049 Ga0466959_0036604 Ga0466959_0036604_2143_2748 199
585 3300045049 Ga0466959_0454665 Ga0466959_0454665_145_753 199
586 3300045051 Ga0451576_0017383 Ga0451576_0017383_5203_5808 199
587 3300046453 Ga0495627_057008 Ga0495627_057008_396_995 199
588 3300046457 Ga0495590_0080524 Ga0495590_0080524_280_879 199
589 3300046459 Ga0495629_0211632 Ga0495629_0211632_589_1188 199
590 3300046460 Ga0495638_0019572 Ga0495638_0019572_1777_2376 199
591 3300046512 Ga0495610_0021660 Ga0495610_0021660_1514_2113 199
592 3300046513 Ga0495616_0003870 Ga0495616_0003870_8332_8931 199
593 3300046518 Ga0495631_0000163 Ga0495631_0000163_38995_39594 199
594 3300046520 Ga0495637_0006475 Ga0495637_0006475_2220_2819 199
595 3300046525 Ga0495663_0037328 Ga0495663_0037328_822_1421 199
596 3300046528 Ga0495642_0081622 Ga0495642_0081622_324_929 199
597 3300046530 Ga0495654_0022427 Ga0495654_0022427_1337_1936 199
598 3300046530 Ga0495654_0201393 Ga0495654_0201393_224_823 199
599 3300046557 Ga0495622_0262361 Ga0495622_0262361_48_647 199
600 3300046558 Ga0495633_0148210 Ga0495633_0148210_112_711 199
601 3300046615 Ga0495656_0000163 Ga0495656_0000163_18890_19489 199
602 3300046615 Ga0495656_0111103 Ga0495656_0111103_286_891 199
603 3300046615 Ga0495656_0124913 Ga0495656_0124913_381_986 199
604 3300046660 Ga0495625_0000045 Ga0495625_0000045_142026_142625 199
605 3300046660 Ga0495625_0060501 Ga0495625_0060501_543_1142 199
606 3300046674 Ga0495588_0255079 Ga0495588_0255079_205_804 199
607 3300046683 Ga0495658_0115048 Ga0495658_0115048_10_609 199
608 3300046691 Ga0495670_0100652 Ga0495670_0100652_459_1058 199
609 3300046692 Ga0495671_0015415 Ga0495671_0015415_2320_2919 199
610 3300046810 Ga0495660_0045443 Ga0495660_0045443_55_654 199
611 3300047321 Ga0495676_0058877 Ga0495676_0058877_2347_2946 199
612 3300047470 Ga0495681_0253262 Ga0495681_0253262_66_671 199
613 3300047673 Ga0495593_0002104 Ga0495593_0002104_282_881 199
614 3300048089 Ga0495614_0088545 Ga0495614_0088545_70_669 199
615 3300048903 Ga0496100_0099001 Ga0496100_0099001_852_1457 199
616 3300048904 Ga0496101_0003542 Ga0496101_0003542_3687_4292 199
617 3300048904 Ga0496101_0059835 Ga0496101_0059835_1318_1917 199
618 3300048905 Ga0496102_0008409 Ga0496102_0008409_3910_4515 199
619 3300048905 Ga0496102_0266002 Ga0496102_0266002_546_1145 199
620 3300048907 Ga0496104_0116799 Ga0496104_0116799_11_616 199
621 3300048908 Ga0496105_0050318 Ga0496105_0050318_175_780 199
622 3300048913 Ga0496110_0013319 Ga0496110_0013319_334_939 199
623 3300048914 Ga0496111_0400359 Ga0496111_0400359_364_969 199
624 3300048917 Ga0496114_0371118 Ga0496114_0371118_377_982 199
625 3300048919 Ga0496116_0064554 Ga0496116_0064554_687_1286 199
626 3300048919 Ga0496116_0158318 Ga0496116_0158318_504_1103 199
627 3300048920 Ga0496117_0028929 Ga0496117_0028929_2941_3540 199
628 3300048920 Ga0496117_0059066 Ga0496117_0059066_614_1213 199
629 3300048920 Ga0496117_0112317 Ga0496117_0112317_780_1379 199
630 3300048921 Ga0496118_0032009 Ga0496118_0032009_1208_1807 199
631 3300048921 Ga0496118_0282758 Ga0496118_0282758_85_690 199
632 3300048921 Ga0496118_0297641 Ga0496118_0297641_242_841 199
633 3300048922 Ga0496119_0162441 Ga0496119_0162441_193_792 199
634 3300048924 Ga0496121_0006773 Ga0496121_0006773_5640_6239 199
635 3300048924 Ga0496121_0094623 Ga0496121_0094623_41_640 199
636 3300048924 Ga0496121_0146946 Ga0496121_0146946_79_678 199
637 3300048924 Ga0496121_0269007 Ga0496121_0269007_147_746 199
638 3300048924 Ga0496121_0316496 Ga0496121_0316496_413_1012 199
639 3300048925 Ga0496122_0000331 Ga0496122_0000331_45655_46254 199
640 3300048925 Ga0496122_0133772 Ga0496122_0133772_386_985 199
641 3300048925 Ga0496122_0162021 Ga0496122_0162021_527_1126 199
642 3300048925 Ga0496122_0367184 Ga0496122_0367184_38_643 199
643 3300048926 Ga0496123_0000124 Ga0496123_0000124_17561_18160 199
644 3300048926 Ga0496123_0040092 Ga0496123_0040092_2282_2899 199
645 3300048926 Ga0496123_0042013 Ga0496123_0042013_1926_2525 199
646 3300048926 Ga0496123_0161843 Ga0496123_0161843_100_699 199
647 3300048927 Ga0496124_0052777 Ga0496124_0052777_2181_2780 199
648 3300048927 Ga0496124_0141472 Ga0496124_0141472_537_1136 199
649 3300048927 Ga0496124_0183400 Ga0496124_0183400_641_1246 199
650 3300048928 Ga0496125_0014888 Ga0496125_0014888_2187_2786 199
651 3300048928 Ga0496125_0032434 Ga0496125_0032434_2826_3425 199
652 3300048928 Ga0496125_0032803 Ga0496125_0032803_2502_3101 199
653 3300048928 Ga0496125_0056027 Ga0496125_0056027_194_793 199
654 3300048928 Ga0496125_0128324 Ga0496125_0128324_1048_1647 199
655 3300048928 Ga0496125_0202642 Ga0496125_0202642_488_1087 199
656 3300048929 Ga0496126_0385908 Ga0496126_0385908_34_633 199
657 3300048929 Ga0496126_0427765 Ga0496126_0427765_29_628 199
658 3300049459 Ga0495678_120977 Ga0495678_120977_105_704 199
659 3300049569 Ga0501032_0279026 Ga0501032_0279026_14_619 199
660 3300049570 Ga0501033_0222049 Ga0501033_0222049_508_1119 199
661 3300049571 Ga0501034_0028787 Ga0501034_0028787_2538_3143 199
662 3300049572 Ga0501036_0544306 Ga0501036_0544306_39_644 199
663 3300049579 Ga0501043_0493917 Ga0501043_0493917_280_885 199
664 3300049581 Ga0501047_0050858 Ga0501047_0050858_2553_3158 199
665 3300049581 Ga0501047_0072718 Ga0501047_0072718_2194_2799 199
666 3300049581 Ga0501047_0360049 Ga0501047_0360049_274_885 199
667 3300049742 Ga0501080_0122319 Ga0501080_0122319_1262_1864 199
668 3300049759 Ga0501262_000120 Ga0501262_000120_6953_7561 199
669 3300049822 Ga0501035_0166450 Ga0501035_0166450_1225_1830 199
670 3300049823 Ga0501044_0504748 Ga0501044_0504748_21_632 199
671 3300050489 nmdc:mga03683_3109_c1 nmdc:mga03683_3109_c1_4328_4933 199
672 3300050490 nmdc:mga03n38_221925_c1 nmdc:mga03n38_221925_c1_366_965 199
673 3300050490 nmdc:mga03n38_97708_c1 nmdc:mga03n38_97708_c1_123_722 199
674 3300050491 nmdc:mga00v17_193484_c1 nmdc:mga00v17_193484_c1_429_1028 199
675 3300050492 nmdc:mga0yw44_22552_c1 nmdc:mga0yw44_22552_c1_1641_2240 199
676 3300050492 nmdc:mga0yw44_284841_c1 nmdc:mga0yw44_284841_c1_470_1075 199
677 3300050493 nmdc:mga0k408_290334_c1 nmdc:mga0k408_290334_c1_339_941 199
678 3300050493 nmdc:mga0k408_78444_c1 nmdc:mga0k408_78444_c1_729_1328 199
679 3300050493 nmdc:mga0k408_79978_c1 nmdc:mga0k408_79978_c1_658_1257 199
680 3300050494 nmdc:mga06z11_193123_c1 nmdc:mga06z11_193123_c1_90_689 199
681 3300050494 nmdc:mga06z11_301054_c1 nmdc:mga06z11_301054_c1_216_815 199
682 3300050494 nmdc:mga06z11_459275_c1 nmdc:mga06z11_459275_c1_55_657 199
683 3300050496 nmdc:mga07m45_17711_c1 nmdc:mga07m45_17711_c1_876_1475 199
684 3300050496 nmdc:mga07m45_29343_c2 nmdc:mga07m45_29343_c2_1175_1774 199
685 3300050496 nmdc:mga07m45_297175_c1 nmdc:mga07m45_297175_c1_324_923 199
686 3300050496 nmdc:mga07m45_5781_c1 nmdc:mga07m45_5781_c1_2813_3418 199
687 3300050496 nmdc:mga07m45_605_c1 nmdc:mga07m45_605_c1_10548_11147 199
688 3300050496 nmdc:mga07m45_62136_c1 nmdc:mga07m45_62136_c1_1074_1673 199
689 3300050496 nmdc:mga07m45_8102_c1 nmdc:mga07m45_8102_c1_4611_5213 199
690 3300050508 nmdc:mga09592_673856_c1 nmdc:mga09592_673856_c1_177_779 199
691 3300053079 Ga0500610_0000014 Ga0500610_0000014_1945_2544 199
692 3300053079 Ga0500610_0000021 Ga0500610_0000021_2720_3319 199
693 3300053087 Ga0500643_025509 Ga0500643_025509_567_1166 199
694 3300053093 Ga0500651_0000560 Ga0500651_0000560_10751_11350 199
695 3300053094 Ga0500566_0176662 Ga0500566_0176662_482_1081 199
696 3300053110 Ga0500571_026455 Ga0500571_026455_531_1130 199
697 3300053111 Ga0500572_061989 Ga0500572_061989_122_721 199
698 3300053117 Ga0500593_000644 Ga0500593_000644_11422_12021 199
699 3300053118 Ga0500594_0000473 Ga0500594_0000473_2056_2655 199
700 3300053121 Ga0500607_000674 Ga0500607_000674_27426_28025 199
701 3300053121 Ga0500607_125994 Ga0500607_125994_324_923 199
702 3300053122 Ga0500608_116280 Ga0500608_116280_473_1075 199
703 3300053128 Ga0500626_036089 Ga0500626_036089_179_778 199
704 3300053134 Ga0500658_0000034 Ga0500658_0000034_84366_84965 199
705 3300053134 Ga0500658_0001015 Ga0500658_0001015_3813_4412 199
706 3300053136 Ga0500559_0000367 Ga0500559_0000367_30532_31131 199
707 3300053138 Ga0500564_151480 Ga0500564_151480_180_779 199
708 3300053139 Ga0500568_0000490 Ga0500568_0000490_1274_1873 199
709 3300053151 Ga0500604_0148557 Ga0500604_0148557_156_755 199
710 3300053153 Ga0500616_0119166 Ga0500616_0119166_477_1076 199
711 3300053158 Ga0500627_0001528 Ga0500627_0001528_5118_5717 199
712 3300053158 Ga0500627_0175674 Ga0500627_0175674_234_833 199
713 3300053161 Ga0500634_0006252 Ga0500634_0006252_258_857 199
714 3300053161 Ga0500634_0122059 Ga0500634_0122059_109_708 199
715 3300053162 Ga0500638_132157 Ga0500638_132157_282_881 199
716 3300053177 Ga0500636_0046985 Ga0500636_0046985_1382_1981 199
717 3300053723 Ga0500567_099967 Ga0500567_099967_132_731 199
718 3300053734 Ga0500565_002430 Ga0500565_002430_325_924 199
719 3300059424 Ga0590075_007587 Ga0590075_007587_137_742 199
720 3300061719 Ga0466962_0250788 Ga0466962_0250788_54_659 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

4

199

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.968 3 194
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9532 3 194
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9186 1 197
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9178 1 196
2dvn-assembly1.cif.gz_A structure of ph1917 protein with the complex of imp from pyrococcus horikoshii 0.9102 1 197
ID Description Score Start End Superfamily
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9738 1 196 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9592 1 196 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9305 2 198 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9186 1 197 3.90.950.10
af_Q9UU89_2_186_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9156 2 196 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A522SJC3-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9974 1 199 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A1V6ET71-F1-model_v4 DITP/XTP pyrophosphatase (EC 3.6.1.19) 0.9955 74 199 GO:0005829
GO:0009117
GO:0009143
GO:0047429
AF-A0A6G8CR52-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9946 1 199 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7X9U394-F1-model_v4 deleted 0.9927 1 199
AF-A0A1M5EUG2-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9923 1 199 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.67 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map