F477295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 720 | 388 | 674 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300005840|Ga0068870_10219672|Ga0068870_102196722 |
| Length | 216 |
| Sequence | MKKIVIATNNVGKLNEIGAILAPLDIEIVAQSTLGVTEAAEPHCTFIENALAKARHASAQTGLPALADDSGICVDALNGAPGVHSARFAGESAQAAGGRASQDARNNQKLLDALAHETNRNAHYYCVIVLTRRADDPQPLVCEAEWHGEIVKTPRGSGGFGYDPLFLIPALNKTGAELGPEEKNRISHRGQALAALSAKLAGSRIEDRGSRTPRRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 8 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 9 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 10 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 11 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 12 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 13 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 14 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 15 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 16 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 17 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 18 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 19 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 20 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 21 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 22 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 23 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 24 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 25 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 26 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 27 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 28 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 29 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 30 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 31 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 32 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 33 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 34 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 35 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 36 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 37 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 38 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 39 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 40 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 41 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 42 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 43 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 44 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 45 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 46 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 47 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 48 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 49 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 50 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 51 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 52 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 53 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 54 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 55 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 56 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 61 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 64 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 71 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 77 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 78 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 97 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 107 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 111 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 115 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 118 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 119 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 121 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 127 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 128 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 150 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 153 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 215 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 216 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 226 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 237 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 256 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 259 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 260 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 261 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 262 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 267 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 268 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 269 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 270 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 271 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 272 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 273 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 274 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 275 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 276 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 277 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 278 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 279 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 280 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 281 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 282 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 283 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 284 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 285 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 288 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 289 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 290 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 293 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 294 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 295 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 298 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 329 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 366 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 367 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 371 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 372 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 373 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 375 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 377 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 383 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 386 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 387 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 388 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.06 |
| Metatranscriptomes | 0.56 |
| Isolates | 6.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.53 |
| Nodule | 0.56 |
| Rhizoplane | 1.94 |
| Rhizosphere | 60.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014457 | 3300001979 | Bacteria | 2911 |
| 2 | JGI25152J39213_1001872 | 3300002773 | Bacteria | 8458 |
| 3 | JGI25152J39213_1013199 | 3300002773 | Bacteria | 1732 |
| 4 | JGI25150J39212_1000863 | 3300002774 | Bacteria | 10077 |
| 5 | JGI25150J39212_1005077 | 3300002774 | Bacteria | 2845 |
| 6 | JGI25159J45721_1001848 | 3300002987 | Bacteria | 8458 |
| 7 | JGI25159J45721_1011405 | 3300002987 | Bacteria | 2181 |
| 8 | JGI25151J46595_10000224 | 3300003187 | Bacteria | 67033 |
| 9 | JGI25151J46595_10003612 | 3300003187 | Bacteria | 8458 |
| 10 | JGI25151J46595_10055825 | 3300003187 | Bacteria | 1300 |
| 11 | JGI25153J46596_10000570 | 3300003215 | Bacteria | 22743 |
| 12 | JGI25153J46596_10045861 | 3300003215 | Bacteria | 1300 |
| 13 | JGI25160J50197_1002537 | 3300003354 | Bacteria | 8458 |
| 14 | JGI25160J50197_1010940 | 3300003354 | Bacteria | 3252 |
| 15 | JGI25161J50226_1004265 | 3300003374 | Bacteria | 3032 |
| 16 | JGI25161J50226_1004510 | 3300003374 | Bacteria | 2903 |
| 17 | Ga0006562J51391_1130119 | 3300003578 | Bacteria | 1680 |
| 18 | Ga0006562J51391_1130120 | 3300003578 | Bacteria | 800 |
| 19 | Ga0006562J51391_1140775 | 3300003578 | Bacteria | 4680 |
| 20 | Ga0006562J51391_1140777 | 3300003578 | Bacteria | 4120 |
| 21 | Ga0055532_1009987 | 3300003758 | Bacteria | 1143 |
| 22 | Ga0055535_1000750 | 3300003761 | Bacteria | 24203 |
| 23 | Ga0055542_1000583 | 3300003762 | Bacteria | 31637 |
| 24 | Ga0055529_1001011 | 3300003763 | Bacteria | 13521 |
| 25 | Ga0055526_1003328 | 3300003771 | Bacteria | 10278 |
| 26 | Ga0055526_1006106 | 3300003771 | Bacteria | 6650 |
| 27 | Ga0055537_1000049 | 3300003773 | Bacteria | 87244 |
| 28 | Ga0055537_1002248 | 3300003773 | Bacteria | 6650 |
| 29 | Ga0055537_1014400 | 3300003773 | Bacteria | 1438 |
| 30 | Ga0055524_1002965 | 3300003775 | Bacteria | 8458 |
| 31 | Ga0055524_1003751 | 3300003775 | Bacteria | 7250 |
| 32 | Ga0055536_1002470 | 3300003781 | Bacteria | 10381 |
| 33 | Ga0055536_1008143 | 3300003781 | Bacteria | 4563 |
| 34 | Ga0055536_1008959 | 3300003781 | Bacteria | 4217 |
| 35 | Ga0055536_1057229 | 3300003781 | Bacteria | 823 |
| 36 | Ga0055534_1000049 | 3300003784 | Bacteria | 92974 |
| 37 | Ga0055534_1000343 | 3300003784 | Bacteria | 30091 |
| 38 | Ga0055534_1002329 | 3300003784 | Bacteria | 6650 |
| 39 | Ga0055534_1003905 | 3300003784 | Bacteria | 4518 |
| 40 | Ga0055528_1001187 | 3300003790 | Bacteria | 16830 |
| 41 | Ga0055528_1004551 | 3300003790 | Bacteria | 6650 |
| 42 | Ga0055528_1030326 | 3300003790 | Bacteria | 1438 |
| 43 | Ga0055530_10000318 | 3300003791 | Bacteria | 43641 |
| 44 | Ga0055530_10027635 | 3300003791 | Bacteria | 1546 |
| 45 | Ga0055530_10031974 | 3300003791 | Bacteria | 1374 |
| 46 | Ga0055540_1001928 | 3300003792 | Bacteria | 11588 |
| 47 | Ga0055540_1003384 | 3300003792 | Bacteria | 7728 |
| 48 | Ga0055540_1004195 | 3300003792 | Bacteria | 6636 |
| 49 | Ga0055540_1006573 | 3300003792 | Bacteria | 4583 |
| 50 | Ga0055540_1007675 | 3300003792 | Bacteria | 4022 |
| 51 | Ga0055540_1025065 | 3300003792 | Bacteria | 1467 |
| 52 | Ga0055540_1037495 | 3300003792 | Bacteria | 1068 |
| 53 | Ga0055531_10000738 | 3300003794 | Bacteria | 27594 |
| 54 | Ga0055531_10002357 | 3300003794 | Bacteria | 12698 |
| 55 | Ga0055531_10007991 | 3300003794 | Bacteria | 5658 |
| 56 | Ga0055531_10021737 | 3300003794 | Bacteria | 2475 |
| 57 | Ga0055543_1001645 | 3300004625 | Bacteria | 8512 |
| 58 | Ga0055543_1002190 | 3300004625 | Bacteria | 6700 |
| 59 | Ga0065165_1003399 | 3300005262 | Bacteria | 11243 |
| 60 | Ga0065714_10003219 | 3300005288 | Bacteria | 12731 |
| 61 | Ga0065704_10275364 | 3300005289 | Bacteria | 934 |
| 62 | Ga0070658_10220642 | 3300005327 | Bacteria | 1603 |
| 63 | Ga0070676_10304541 | 3300005328 | Bacteria | 1081 |
| 64 | Ga0070670_100194010 | 3300005331 | Bacteria | 1764 |
| 65 | Ga0070670_100465219 | 3300005331 | Bacteria | 1122 |
| 66 | Ga0070670_100570772 | 3300005331 | Bacteria | 1010 |
| 67 | Ga0068869_100821021 | 3300005334 | Bacteria | 800 |
| 68 | Ga0068868_100014255 | 3300005338 | Bacteria | 5854 |
| 69 | Ga0068868_100164794 | 3300005338 | Bacteria | 1832 |
| 70 | Ga0070661_100068133 | 3300005344 | Bacteria | 2616 |
| 71 | Ga0070692_10292517 | 3300005345 | Bacteria | 991 |
| 72 | Ga0070668_100111555 | 3300005347 | Bacteria | 2177 |
| 73 | Ga0070668_100130668 | 3300005347 | Bacteria | 2015 |
| 74 | Ga0070669_100043608 | 3300005353 | Bacteria | 3268 |
| 75 | Ga0070669_100131849 | 3300005353 | Bacteria | 1918 |
| 76 | Ga0070669_100262967 | 3300005353 | Bacteria | 1377 |
| 77 | Ga0070669_100361837 | 3300005353 | Bacteria | 1180 |
| 78 | Ga0070675_100041967 | 3300005354 | Bacteria | 3737 |
| 79 | Ga0070671_100129474 | 3300005355 | Bacteria | 2125 |
| 80 | Ga0070674_100318253 | 3300005356 | Bacteria | 1246 |
| 81 | Ga0070674_100612924 | 3300005356 | Bacteria | 921 |
| 82 | Ga0070673_100365501 | 3300005364 | Bacteria | 1283 |
| 83 | Ga0070667_100290148 | 3300005367 | Bacteria | 1471 |
| 84 | Ga0070701_10007392 | 3300005438 | Bacteria | 4691 |
| 85 | Ga0070700_100612691 | 3300005441 | Bacteria | 854 |
| 86 | Ga0070663_100197648 | 3300005455 | Bacteria | 1568 |
| 87 | Ga0070678_100028025 | 3300005456 | Bacteria | 3834 |
| 88 | Ga0070678_100049560 | 3300005456 | Bacteria | 3031 |
| 89 | Ga0070678_100052297 | 3300005456 | Bacteria | 2965 |
| 90 | Ga0070678_100454674 | 3300005456 | Bacteria | 1122 |
| 91 | Ga0070678_100506453 | 3300005456 | Bacteria | 1066 |
| 92 | Ga0070662_100026306 | 3300005457 | Bacteria | 4028 |
| 93 | Ga0068867_100168784 | 3300005459 | Bacteria | 1731 |
| 94 | Ga0068867_100259949 | 3300005459 | Bacteria | 1415 |
| 95 | Ga0068867_100423233 | 3300005459 | Bacteria | 1128 |
| 96 | Ga0068867_100687106 | 3300005459 | Bacteria | 902 |
| 97 | Ga0070685_10113354 | 3300005466 | Bacteria | 1674 |
| 98 | Ga0070706_100059087 | 3300005467 | Bacteria | 3539 |
| 99 | Ga0070698_100552296 | 3300005471 | Bacteria | 1091 |
| 100 | Ga0068853_100823620 | 3300005539 | Bacteria | 889 |
| 101 | Ga0070672_100295833 | 3300005543 | Bacteria | 1371 |
| 102 | Ga0070693_100830647 | 3300005547 | Bacteria | 687 |
| 103 | Ga0070665_100234720 | 3300005548 | Bacteria | 1834 |
| 104 | Ga0070665_100488021 | 3300005548 | Bacteria | 1243 |
| 105 | Ga0070665_100662473 | 3300005548 | Bacteria | 1057 |
| 106 | Ga0070704_100011744 | 3300005549 | Bacteria | 5383 |
| 107 | Ga0070704_100085589 | 3300005549 | Bacteria | 2333 |
| 108 | Ga0068855_100112017 | 3300005563 | Bacteria | 3131 |
| 109 | Ga0068855_100175809 | 3300005563 | Bacteria | 2423 |
| 110 | Ga0070664_100067201 | 3300005564 | Bacteria | 3064 |
| 111 | Ga0068857_100064951 | 3300005577 | Bacteria | 3245 |
| 112 | Ga0068854_100194092 | 3300005578 | Bacteria | 1592 |
| 113 | Ga0068854_100244746 | 3300005578 | Bacteria | 1430 |
| 114 | Ga0068856_100334978 | 3300005614 | Bacteria | 1531 |
| 115 | Ga0068864_100444163 | 3300005618 | Bacteria | 1239 |
| 116 | Ga0068864_100555712 | 3300005618 | Bacteria | 1110 |
| 117 | Ga0068866_10362257 | 3300005718 | Bacteria | 924 |
| 118 | Ga0068861_100026271 | 3300005719 | Bacteria | 4232 |
| 119 | Ga0068851_10011783 | 3300005834 | Bacteria | 4107 |
| 120 | Ga0068870_10219672 | 3300005840 | Bacteria | 1162 |
| 121 | Ga0068863_100047683 | 3300005841 | Bacteria | 4063 |
| 122 | Ga0068863_100132321 | 3300005841 | Bacteria | 2381 |
| 123 | Ga0068863_100155513 | 3300005841 | Bacteria | 2189 |
| 124 | Ga0068860_100114582 | 3300005843 | Bacteria | 2577 |
| 125 | Ga0068862_100109907 | 3300005844 | Bacteria | 2419 |
| 126 | Ga0068862_100427324 | 3300005844 | Bacteria | 1244 |
| 127 | Ga0075363_100017180 | 3300006048 | Bacteria | 3584 |
| 128 | Ga0075363_100065074 | 3300006048 | Bacteria | 1970 |
| 129 | Ga0075363_100171738 | 3300006048 | Bacteria | 1231 |
| 130 | Ga0075363_100264430 | 3300006048 | Bacteria | 993 |
| 131 | Ga0075363_100280042 | 3300006048 | Bacteria | 965 |
| 132 | Ga0075432_10074273 | 3300006058 | Bacteria | 1225 |
| 133 | Ga0075432_10108319 | 3300006058 | Bacteria | 1033 |
| 134 | Ga0075362_10002978 | 3300006177 | Bacteria | 5825 |
| 135 | Ga0075362_10013006 | 3300006177 | Bacteria | 3320 |
| 136 | Ga0075362_10019237 | 3300006177 | Bacteria | 2837 |
| 137 | Ga0075369_10218994 | 3300006186 | Bacteria | 881 |
| 138 | Ga0075366_10072694 | 3300006195 | Bacteria | 2049 |
| 139 | Ga0075366_10080886 | 3300006195 | Bacteria | 1940 |
| 140 | Ga0075366_10100065 | 3300006195 | Bacteria | 1739 |
| 141 | Ga0075366_10105913 | 3300006195 | Bacteria | 1690 |
| 142 | Ga0075366_10124003 | 3300006195 | Bacteria | 1558 |
| 143 | Ga0075366_10190135 | 3300006195 | Bacteria | 1248 |
| 144 | Ga0097621_100030530 | 3300006237 | Bacteria | 4267 |
| 145 | Ga0097621_100246691 | 3300006237 | Bacteria | 1563 |
| 146 | Ga0097621_100797262 | 3300006237 | Bacteria | 875 |
| 147 | Ga0075370_10001034 | 3300006353 | Bacteria | 11554 |
| 148 | Ga0075370_10003779 | 3300006353 | Bacteria | 7244 |
| 149 | Ga0075370_10023982 | 3300006353 | Bacteria | 3365 |
| 150 | Ga0075370_10065741 | 3300006353 | Bacteria | 2068 |
| 151 | Ga0075370_10071851 | 3300006353 | Bacteria | 1980 |
| 152 | Ga0068871_100033921 | 3300006358 | Bacteria | 4045 |
| 153 | Ga0068871_100615614 | 3300006358 | Bacteria | 989 |
| 154 | Ga0075430_100101548 | 3300006846 | Bacteria | 2401 |
| 155 | Ga0075431_100299414 | 3300006847 | Bacteria | 1625 |
| 156 | Ga0075434_100053749 | 3300006871 | Bacteria | 4002 |
| 157 | Ga0075429_100782157 | 3300006880 | Bacteria | 836 |
| 158 | Ga0075436_100622679 | 3300006914 | Bacteria | 796 |
| 159 | Ga0099826_10114653 | 3300006948 | Bacteria | 1599 |
| 160 | Ga0105244_10036366 | 3300009036 | Bacteria | 2580 |
| 161 | Ga0105244_10166189 | 3300009036 | Bacteria | 1052 |
| 162 | Ga0105245_10033012 | 3300009098 | Bacteria | 4584 |
| 163 | Ga0105243_10001140 | 3300009148 | Bacteria | 24116 |
| 164 | Ga0105243_10014072 | 3300009148 | Bacteria | 6054 |
| 165 | Ga0105243_10030230 | 3300009148 | Bacteria | 4168 |
| 166 | Ga0105241_10031745 | 3300009174 | Bacteria | 3955 |
| 167 | Ga0105242_10283450 | 3300009176 | Bacteria | 1506 |
| 168 | Ga0105242_11564768 | 3300009176 | Bacteria | 692 |
| 169 | Ga0105248_10206365 | 3300009177 | Bacteria | 2214 |
| 170 | Ga0105248_10561826 | 3300009177 | Bacteria | 1287 |
| 171 | Ga0105239_10577955 | 3300010375 | Bacteria | 1281 |
| 172 | Ga0105239_11018428 | 3300010375 | Bacteria | 952 |
| 173 | Ga0105246_10069698 | 3300011119 | Bacteria | 2471 |
| 174 | Ga0157347_1009909 | 3300012502 | Bacteria | 993 |
| 175 | Ga0157373_10095661 | 3300013100 | Bacteria | 2091 |
| 176 | Ga0157370_10002450 | 3300013104 | Bacteria | 22388 |
| 177 | Ga0157370_10240479 | 3300013104 | Bacteria | 1675 |
| 178 | Ga0157374_10180187 | 3300013296 | Bacteria | 2063 |
| 179 | Ga0163162_11125515 | 3300013306 | Bacteria | 890 |
| 180 | Ga0157375_10111027 | 3300013308 | Bacteria | 2840 |
| 181 | Ga0157375_10789500 | 3300013308 | Bacteria | 1099 |
| 182 | Ga0157375_10822204 | 3300013308 | Bacteria | 1077 |
| 183 | Ga0163163_10126096 | 3300014325 | Bacteria | 2598 |
| 184 | Ga0163163_10625101 | 3300014325 | Bacteria | 1140 |
| 185 | Ga0163163_10676364 | 3300014325 | Bacteria | 1096 |
| 186 | Ga0157380_10199150 | 3300014326 | Bacteria | 1775 |
| 187 | Ga0182008_10000225 | 3300014497 | Bacteria | 44301 |
| 188 | Ga0182008_10011230 | 3300014497 | Bacteria | 4772 |
| 189 | Ga0182008_10014507 | 3300014497 | Bacteria | 4125 |
| 190 | Ga0182008_10019854 | 3300014497 | Bacteria | 3464 |
| 191 | Ga0182008_10040078 | 3300014497 | Bacteria | 2340 |
| 192 | Ga0182008_10259584 | 3300014497 | Bacteria | 898 |
| 193 | Ga0157379_10014445 | 3300014968 | Bacteria | 6930 |
| 194 | Ga0157379_10512770 | 3300014968 | Bacteria | 1112 |
| 195 | Ga0157376_10038395 | 3300014969 | Bacteria | 3896 |
| 196 | Ga0157376_10082225 | 3300014969 | Bacteria | 2767 |
| 197 | Ga0157376_10354467 | 3300014969 | Bacteria | 1405 |
| 198 | Ga0157376_10405592 | 3300014969 | Bacteria | 1319 |
| 199 | Ga0157376_10940372 | 3300014969 | Bacteria | 884 |
| 200 | Ga0182006_1010162 | 3300015261 | Bacteria | 4195 |
| 201 | Ga0182006_1041803 | 3300015261 | Bacteria | 1798 |
| 202 | Ga0182007_10003534 | 3300015262 | Bacteria | 7361 |
| 203 | Ga0182007_10020624 | 3300015262 | Bacteria | 2353 |
| 204 | Ga0182005_1016595 | 3300015265 | Bacteria | 2046 |
| 205 | Ga0182005_1039584 | 3300015265 | Bacteria | 1282 |
| 206 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 207 | Ga0163161_10000114 | 3300017792 | Bacteria | 76397 |
| 208 | Ga0163161_10051863 | 3300017792 | Bacteria | 2973 |
| 209 | Ga0163161_10101427 | 3300017792 | Bacteria | 2143 |
| 210 | Ga0163161_10232667 | 3300017792 | Bacteria | 1430 |
| 211 | Ga0163161_10241309 | 3300017792 | Bacteria | 1405 |
| 212 | Ga0163161_10288442 | 3300017792 | Bacteria | 1289 |
| 213 | Ga0163161_10679700 | 3300017792 | Bacteria | 855 |
| 214 | Ga0163161_11266573 | 3300017792 | Bacteria | 640 |
| 215 | Ga0213872_10005990 | 3300021361 | Bacteria | 6162 |
| 216 | Ga0209672_100477 | 3300025228 | Bacteria | 22499 |
| 217 | Ga0209147_101499 | 3300025229 | Bacteria | 8245 |
| 218 | Ga0209258_100568 | 3300025242 | Bacteria | 31666 |
| 219 | Ga0207425_1000069 | 3300025245 | Bacteria | 120895 |
| 220 | Ga0207425_1007005 | 3300025245 | Bacteria | 3028 |
| 221 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 222 | Ga0209129_1000233 | 3300025258 | Bacteria | 61174 |
| 223 | Ga0209129_1001166 | 3300025258 | Bacteria | 15152 |
| 224 | Ga0209129_1006462 | 3300025258 | Bacteria | 3778 |
| 225 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 226 | Ga0209565_1000171 | 3300025263 | Bacteria | 84566 |
| 227 | Ga0209565_1007159 | 3300025263 | Bacteria | 3038 |
| 228 | Ga0209565_1047747 | 3300025263 | Bacteria | 778 |
| 229 | Ga0209455_1000819 | 3300025272 | Bacteria | 16921 |
| 230 | Ga0209673_1000295 | 3300025273 | Bacteria | 92499 |
| 231 | Ga0209673_1000301 | 3300025273 | Bacteria | 91435 |
| 232 | Ga0209673_1004394 | 3300025273 | Bacteria | 7572 |
| 233 | Ga0209673_1009432 | 3300025273 | Bacteria | 4226 |
| 234 | Ga0209673_1020108 | 3300025273 | Bacteria | 2373 |
| 235 | Ga0209673_1020941 | 3300025273 | Bacteria | 2300 |
| 236 | Ga0209130_1000193 | 3300025284 | Bacteria | 84550 |
| 237 | Ga0209130_1000366 | 3300025284 | Bacteria | 51201 |
| 238 | Ga0209130_1001843 | 3300025284 | Bacteria | 12207 |
| 239 | Ga0209130_1025709 | 3300025284 | Bacteria | 1272 |
| 240 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 241 | Ga0209675_1000236 | 3300025291 | Bacteria | 55143 |
| 242 | Ga0209675_1000582 | 3300025291 | Bacteria | 26359 |
| 243 | Ga0209675_1006428 | 3300025291 | Bacteria | 4709 |
| 244 | Ga0209675_1008038 | 3300025291 | Bacteria | 3940 |
| 245 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 246 | Ga0209676_1000098 | 3300025292 | Bacteria | 234305 |
| 247 | Ga0209676_1000123 | 3300025292 | Bacteria | 195351 |
| 248 | Ga0209676_1013512 | 3300025292 | Bacteria | 3136 |
| 249 | Ga0209676_1018047 | 3300025292 | Bacteria | 2473 |
| 250 | Ga0209676_1023673 | 3300025292 | Bacteria | 2005 |
| 251 | Ga0209676_1043481 | 3300025292 | Bacteria | 1239 |
| 252 | Ga0209676_1050949 | 3300025292 | Bacteria | 1088 |
| 253 | Ga0209025_1000204 | 3300025294 | Bacteria | 142193 |
| 254 | Ga0209025_1000264 | 3300025294 | Bacteria | 123411 |
| 255 | Ga0209025_1000348 | 3300025294 | Bacteria | 100228 |
| 256 | Ga0209025_1005823 | 3300025294 | Bacteria | 9873 |
| 257 | Ga0209025_1019355 | 3300025294 | Bacteria | 3789 |
| 258 | Ga0209025_1019870 | 3300025294 | Bacteria | 3710 |
| 259 | Ga0209564_1000231 | 3300025295 | Bacteria | 123417 |
| 260 | Ga0209564_1002077 | 3300025295 | Bacteria | 17219 |
| 261 | Ga0209758_1000222 | 3300025297 | Bacteria | 123411 |
| 262 | Ga0209758_1051551 | 3300025297 | Bacteria | 1431 |
| 263 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 264 | Ga0209050_1001339 | 3300025298 | Bacteria | 27306 |
| 265 | Ga0209050_1033105 | 3300025298 | Bacteria | 1574 |
| 266 | Ga0209050_1035197 | 3300025298 | Bacteria | 1484 |
| 267 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 268 | Ga0209256_1000284 | 3300025299 | Bacteria | 89178 |
| 269 | Ga0209256_1016014 | 3300025299 | Bacteria | 2583 |
| 270 | Ga0207426_1000058 | 3300025302 | Bacteria | 363857 |
| 271 | Ga0207426_1000349 | 3300025302 | Bacteria | 84546 |
| 272 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 273 | Ga0209051_1000091 | 3300025303 | Bacteria | 173683 |
| 274 | Ga0209051_1000098 | 3300025303 | Bacteria | 165284 |
| 275 | Ga0209051_1000099 | 3300025303 | Bacteria | 165161 |
| 276 | Ga0209051_1000342 | 3300025303 | Bacteria | 70022 |
| 277 | Ga0209051_1001310 | 3300025303 | Bacteria | 21859 |
| 278 | Ga0209051_1025182 | 3300025303 | Bacteria | 2428 |
| 279 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 280 | Ga0209257_1000497 | 3300025304 | Bacteria | 70185 |
| 281 | Ga0209257_1000677 | 3300025304 | Bacteria | 53181 |
| 282 | Ga0209257_1003804 | 3300025304 | Bacteria | 12416 |
| 283 | Ga0209257_1004226 | 3300025304 | Bacteria | 11372 |
| 284 | Ga0209257_1052704 | 3300025304 | Bacteria | 1141 |
| 285 | Ga0207656_10015819 | 3300025321 | Bacteria | 2926 |
| 286 | Ga0207655_1000675 | 3300025728 | Bacteria | 39901 |
| 287 | Ga0207682_10002543 | 3300025893 | Bacteria | 8137 |
| 288 | Ga0207682_10146311 | 3300025893 | Bacteria | 1063 |
| 289 | Ga0207688_10016415 | 3300025901 | Bacteria | 4016 |
| 290 | Ga0207680_10126640 | 3300025903 | Bacteria | 1677 |
| 291 | Ga0207645_10002306 | 3300025907 | Bacteria | 15080 |
| 292 | Ga0207645_10135701 | 3300025907 | Bacteria | 1602 |
| 293 | Ga0207643_10002326 | 3300025908 | Bacteria | 10344 |
| 294 | Ga0207662_10009379 | 3300025918 | Bacteria | 5382 |
| 295 | Ga0207652_10416497 | 3300025921 | Bacteria | 1212 |
| 296 | Ga0207681_10083126 | 3300025923 | Bacteria | 2265 |
| 297 | Ga0207681_10312177 | 3300025923 | Bacteria | 1247 |
| 298 | Ga0207681_10475956 | 3300025923 | Bacteria | 1019 |
| 299 | Ga0207650_10018089 | 3300025925 | Bacteria | 4941 |
| 300 | Ga0207650_10691507 | 3300025925 | Bacteria | 861 |
| 301 | Ga0207644_10127309 | 3300025931 | Bacteria | 1945 |
| 302 | Ga0207706_10015483 | 3300025933 | Bacteria | 6890 |
| 303 | Ga0207706_10035041 | 3300025933 | Bacteria | 4465 |
| 304 | Ga0207686_10335459 | 3300025934 | Bacteria | 1134 |
| 305 | Ga0207709_10000331 | 3300025935 | Bacteria | 50983 |
| 306 | Ga0207709_10000464 | 3300025935 | Bacteria | 37316 |
| 307 | Ga0207709_10008913 | 3300025935 | Bacteria | 5539 |
| 308 | Ga0207709_10100531 | 3300025935 | Bacteria | 1911 |
| 309 | Ga0207669_10102702 | 3300025937 | Bacteria | 1894 |
| 310 | Ga0207704_10797581 | 3300025938 | Bacteria | 788 |
| 311 | Ga0207691_10015351 | 3300025940 | Bacteria | 7286 |
| 312 | Ga0207691_10633910 | 3300025940 | Bacteria | 904 |
| 313 | Ga0207711_10129776 | 3300025941 | Bacteria | 2259 |
| 314 | Ga0207711_10285186 | 3300025941 | Bacteria | 1521 |
| 315 | Ga0207689_10007489 | 3300025942 | Bacteria | 9568 |
| 316 | Ga0207689_10100011 | 3300025942 | Bacteria | 2383 |
| 317 | Ga0207689_10588989 | 3300025942 | Bacteria | 935 |
| 318 | Ga0207679_10074547 | 3300025945 | Bacteria | 2572 |
| 319 | Ga0207667_10099672 | 3300025949 | Bacteria | 2997 |
| 320 | Ga0207667_10109713 | 3300025949 | Bacteria | 2846 |
| 321 | Ga0207651_10019609 | 3300025960 | Bacteria | 4058 |
| 322 | Ga0207651_10072831 | 3300025960 | Bacteria | 2441 |
| 323 | Ga0207651_10206224 | 3300025960 | Bacteria | 1579 |
| 324 | Ga0207640_10482424 | 3300025981 | Bacteria | 1029 |
| 325 | Ga0207658_10116126 | 3300025986 | Bacteria | 2125 |
| 326 | Ga0207658_10255627 | 3300025986 | Bacteria | 1490 |
| 327 | Ga0207658_10865360 | 3300025986 | Bacteria | 822 |
| 328 | Ga0207677_10018143 | 3300026023 | Bacteria | 4217 |
| 329 | Ga0207677_10288768 | 3300026023 | Bacteria | 1350 |
| 330 | Ga0207639_10020870 | 3300026041 | Bacteria | 4697 |
| 331 | Ga0207708_10002353 | 3300026075 | Bacteria | 13889 |
| 332 | Ga0207702_10667621 | 3300026078 | Bacteria | 1023 |
| 333 | Ga0207702_10725298 | 3300026078 | Bacteria | 980 |
| 334 | Ga0207641_10129708 | 3300026088 | Bacteria | 2262 |
| 335 | Ga0207641_10434966 | 3300026088 | Bacteria | 1265 |
| 336 | Ga0207648_10003860 | 3300026089 | Bacteria | 15650 |
| 337 | Ga0207676_10681670 | 3300026095 | Bacteria | 994 |
| 338 | Ga0207674_10100238 | 3300026116 | Bacteria | 2878 |
| 339 | Ga0207674_10122845 | 3300026116 | Bacteria | 2562 |
| 340 | Ga0207674_10269315 | 3300026116 | Bacteria | 1651 |
| 341 | Ga0207674_10328358 | 3300026116 | Bacteria | 1479 |
| 342 | Ga0207675_100010756 | 3300026118 | Bacteria | 8574 |
| 343 | Ga0207683_10003766 | 3300026121 | Bacteria | 13151 |
| 344 | Ga0207683_10085145 | 3300026121 | Bacteria | 2810 |
| 345 | Ga0207683_10092950 | 3300026121 | Bacteria | 2688 |
| 346 | Ga0207683_10377433 | 3300026121 | Bacteria | 1303 |
| 347 | Ga0207683_10427315 | 3300026121 | Bacteria | 1220 |
| 348 | Ga0207698_10219338 | 3300026142 | Bacteria | 1717 |
| 349 | Ga0209282_1005738 | 3300027666 | Bacteria | 7658 |
| 350 | Ga0209282_1093813 | 3300027666 | Bacteria | 1565 |
| 351 | Ga0268266_10200059 | 3300028379 | Bacteria | 1828 |
| 352 | Ga0268266_10313833 | 3300028379 | Bacteria | 1465 |
| 353 | Ga0268265_10021322 | 3300028380 | Bacteria | 4537 |
| 354 | Ga0265318_10005954 | 3300028577 | Bacteria | 5667 |
| 355 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 356 | Ga0307515_10099599 | 3300028794 | Bacteria | 3527 |
| 357 | Ga0316177_1099357 | 3300030731 | Bacteria | 1064 |
| 358 | Ga0316176_1067430 | 3300030732 | Bacteria | 2291 |
| 359 | Ga0316183_1086557 | 3300030742 | Bacteria | 14600 |
| 360 | Ga0265330_10019471 | 3300031235 | Bacteria | 3110 |
| 361 | Ga0265330_10025206 | 3300031235 | Bacteria | 2696 |
| 362 | Ga0265332_10000029 | 3300031238 | Bacteria | 180902 |
| 363 | Ga0265332_10000398 | 3300031238 | Bacteria | 31536 |
| 364 | Ga0265328_10000020 | 3300031239 | Bacteria | 125715 |
| 365 | Ga0265328_10011318 | 3300031239 | Bacteria | 3569 |
| 366 | Ga0265328_10040694 | 3300031239 | Bacteria | 1712 |
| 367 | Ga0265320_10033514 | 3300031240 | Bacteria | 2622 |
| 368 | Ga0265320_10141019 | 3300031240 | Bacteria | 1092 |
| 369 | Ga0265329_10004474 | 3300031242 | Bacteria | 5803 |
| 370 | Ga0265329_10034834 | 3300031242 | Unclassified | 1626 |
| 371 | Ga0265340_10217061 | 3300031247 | Bacteria | 857 |
| 372 | Ga0265339_10060614 | 3300031249 | Bacteria | 2039 |
| 373 | Ga0265331_10021074 | 3300031250 | Bacteria | 3338 |
| 374 | Ga0265331_10053388 | 3300031250 | Bacteria | 1928 |
| 375 | Ga0265327_10000746 | 3300031251 | Bacteria | 50605 |
| 376 | Ga0265327_10001767 | 3300031251 | Bacteria | 25537 |
| 377 | Ga0265327_10021084 | 3300031251 | Bacteria | 3944 |
| 378 | Ga0265327_10044923 | 3300031251 | Bacteria | 2351 |
| 379 | Ga0265327_10052990 | 3300031251 | Bacteria | 2108 |
| 380 | Ga0265316_10030433 | 3300031344 | Bacteria | 4425 |
| 381 | Ga0265316_10048756 | 3300031344 | Bacteria | 3341 |
| 382 | Ga0265316_10139021 | 3300031344 | Bacteria | 1826 |
| 383 | Ga0265316_10141935 | 3300031344 | Bacteria | 1803 |
| 384 | Ga0307513_10113647 | 3300031456 | Bacteria | 2695 |
| 385 | Ga0307513_10175863 | 3300031456 | Bacteria | 2011 |
| 386 | Ga0307513_10313467 | 3300031456 | Bacteria | 1330 |
| 387 | Ga0307408_100003650 | 3300031548 | Bacteria | 10489 |
| 388 | Ga0307408_100051116 | 3300031548 | Bacteria | 2975 |
| 389 | Ga0307408_100053852 | 3300031548 | Bacteria | 2907 |
| 390 | Ga0307408_100076112 | 3300031548 | Bacteria | 2495 |
| 391 | Ga0307408_101162263 | 3300031548 | Bacteria | 718 |
| 392 | Ga0265313_10075381 | 3300031595 | Bacteria | 1544 |
| 393 | Ga0307514_10008104 | 3300031649 | Bacteria | 8984 |
| 394 | Ga0265314_10005578 | 3300031711 | Bacteria | 11314 |
| 395 | Ga0265342_10008414 | 3300031712 | Bacteria | 7396 |
| 396 | Ga0307516_10077116 | 3300031730 | Bacteria | 3182 |
| 397 | Ga0307516_10126631 | 3300031730 | Bacteria | 2338 |
| 398 | Ga0307405_10012930 | 3300031731 | Bacteria | 4438 |
| 399 | Ga0307405_10027530 | 3300031731 | Bacteria | 3297 |
| 400 | Ga0307405_10280752 | 3300031731 | Bacteria | 1253 |
| 401 | Ga0307405_10546594 | 3300031731 | Bacteria | 936 |
| 402 | Ga0307405_10641943 | 3300031731 | Bacteria | 872 |
| 403 | Ga0307405_10695234 | 3300031731 | Bacteria | 841 |
| 404 | Ga0307405_11133808 | 3300031731 | Bacteria | 673 |
| 405 | Ga0307413_10055028 | 3300031824 | Bacteria | 2418 |
| 406 | Ga0307413_10434456 | 3300031824 | Bacteria | 1038 |
| 407 | Ga0307406_10000324 | 3300031901 | Bacteria | 27796 |
| 408 | Ga0307406_10059024 | 3300031901 | Bacteria | 2468 |
| 409 | Ga0307406_10235516 | 3300031901 | Bacteria | 1370 |
| 410 | Ga0307406_10260938 | 3300031901 | Bacteria | 1311 |
| 411 | Ga0307406_10316864 | 3300031901 | Bacteria | 1205 |
| 412 | Ga0307406_10750741 | 3300031901 | Bacteria | 819 |
| 413 | Ga0307407_10445024 | 3300031903 | Bacteria | 939 |
| 414 | Ga0307412_10030197 | 3300031911 | Bacteria | 3409 |
| 415 | Ga0307412_10043892 | 3300031911 | Bacteria | 2914 |
| 416 | Ga0307412_10077823 | 3300031911 | Bacteria | 2282 |
| 417 | Ga0307412_10102742 | 3300031911 | Bacteria | 2024 |
| 418 | Ga0307412_10247791 | 3300031911 | Bacteria | 1382 |
| 419 | Ga0307409_101043332 | 3300031995 | Bacteria | 837 |
| 420 | Ga0307416_100010896 | 3300032002 | Bacteria | 6030 |
| 421 | Ga0307414_10078062 | 3300032004 | Bacteria | 2412 |
| 422 | Ga0307414_10610220 | 3300032004 | Bacteria | 979 |
| 423 | Ga0307414_10710933 | 3300032004 | Bacteria | 910 |
| 424 | Ga0307411_10001615 | 3300032005 | Bacteria | 9387 |
| 425 | Ga0307411_10027661 | 3300032005 | Bacteria | 3435 |
| 426 | Ga0307411_10578154 | 3300032005 | Bacteria | 963 |
| 427 | Ga0307415_100393587 | 3300032126 | Bacteria | 1181 |
| 428 | Ga0316583_10017757 | 3300032133 | Bacteria | 2556 |
| 429 | Ga0373932_0127620 | 3300035112 | Bacteria | 854 |
| 430 | Ga0373931_0032340 | 3300035691 | Bacteria | 2707 |
| 431 | Ga0373931_0059932 | 3300035691 | Bacteria | 2048 |
| 432 | Ga0373933_0563865 | 3300035724 | Bacteria | 747 |
| 433 | Ga0373937_0627494 | 3300036401 | Bacteria | 1020 |
| 434 | Ga0373925_0280497 | 3300037068 | Bacteria | 1342 |
| 435 | Ga0395899_0001018 | 3300037312 | Bacteria | 25619 |
| 436 | Ga0395899_0322141 | 3300037312 | Bacteria | 1041 |
| 437 | Ga0395899_0455726 | 3300037312 | Bacteria | 837 |
| 438 | Ga0395900_0040394 | 3300037418 | Bacteria | 4808 |
| 439 | Ga0395900_0216421 | 3300037418 | Bacteria | 1933 |
| 440 | Ga0395898_0008698 | 3300037466 | Bacteria | 10712 |
| 441 | Ga0395898_0107645 | 3300037466 | Bacteria | 2673 |
| 442 | Ga0395898_0199014 | 3300037466 | Bacteria | 1913 |
| 443 | Ga0395905_0002817 | 3300037471 | Bacteria | 19057 |
| 444 | Ga0395905_0004508 | 3300037471 | Bacteria | 14433 |
| 445 | Ga0395905_0008661 | 3300037471 | Bacteria | 10021 |
| 446 | Ga0395905_0052347 | 3300037471 | Bacteria | 3822 |
| 447 | Ga0395905_0065940 | 3300037471 | Bacteria | 3390 |
| 448 | Ga0395905_0089643 | 3300037471 | Bacteria | 2882 |
| 449 | Ga0395905_0206749 | 3300037471 | Bacteria | 1840 |
| 450 | Ga0395905_0228685 | 3300037471 | Bacteria | 1739 |
| 451 | Ga0395905_0795698 | 3300037471 | Bacteria | 848 |
| 452 | Ga0395905_0834446 | 3300037471 | Bacteria | 824 |
| 453 | Ga0395901_0022637 | 3300038443 | Bacteria | 6441 |
| 454 | Ga0395901_0097141 | 3300038443 | Bacteria | 3087 |
| 455 | Ga0395901_0366817 | 3300038443 | Bacteria | 1484 |
| 456 | Ga0400490_08919 | 3300038726 | Bacteria | 7346 |
| 457 | Ga0400483_079146 | 3300039062 | Bacteria | 1018 |
| 458 | Ga0436361_0837231 | 3300039447 | Bacteria | 44100 |
| 459 | Ga0439436_0000586 | 3300041404 | Bacteria | 9641 |
| 460 | Ga0439436_0003260 | 3300041404 | Bacteria | 4920 |
| 461 | Ga0439436_0053662 | 3300041404 | Bacteria | 1135 |
| 462 | Ga0439439_0007617 | 3300041406 | Bacteria | 2537 |
| 463 | Ga0439439_0012633 | 3300041406 | Bacteria | 2044 |
| 464 | Ga0439447_031943 | 3300041407 | Bacteria | 1319 |
| 465 | Ga0439447_074976 | 3300041407 | Bacteria | 784 |
| 466 | Ga0439447_080230 | 3300041407 | Bacteria | 754 |
| 467 | Ga0439461_0001667 | 3300041410 | Bacteria | 3459 |
| 468 | Ga0439466_0016222 | 3300041411 | Bacteria | 2696 |
| 469 | Ga0439466_0093318 | 3300041411 | Bacteria | 942 |
| 470 | Ga0439465_0000571 | 3300041413 | Bacteria | 11082 |
| 471 | Ga0451841_1087416 | 3300041498 | Bacteria | 708 |
| 472 | Ga0439431_0000218 | 3300041997 | Bacteria | 11553 |
| 473 | Ga0439431_0023674 | 3300041997 | Bacteria | 1489 |
| 474 | Ga0439431_0045506 | 3300041997 | Bacteria | 1127 |
| 475 | Ga0439437_023326 | 3300042000 | Bacteria | 756 |
| 476 | Ga0439442_014583 | 3300042002 | Bacteria | 1618 |
| 477 | Ga0439445_0005073 | 3300042004 | Bacteria | 2991 |
| 478 | Ga0439445_0060743 | 3300042004 | Bacteria | 1033 |
| 479 | Ga0439445_0100640 | 3300042004 | Bacteria | 819 |
| 480 | Ga0439432_000464 | 3300042006 | Bacteria | 15181 |
| 481 | Ga0439432_013370 | 3300042006 | Bacteria | 2793 |
| 482 | Ga0439449_0001782 | 3300042007 | Bacteria | 8471 |
| 483 | Ga0439449_0002685 | 3300042007 | Bacteria | 6926 |
| 484 | Ga0439449_0232706 | 3300042007 | Bacteria | 692 |
| 485 | Ga0439452_009991 | 3300042010 | Bacteria | 2776 |
| 486 | Ga0439455_0031067 | 3300042012 | Bacteria | 1328 |
| 487 | Ga0439457_021851 | 3300042014 | Bacteria | 1417 |
| 488 | Ga0439457_039645 | 3300042014 | Bacteria | 1049 |
| 489 | Ga0439457_045282 | 3300042014 | Bacteria | 983 |
| 490 | Ga0439457_067131 | 3300042014 | Bacteria | 815 |
| 491 | Ga0439462_0001912 | 3300042015 | Bacteria | 4743 |
| 492 | Ga0439462_0006154 | 3300042015 | Bacteria | 2976 |
| 493 | Ga0439462_0007329 | 3300042015 | Bacteria | 2759 |
| 494 | Ga0439462_0029151 | 3300042015 | Bacteria | 1460 |
| 495 | Ga0439462_0033550 | 3300042015 | Bacteria | 1361 |
| 496 | Ga0450911_000496 | 3300042115 | Bacteria | 12520 |
| 497 | Ga0450919_008525 | 3300042121 | Bacteria | 1184 |
| 498 | Ga0450894_011246 | 3300042131 | Bacteria | 1165 |
| 499 | Ga0450906_014085 | 3300042145 | Bacteria | 1467 |
| 500 | Ga0450910_001247 | 3300042147 | Bacteria | 3169 |
| 501 | Ga0439446_0088038 | 3300042156 | Bacteria | 969 |
| 502 | Ga0439446_0219893 | 3300042156 | Bacteria | 647 |
| 503 | Ga0450908_004376 | 3300042184 | Bacteria | 2724 |
| 504 | Ga0450909_014761 | 3300042185 | Bacteria | 1150 |
| 505 | Ga0450909_026382 | 3300042185 | Bacteria | 876 |
| 506 | Ga0439434_0000517 | 3300042435 | Bacteria | 10981 |
| 507 | Ga0439434_0009050 | 3300042435 | Bacteria | 2927 |
| 508 | Ga0439460_0030740 | 3300042461 | Bacteria | 1529 |
| 509 | Ga0450918_006667 | 3300042531 | Bacteria | 2054 |
| 510 | Ga0450918_024708 | 3300042531 | Bacteria | 1051 |
| 511 | Ga0451577_0035717 | 3300042876 | Bacteria | 4477 |
| 512 | Ga0451577_0073800 | 3300042876 | Bacteria | 3044 |
| 513 | Ga0451577_0101455 | 3300042876 | Bacteria | 2571 |
| 514 | Ga0466969_0021587 | 3300044656 | Bacteria | 3328 |
| 515 | Ga0466969_0038894 | 3300044656 | Bacteria | 2391 |
| 516 | Ga0453683_0006241 | 3300044673 | Bacteria | 8196 |
| 517 | Ga0466965_0370169 | 3300044683 | Bacteria | 787 |
| 518 | Ga0466966_0138717 | 3300044684 | Bacteria | 1487 |
| 519 | Ga0466961_0099502 | 3300044693 | Bacteria | 1832 |
| 520 | Ga0453684_0449119 | 3300044712 | Bacteria | 1435 |
| 521 | Ga0453684_1575430 | 3300044712 | Bacteria | 675 |
| 522 | Ga0466970_0037823 | 3300044765 | Bacteria | 2559 |
| 523 | Ga0466957_0396785 | 3300044842 | Bacteria | 943 |
| 524 | Ga0466960_0265159 | 3300044901 | Bacteria | 958 |
| 525 | Ga0466960_0539891 | 3300044901 | Bacteria | 687 |
| 526 | Ga0466959_0036604 | 3300045049 | Bacteria | 3626 |
| 527 | Ga0466959_0454665 | 3300045049 | Bacteria | 868 |
| 528 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 529 | Ga0451576_0017383 | 3300045051 | Bacteria | 7907 |
| 530 | Ga0451576_0609279 | 3300045051 | Bacteria | 1148 |
| 531 | Ga0495627_057008 | 3300046453 | Bacteria | 1163 |
| 532 | Ga0495590_0080524 | 3300046457 | Bacteria | 1147 |
| 533 | Ga0495629_0211632 | 3300046459 | Bacteria | 1339 |
| 534 | Ga0495638_0019572 | 3300046460 | Bacteria | 4478 |
| 535 | Ga0495610_0021660 | 3300046512 | Bacteria | 3528 |
| 536 | Ga0495616_0003870 | 3300046513 | Bacteria | 9542 |
| 537 | Ga0495631_0000163 | 3300046518 | Bacteria | 45348 |
| 538 | Ga0495637_0006475 | 3300046520 | Bacteria | 5874 |
| 539 | Ga0495663_0037328 | 3300046525 | Bacteria | 1465 |
| 540 | Ga0495642_0081622 | 3300046528 | Bacteria | 1362 |
| 541 | Ga0495654_0022427 | 3300046530 | Bacteria | 3279 |
| 542 | Ga0495654_0201393 | 3300046530 | Bacteria | 852 |
| 543 | Ga0495622_0262361 | 3300046557 | Bacteria | 758 |
| 544 | Ga0495633_0148210 | 3300046558 | Bacteria | 1084 |
| 545 | Ga0495656_0000163 | 3300046615 | Bacteria | 24459 |
| 546 | Ga0495656_0111103 | 3300046615 | Bacteria | 1282 |
| 547 | Ga0495656_0124913 | 3300046615 | Bacteria | 1219 |
| 548 | Ga0495625_0000045 | 3300046660 | Bacteria | 202475 |
| 549 | Ga0495625_0060501 | 3300046660 | Bacteria | 2683 |
| 550 | Ga0495588_0255079 | 3300046674 | Bacteria | 924 |
| 551 | Ga0495658_0115048 | 3300046683 | Bacteria | 1621 |
| 552 | Ga0495670_0100652 | 3300046691 | Bacteria | 1488 |
| 553 | Ga0495671_0015415 | 3300046692 | Bacteria | 4093 |
| 554 | Ga0495660_0045443 | 3300046810 | Bacteria | 2411 |
| 555 | Ga0495676_0058877 | 3300047321 | Bacteria | 3020 |
| 556 | Ga0495681_0253262 | 3300047470 | Bacteria | 694 |
| 557 | Ga0495593_0002104 | 3300047673 | Bacteria | 11902 |
| 558 | Ga0495614_0088545 | 3300048089 | Bacteria | 1345 |
| 559 | Ga0496100_0099001 | 3300048903 | Bacteria | 2005 |
| 560 | Ga0496101_0003542 | 3300048904 | Bacteria | 9742 |
| 561 | Ga0496101_0059835 | 3300048904 | Bacteria | 2762 |
| 562 | Ga0496102_0008409 | 3300048905 | Bacteria | 8842 |
| 563 | Ga0496102_0266002 | 3300048905 | Bacteria | 1617 |
| 564 | Ga0496104_0116799 | 3300048907 | Bacteria | 2560 |
| 565 | Ga0496105_0050318 | 3300048908 | Bacteria | 3441 |
| 566 | Ga0496108_0221492 | 3300048911 | Bacteria | 1644 |
| 567 | Ga0496110_0013319 | 3300048913 | Bacteria | 6795 |
| 568 | Ga0496111_0400359 | 3300048914 | Bacteria | 1014 |
| 569 | Ga0496114_0371118 | 3300048917 | Bacteria | 1266 |
| 570 | Ga0496116_0064554 | 3300048919 | Bacteria | 2353 |
| 571 | Ga0496116_0158318 | 3300048919 | Bacteria | 1246 |
| 572 | Ga0496117_0028929 | 3300048920 | Bacteria | 4281 |
| 573 | Ga0496117_0059066 | 3300048920 | Bacteria | 2652 |
| 574 | Ga0496117_0112317 | 3300048920 | Bacteria | 1694 |
| 575 | Ga0496118_0032009 | 3300048921 | Bacteria | 4344 |
| 576 | Ga0496118_0282758 | 3300048921 | Bacteria | 922 |
| 577 | Ga0496118_0297641 | 3300048921 | Bacteria | 888 |
| 578 | Ga0496119_0162441 | 3300048922 | Bacteria | 1186 |
| 579 | Ga0496121_0006773 | 3300048924 | Bacteria | 14053 |
| 580 | Ga0496121_0094623 | 3300048924 | Bacteria | 2323 |
| 581 | Ga0496121_0146946 | 3300048924 | Bacteria | 1740 |
| 582 | Ga0496121_0269007 | 3300048924 | Bacteria | 1172 |
| 583 | Ga0496121_0316496 | 3300048924 | Bacteria | 1052 |
| 584 | Ga0496122_0000331 | 3300048925 | Bacteria | 102617 |
| 585 | Ga0496122_0133772 | 3300048925 | Bacteria | 1568 |
| 586 | Ga0496122_0162021 | 3300048925 | Bacteria | 1362 |
| 587 | Ga0496122_0367184 | 3300048925 | Bacteria | 744 |
| 588 | Ga0496122_0367425 | 3300048925 | Bacteria | 744 |
| 589 | Ga0496123_0000124 | 3300048926 | Bacteria | 158327 |
| 590 | Ga0496123_0040092 | 3300048926 | Bacteria | 3268 |
| 591 | Ga0496123_0042013 | 3300048926 | Bacteria | 3162 |
| 592 | Ga0496123_0161843 | 3300048926 | Bacteria | 1192 |
| 593 | Ga0496124_0052777 | 3300048927 | Bacteria | 3452 |
| 594 | Ga0496124_0141472 | 3300048927 | Bacteria | 1898 |
| 595 | Ga0496124_0183400 | 3300048927 | Bacteria | 1608 |
| 596 | Ga0496125_0014888 | 3300048928 | Bacteria | 7553 |
| 597 | Ga0496125_0032434 | 3300048928 | Bacteria | 4640 |
| 598 | Ga0496125_0032803 | 3300048928 | Bacteria | 4607 |
| 599 | Ga0496125_0056027 | 3300048928 | Bacteria | 3205 |
| 600 | Ga0496125_0128324 | 3300048928 | Bacteria | 1791 |
| 601 | Ga0496125_0202642 | 3300048928 | Bacteria | 1297 |
| 602 | Ga0496126_0385908 | 3300048929 | Bacteria | 1139 |
| 603 | Ga0496126_0427765 | 3300048929 | Bacteria | 1069 |
| 604 | Ga0495678_120977 | 3300049459 | Bacteria | 879 |
| 605 | Ga0501032_0279026 | 3300049569 | Bacteria | 1082 |
| 606 | Ga0501033_0179328 | 3300049570 | Bacteria | 1519 |
| 607 | Ga0501033_0222049 | 3300049570 | Bacteria | 1345 |
| 608 | Ga0501034_0028787 | 3300049571 | Bacteria | 5652 |
| 609 | Ga0501034_0957112 | 3300049571 | Bacteria | 742 |
| 610 | Ga0501036_0544306 | 3300049572 | Bacteria | 965 |
| 611 | Ga0501043_0493917 | 3300049579 | Bacteria | 915 |
| 612 | Ga0501047_0050858 | 3300049581 | Bacteria | 4002 |
| 613 | Ga0501047_0072718 | 3300049581 | Bacteria | 3309 |
| 614 | Ga0501047_0360049 | 3300049581 | Bacteria | 1291 |
| 615 | Ga0501072_0702415 | 3300049588 | Bacteria | 795 |
| 616 | Ga0501080_0122319 | 3300049742 | Bacteria | 2411 |
| 617 | Ga0501262_000120 | 3300049759 | Bacteria | 9771 |
| 618 | Ga0501035_0009745 | 3300049822 | Bacteria | 8934 |
| 619 | Ga0501035_0166450 | 3300049822 | Bacteria | 1906 |
| 620 | Ga0501044_0005907 | 3300049823 | Bacteria | 13556 |
| 621 | Ga0501044_0504748 | 3300049823 | Bacteria | 1110 |
| 622 | nmdc:mga03683_3109_c1 | 3300050489 | Bacteria | 5281 |
| 623 | nmdc:mga03n38_221925_c1 | 3300050490 | Bacteria | 987 |
| 624 | nmdc:mga03n38_97708_c1 | 3300050490 | Bacteria | 1411 |
| 625 | nmdc:mga00v17_193484_c1 | 3300050491 | Bacteria | 1314 |
| 626 | nmdc:mga0yw44_22552_c1 | 3300050492 | Bacteria | 3532 |
| 627 | nmdc:mga0yw44_284841_c1 | 3300050492 | Bacteria | 1105 |
| 628 | nmdc:mga0k408_290334_c1 | 3300050493 | Bacteria | 976 |
| 629 | nmdc:mga0k408_78444_c1 | 3300050493 | Bacteria | 1932 |
| 630 | nmdc:mga0k408_79978_c1 | 3300050493 | Bacteria | 1913 |
| 631 | nmdc:mga06z11_193123_c1 | 3300050494 | Bacteria | 1179 |
| 632 | nmdc:mga06z11_301054_c1 | 3300050494 | Bacteria | 953 |
| 633 | nmdc:mga06z11_459275_c1 | 3300050494 | Bacteria | 770 |
| 634 | nmdc:mga07m45_17711_c1 | 3300050496 | Bacteria | 3832 |
| 635 | nmdc:mga07m45_29343_c2 | 3300050496 | Bacteria | 2027 |
| 636 | nmdc:mga07m45_297175_c1 | 3300050496 | Bacteria | 939 |
| 637 | nmdc:mga07m45_5781_c1 | 3300050496 | Bacteria | 6196 |
| 638 | nmdc:mga07m45_605_c1 | 3300050496 | Bacteria | 15256 |
| 639 | nmdc:mga07m45_62136_c1 | 3300050496 | Bacteria | 2116 |
| 640 | nmdc:mga07m45_8102_c1 | 3300050496 | Bacteria | 5387 |
| 641 | nmdc:mga09592_673856_c1 | 3300050508 | Bacteria | 882 |
| 642 | nmdc:mga0qj67_671149_c1 | 3300050509 | Bacteria | 826 |
| 643 | nmdc:mga0n895_950962_c1 | 3300050512 | Bacteria | 842 |
| 644 | nmdc:mga08x19_556076_c1 | 3300050514 | Bacteria | 812 |
| 645 | Ga0500610_0000014 | 3300053079 | Bacteria | 84868 |
| 646 | Ga0500610_0000021 | 3300053079 | Bacteria | 66361 |
| 647 | Ga0500643_025509 | 3300053087 | Bacteria | 1862 |
| 648 | Ga0500651_0000560 | 3300053093 | Bacteria | 18911 |
| 649 | Ga0500566_0176662 | 3300053094 | Bacteria | 1099 |
| 650 | Ga0500571_026455 | 3300053110 | Bacteria | 3212 |
| 651 | Ga0500572_061989 | 3300053111 | Bacteria | 1139 |
| 652 | Ga0500593_000644 | 3300053117 | Bacteria | 13420 |
| 653 | Ga0500594_0000473 | 3300053118 | Bacteria | 8831 |
| 654 | Ga0500607_000674 | 3300053121 | Bacteria | 32958 |
| 655 | Ga0500607_125994 | 3300053121 | Bacteria | 1230 |
| 656 | Ga0500608_116280 | 3300053122 | Bacteria | 1219 |
| 657 | Ga0500626_036089 | 3300053128 | Bacteria | 2235 |
| 658 | Ga0500658_0000034 | 3300053134 | Bacteria | 87668 |
| 659 | Ga0500658_0001015 | 3300053134 | Bacteria | 11448 |
| 660 | Ga0500559_0000367 | 3300053136 | Bacteria | 33241 |
| 661 | Ga0500564_151480 | 3300053138 | Bacteria | 988 |
| 662 | Ga0500568_0000490 | 3300053139 | Bacteria | 29149 |
| 663 | Ga0500604_0148557 | 3300053151 | Bacteria | 795 |
| 664 | Ga0500616_0119166 | 3300053153 | Bacteria | 1263 |
| 665 | Ga0500627_0001528 | 3300053158 | Bacteria | 6510 |
| 666 | Ga0500627_0175674 | 3300053158 | Bacteria | 964 |
| 667 | Ga0500634_0006252 | 3300053161 | Bacteria | 5745 |
| 668 | Ga0500634_0122059 | 3300053161 | Bacteria | 1266 |
| 669 | Ga0500638_132157 | 3300053162 | Bacteria | 1130 |
| 670 | Ga0500636_0046985 | 3300053177 | Bacteria | 2544 |
| 671 | Ga0500567_099967 | 3300053723 | Bacteria | 1207 |
| 672 | Ga0500565_002430 | 3300053734 | Bacteria | 1391 |
| 673 | Ga0590075_007587 | 3300059424 | Bacteria | 2582 |
| 674 | Ga0466962_0250788 | 3300061719 | Bacteria | 870 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048925 | Ga0496122_0367425 | Ga0496122_0367425_95_613 | 172 |
| 2 | 3300035691 | Ga0373931_0059932 | Ga0373931_0059932_584_1114 | 174 |
| 3 | 3300039062 | Ga0400483_079146 | Ga0400483_079146_393_986 | 179 |
| 4 | 3300044901 | Ga0466960_0539891 | Ga0466960_0539891_11_556 | 181 |
| 5 | 3300049588 | Ga0501072_0702415 | Ga0501072_0702415_21_614 | 181 |
| 6 | 3300050509 | nmdc:mga0qj67_671149_c1 | nmdc:mga0qj67_671149_c1_269_814 | 181 |
| 7 | 3300038726 | Ga0400490_08919 | Ga0400490_08919_345_941 | 185 |
| 8 | 3300049571 | Ga0501034_0957112 | Ga0501034_0957112_164_727 | 187 |
| 9 | 3300005467 | Ga0070706_100059087 | Ga0070706_1000590872 | 189 |
| 10 | 3300005471 | Ga0070698_100552296 | Ga0070698_1005522962 | 189 |
| 11 | 3300005549 | Ga0070704_100011744 | Ga0070704_1000117445 | 189 |
| 12 | 3300006871 | Ga0075434_100053749 | Ga0075434_1000537496 | 189 |
| 13 | 3300006914 | Ga0075436_100622679 | Ga0075436_1006226791 | 189 |
| 14 | 3300050512 | nmdc:mga0n895_950962_c1 | nmdc:mga0n895_950962_c1_70_708 | 189 |
| 15 | 3300050514 | nmdc:mga08x19_556076_c1 | nmdc:mga08x19_556076_c1_29_667 | 189 |
| 16 | iso_pu_bacteria | 2526164512 | 2526211396 | 189 |
| 17 | 3300031595 | Ga0265313_10075381 | Ga0265313_100753812 | 191 |
| 18 | 3300042876 | Ga0451577_0073800 | Ga0451577_0073800_1911_2495 | 191 |
| 19 | 3300044712 | Ga0453684_1575430 | Ga0453684_1575430_67_651 | 191 |
| 20 | 3300031239 | Ga0265328_10040694 | Ga0265328_100406942 | 192 |
| 21 | 3300031240 | Ga0265320_10141019 | Ga0265320_101410192 | 192 |
| 22 | 3300031250 | Ga0265331_10021074 | Ga0265331_100210743 | 192 |
| 23 | 3300031251 | Ga0265327_10001767 | Ga0265327_1000176724 | 192 |
| 24 | 3300031251 | Ga0265327_10021084 | Ga0265327_100210843 | 192 |
| 25 | 3300031251 | Ga0265327_10052990 | Ga0265327_100529902 | 192 |
| 26 | 3300031344 | Ga0265316_10030433 | Ga0265316_100304335 | 192 |
| 27 | 3300031344 | Ga0265316_10141935 | Ga0265316_101419352 | 192 |
| 28 | 3300031730 | Ga0307516_10126631 | Ga0307516_101266314 | 192 |
| 29 | 3300035112 | Ga0373932_0127620 | Ga0373932_0127620_68_655 | 192 |
| 30 | 3300035724 | Ga0373933_0563865 | Ga0373933_0563865_127_735 | 192 |
| 31 | 3300042876 | Ga0451577_0035717 | Ga0451577_0035717_3775_4368 | 192 |
| 32 | 3300044712 | Ga0453684_0449119 | Ga0453684_0449119_160_747 | 192 |
| 33 | 3300026116 | Ga0207674_10100238 | Ga0207674_101002381 | 193 |
| 34 | 3300031238 | Ga0265332_10000029 | Ga0265332_1000002969 | 193 |
| 35 | 3300031344 | Ga0265316_10048756 | Ga0265316_100487564 | 193 |
| 36 | 3300032133 | Ga0316583_10017757 | Ga0316583_100177573 | 193 |
| 37 | 3300045051 | Ga0451576_0000006 | Ga0451576_0000006_125702_126295 | 193 |
| 38 | 3300045051 | Ga0451576_0609279 | Ga0451576_0609279_16_606 | 193 |
| 39 | 3300003763 | Ga0055529_1001011 | Ga0055529_10010119 | 195 |
| 40 | 3300005328 | Ga0070676_10304541 | Ga0070676_103045411 | 195 |
| 41 | 3300005331 | Ga0070670_100194010 | Ga0070670_1001940102 | 195 |
| 42 | 3300005331 | Ga0070670_100570772 | Ga0070670_1005707722 | 195 |
| 43 | 3300005345 | Ga0070692_10292517 | Ga0070692_102925172 | 195 |
| 44 | 3300005347 | Ga0070668_100130668 | Ga0070668_1001306682 | 195 |
| 45 | 3300005353 | Ga0070669_100131849 | Ga0070669_1001318492 | 195 |
| 46 | 3300005353 | Ga0070669_100262967 | Ga0070669_1002629672 | 195 |
| 47 | 3300005354 | Ga0070675_100041967 | Ga0070675_1000419675 | 195 |
| 48 | 3300005355 | Ga0070671_100129474 | Ga0070671_1001294742 | 195 |
| 49 | 3300005356 | Ga0070674_100318253 | Ga0070674_1003182532 | 195 |
| 50 | 3300005364 | Ga0070673_100365501 | Ga0070673_1003655012 | 195 |
| 51 | 3300005438 | Ga0070701_10007392 | Ga0070701_100073926 | 195 |
| 52 | 3300005441 | Ga0070700_100612691 | Ga0070700_1006126911 | 195 |
| 53 | 3300005456 | Ga0070678_100028025 | Ga0070678_1000280252 | 195 |
| 54 | 3300005459 | Ga0068867_100168784 | Ga0068867_1001687841 | 195 |
| 55 | 3300005459 | Ga0068867_100423233 | Ga0068867_1004232332 | 195 |
| 56 | 3300005466 | Ga0070685_10113354 | Ga0070685_101133542 | 195 |
| 57 | 3300005543 | Ga0070672_100295833 | Ga0070672_1002958332 | 195 |
| 58 | 3300005549 | Ga0070704_100085589 | Ga0070704_1000855893 | 195 |
| 59 | 3300005578 | Ga0068854_100244746 | Ga0068854_1002447462 | 195 |
| 60 | 3300005618 | Ga0068864_100444163 | Ga0068864_1004441632 | 195 |
| 61 | 3300005718 | Ga0068866_10362257 | Ga0068866_103622572 | 195 |
| 62 | 3300005719 | Ga0068861_100026271 | Ga0068861_1000262716 | 195 |
| 63 | 3300005840 | Ga0068870_10219672 | Ga0068870_102196722 | 195 |
| 64 | 3300005841 | Ga0068863_100047683 | Ga0068863_1000476835 | 195 |
| 65 | 3300005841 | Ga0068863_100132321 | Ga0068863_1001323212 | 195 |
| 66 | 3300005843 | Ga0068860_100114582 | Ga0068860_1001145822 | 195 |
| 67 | 3300005844 | Ga0068862_100427324 | Ga0068862_1004273242 | 195 |
| 68 | 3300006237 | Ga0097621_100030530 | Ga0097621_1000305304 | 195 |
| 69 | 3300006358 | Ga0068871_100033921 | Ga0068871_1000339214 | 195 |
| 70 | 3300009098 | Ga0105245_10033012 | Ga0105245_100330126 | 195 |
| 71 | 3300009148 | Ga0105243_10030230 | Ga0105243_100302305 | 195 |
| 72 | 3300009176 | Ga0105242_10283450 | Ga0105242_102834502 | 195 |
| 73 | 3300009177 | Ga0105248_10561826 | Ga0105248_105618261 | 195 |
| 74 | 3300011119 | Ga0105246_10069698 | Ga0105246_100696983 | 195 |
| 75 | 3300013296 | Ga0157374_10180187 | Ga0157374_101801872 | 195 |
| 76 | 3300013308 | Ga0157375_10111027 | Ga0157375_101110274 | 195 |
| 77 | 3300013308 | Ga0157375_10789500 | Ga0157375_107895001 | 195 |
| 78 | 3300014325 | Ga0163163_10126096 | Ga0163163_101260962 | 195 |
| 79 | 3300014325 | Ga0163163_10676364 | Ga0163163_106763641 | 195 |
| 80 | 3300014326 | Ga0157380_10199150 | Ga0157380_101991502 | 195 |
| 81 | 3300014968 | Ga0157379_10014445 | Ga0157379_100144452 | 195 |
| 82 | 3300014969 | Ga0157376_10082225 | Ga0157376_100822253 | 195 |
| 83 | 3300014969 | Ga0157376_10354467 | Ga0157376_103544672 | 195 |
| 84 | 3300017792 | Ga0163161_10288442 | Ga0163161_102884422 | 195 |
| 85 | 3300025272 | Ga0209455_1000819 | Ga0209455_100081911 | 195 |
| 86 | 3300025893 | Ga0207682_10002543 | Ga0207682_100025434 | 195 |
| 87 | 3300025901 | Ga0207688_10016415 | Ga0207688_100164156 | 195 |
| 88 | 3300025903 | Ga0207680_10126640 | Ga0207680_101266402 | 195 |
| 89 | 3300025907 | Ga0207645_10002306 | Ga0207645_100023069 | 195 |
| 90 | 3300025908 | Ga0207643_10002326 | Ga0207643_100023268 | 195 |
| 91 | 3300025918 | Ga0207662_10009379 | Ga0207662_100093797 | 195 |
| 92 | 3300025923 | Ga0207681_10312177 | Ga0207681_103121772 | 195 |
| 93 | 3300025925 | Ga0207650_10018089 | Ga0207650_100180891 | 195 |
| 94 | 3300025925 | Ga0207650_10691507 | Ga0207650_106915072 | 195 |
| 95 | 3300025931 | Ga0207644_10127309 | Ga0207644_101273092 | 195 |
| 96 | 3300025933 | Ga0207706_10015483 | Ga0207706_100154836 | 195 |
| 97 | 3300025934 | Ga0207686_10335459 | Ga0207686_103354592 | 195 |
| 98 | 3300025935 | Ga0207709_10100531 | Ga0207709_101005312 | 195 |
| 99 | 3300025937 | Ga0207669_10102702 | Ga0207669_101027022 | 195 |
| 100 | 3300025940 | Ga0207691_10015351 | Ga0207691_100153512 | 195 |
| 101 | 3300025941 | Ga0207711_10285186 | Ga0207711_102851862 | 195 |
| 102 | 3300025942 | Ga0207689_10007489 | Ga0207689_1000748911 | 195 |
| 103 | 3300025960 | Ga0207651_10019609 | Ga0207651_100196096 | 195 |
| 104 | 3300025986 | Ga0207658_10116126 | Ga0207658_101161262 | 195 |
| 105 | 3300026075 | Ga0207708_10002353 | Ga0207708_100023532 | 195 |
| 106 | 3300026088 | Ga0207641_10434966 | Ga0207641_104349662 | 195 |
| 107 | 3300026089 | Ga0207648_10003860 | Ga0207648_1000386017 | 195 |
| 108 | 3300026118 | Ga0207675_100010756 | Ga0207675_1000107566 | 195 |
| 109 | 3300026121 | Ga0207683_10003766 | Ga0207683_1000376611 | 195 |
| 110 | 3300026142 | Ga0207698_10219338 | Ga0207698_102193381 | 195 |
| 111 | 3300028577 | Ga0265318_10005954 | Ga0265318_100059543 | 195 |
| 112 | 3300031235 | Ga0265330_10025206 | Ga0265330_100252062 | 195 |
| 113 | 3300031238 | Ga0265332_10000398 | Ga0265332_100003983 | 195 |
| 114 | 3300031239 | Ga0265328_10000020 | Ga0265328_10000020103 | 195 |
| 115 | 3300031239 | Ga0265328_10011318 | Ga0265328_100113182 | 195 |
| 116 | 3300031240 | Ga0265320_10033514 | Ga0265320_100335143 | 195 |
| 117 | 3300031242 | Ga0265329_10004474 | Ga0265329_100044745 | 195 |
| 118 | 3300031242 | Ga0265329_10034834 | Ga0265329_100348343 | 195 |
| 119 | 3300031249 | Ga0265339_10060614 | Ga0265339_100606142 | 195 |
| 120 | 3300031250 | Ga0265331_10053388 | Ga0265331_100533882 | 195 |
| 121 | 3300031344 | Ga0265316_10139021 | Ga0265316_101390213 | 195 |
| 122 | 3300031711 | Ga0265314_10005578 | Ga0265314_100055783 | 195 |
| 123 | 3300031712 | Ga0265342_10008414 | Ga0265342_100084142 | 195 |
| 124 | 3300037068 | Ga0373925_0280497 | Ga0373925_0280497_144_773 | 195 |
| 125 | 3300048911 | Ga0496108_0221492 | Ga0496108_0221492_520_1167 | 195 |
| 126 | 3300049570 | Ga0501033_0179328 | Ga0501033_0179328_294_914 | 195 |
| 127 | 3300049822 | Ga0501035_0009745 | Ga0501035_0009745_4834_5454 | 195 |
| 128 | 3300049823 | Ga0501044_0005907 | Ga0501044_0005907_7677_8297 | 195 |
| 129 | iso_pu_bacteria | 2513020051 | 2513230376 | 195 |
| 130 | iso_pu_bacteria | 2599185214 | 2599627959 | 195 |
| 131 | iso_pu_bacteria | 2599185226 | 2599677770 | 195 |
| 132 | iso_pu_bacteria | 2599185227 | 2599685589 | 195 |
| 133 | iso_pu_bacteria | 2599185229 | 2599697491 | 195 |
| 134 | iso_pu_bacteria | 2643221628 | 2644161788 | 195 |
| 135 | iso_pu_bacteria | 2643221658 | 2644325808 | 195 |
| 136 | iso_pu_bacteria | 2643221672 | 2644399649 | 195 |
| 137 | iso_pu_bacteria | 2643221683 | 2644465161 | 195 |
| 138 | iso_pu_bacteria | 2738541277 | 2738724022 | 195 |
| 139 | iso_pu_bacteria | 2738541307 | 2738880576 | 195 |
| 140 | iso_pu_bacteria | 2738543013 | 2739247912 | 195 |
| 141 | iso_pu_bacteria | 2738543019 | 2739284707 | 195 |
| 142 | iso_pu_bacteria | 2818991446 | 2819600673 | 195 |
| 143 | iso_pu_bacteria | 2831265667 | 2831268084 | 195 |
| 144 | iso_pu_bacteria | 2838054893 | 2838061719 | 195 |
| 145 | iso_pu_bacteria | 2842677519 | 2842679760 | 195 |
| 146 | iso_pu_bacteria | 2842733646 | 2842734097 | 195 |
| 147 | iso_pu_bacteria | 2842747753 | 2842752527 | 195 |
| 148 | iso_pu_bacteria | 2885192300 | 2885193061 | 195 |
| 149 | iso_pu_bacteria | 2885198086 | 2885203153 | 195 |
| 150 | iso_pu_bacteria | 2885211737 | 2885216450 | 195 |
| 151 | iso_pu_bacteria | 2899924645 | 2899928073 | 195 |
| 152 | iso_pu_bacteria | 2904541872 | 2904545224 | 195 |
| 153 | iso_pu_bacteria | 2919462493 | 2919463860 | 195 |
| 154 | iso_pu_bacteria | 2919704043 | 2919704165 | 195 |
| 155 | iso_pu_bacteria | 2928037797 | 2928041077 | 195 |
| 156 | iso_pu_bacteria | 2928044640 | 2928047919 | 195 |
| 157 | iso_pu_bacteria | 2928051484 | 2928055814 | 195 |
| 158 | iso_pu_bacteria | 2928064002 | 2928066712 | 195 |
| 159 | iso_pu_bacteria | 2928070936 | 2928075218 | 195 |
| 160 | iso_pu_bacteria | 2928084124 | 2928088611 | 195 |
| 161 | iso_pu_bacteria | 2928115317 | 2928115563 | 195 |
| 162 | iso_pu_bacteria | 2929160207 | 2929165416 | 195 |
| 163 | iso_pu_bacteria | 2929520902 | 2929522856 | 195 |
| 164 | iso_pu_bacteria | 2939631187 | 2939636115 | 195 |
| 165 | iso_pu_bacteria | 2945909444 | 2945909940 | 195 |
| 166 | iso_pu_bacteria | 2945945610 | 2945945983 | 195 |
| 167 | iso_pu_bacteria | 2945984333 | 2945988099 | 195 |
| 168 | iso_pu_bacteria | 2881101125 | 2881102712 | 197 |
| 169 | iso_pu_bacteria | 2904449895 | 2904452511 | 197 |
| 170 | iso_pu_bacteria | 2904456579 | 2904460890 | 197 |
| 171 | iso_pu_bacteria | 2904479285 | 2904480013 | 197 |
| 172 | iso_pu_bacteria | 2945972063 | 2945975601 | 197 |
| 173 | iso_pu_bacteria | 2954767861 | 2954768954 | 197 |
| 174 | 3300005353 | Ga0070669_100361837 | Ga0070669_1003618372 | 198 |
| 175 | 3300005456 | Ga0070678_100049560 | Ga0070678_1000495602 | 198 |
| 176 | 3300025921 | Ga0207652_10416497 | Ga0207652_104164972 | 198 |
| 177 | 3300025923 | Ga0207681_10475956 | Ga0207681_104759562 | 198 |
| 178 | 3300025960 | Ga0207651_10072831 | Ga0207651_100728312 | 198 |
| 179 | 3300026121 | Ga0207683_10085145 | Ga0207683_100851452 | 198 |
| 180 | 3300028379 | Ga0268266_10313833 | Ga0268266_103138332 | 198 |
| 181 | 3300001979 | JGI24740J21852_10014457 | JGI24740J21852_100144574 | 199 |
| 182 | 3300002773 | JGI25152J39213_1001872 | JGI25152J39213_10018724 | 199 |
| 183 | 3300002773 | JGI25152J39213_1013199 | JGI25152J39213_10131992 | 199 |
| 184 | 3300002774 | JGI25150J39212_1000863 | JGI25150J39212_10008632 | 199 |
| 185 | 3300002774 | JGI25150J39212_1005077 | JGI25150J39212_10050774 | 199 |
| 186 | 3300002987 | JGI25159J45721_1001848 | JGI25159J45721_10018489 | 199 |
| 187 | 3300002987 | JGI25159J45721_1011405 | JGI25159J45721_10114052 | 199 |
| 188 | 3300003187 | JGI25151J46595_10000224 | JGI25151J46595_100002242 | 199 |
| 189 | 3300003187 | JGI25151J46595_10003612 | JGI25151J46595_100036124 | 199 |
| 190 | 3300003187 | JGI25151J46595_10055825 | JGI25151J46595_100558252 | 199 |
| 191 | 3300003215 | JGI25153J46596_10000570 | JGI25153J46596_100005704 | 199 |
| 192 | 3300003215 | JGI25153J46596_10045861 | JGI25153J46596_100458612 | 199 |
| 193 | 3300003354 | JGI25160J50197_1002537 | JGI25160J50197_10025379 | 199 |
| 194 | 3300003354 | JGI25160J50197_1010940 | JGI25160J50197_10109402 | 199 |
| 195 | 3300003374 | JGI25161J50226_1004265 | JGI25161J50226_10042652 | 199 |
| 196 | 3300003374 | JGI25161J50226_1004510 | JGI25161J50226_10045102 | 199 |
| 197 | 3300003578 | Ga0006562J51391_1130119 | Ga0006562J51391_11301191 | 199 |
| 198 | 3300003578 | Ga0006562J51391_1130120 | Ga0006562J51391_11301201 | 199 |
| 199 | 3300003578 | Ga0006562J51391_1140775 | Ga0006562J51391_11407754 | 199 |
| 200 | 3300003578 | Ga0006562J51391_1140777 | Ga0006562J51391_11407773 | 199 |
| 201 | 3300003758 | Ga0055532_1009987 | Ga0055532_10099871 | 199 |
| 202 | 3300003761 | Ga0055535_1000750 | Ga0055535_100075011 | 199 |
| 203 | 3300003762 | Ga0055542_1000583 | Ga0055542_100058311 | 199 |
| 204 | 3300003771 | Ga0055526_1003328 | Ga0055526_100332812 | 199 |
| 205 | 3300003771 | Ga0055526_1006106 | Ga0055526_10061069 | 199 |
| 206 | 3300003773 | Ga0055537_1000049 | Ga0055537_100004917 | 199 |
| 207 | 3300003773 | Ga0055537_1002248 | Ga0055537_10022489 | 199 |
| 208 | 3300003773 | Ga0055537_1014400 | Ga0055537_10144002 | 199 |
| 209 | 3300003775 | Ga0055524_1002965 | Ga0055524_10029659 | 199 |
| 210 | 3300003775 | Ga0055524_1003751 | Ga0055524_10037514 | 199 |
| 211 | 3300003781 | Ga0055536_1002470 | Ga0055536_10024703 | 199 |
| 212 | 3300003781 | Ga0055536_1008143 | Ga0055536_10081433 | 199 |
| 213 | 3300003781 | Ga0055536_1008959 | Ga0055536_10089594 | 199 |
| 214 | 3300003781 | Ga0055536_1057229 | Ga0055536_10572291 | 199 |
| 215 | 3300003784 | Ga0055534_1000049 | Ga0055534_100004982 | 199 |
| 216 | 3300003784 | Ga0055534_1000343 | Ga0055534_10003436 | 199 |
| 217 | 3300003784 | Ga0055534_1002329 | Ga0055534_10023299 | 199 |
| 218 | 3300003784 | Ga0055534_1003905 | Ga0055534_10039052 | 199 |
| 219 | 3300003790 | Ga0055528_1001187 | Ga0055528_100118716 | 199 |
| 220 | 3300003790 | Ga0055528_1004551 | Ga0055528_10045519 | 199 |
| 221 | 3300003790 | Ga0055528_1030326 | Ga0055528_10303262 | 199 |
| 222 | 3300003791 | Ga0055530_10000318 | Ga0055530_1000031843 | 199 |
| 223 | 3300003791 | Ga0055530_10027635 | Ga0055530_100276352 | 199 |
| 224 | 3300003791 | Ga0055530_10031974 | Ga0055530_100319742 | 199 |
| 225 | 3300003792 | Ga0055540_1001928 | Ga0055540_100192812 | 199 |
| 226 | 3300003792 | Ga0055540_1003384 | Ga0055540_10033843 | 199 |
| 227 | 3300003792 | Ga0055540_1004195 | Ga0055540_10041953 | 199 |
| 228 | 3300003792 | Ga0055540_1006573 | Ga0055540_10065735 | 199 |
| 229 | 3300003792 | Ga0055540_1007675 | Ga0055540_10076752 | 199 |
| 230 | 3300003792 | Ga0055540_1025065 | Ga0055540_10250652 | 199 |
| 231 | 3300003792 | Ga0055540_1037495 | Ga0055540_10374952 | 199 |
| 232 | 3300003794 | Ga0055531_10000738 | Ga0055531_1000073814 | 199 |
| 233 | 3300003794 | Ga0055531_10002357 | Ga0055531_100023574 | 199 |
| 234 | 3300003794 | Ga0055531_10007991 | Ga0055531_100079914 | 199 |
| 235 | 3300003794 | Ga0055531_10021737 | Ga0055531_100217372 | 199 |
| 236 | 3300004625 | Ga0055543_1001645 | Ga0055543_10016459 | 199 |
| 237 | 3300004625 | Ga0055543_1002190 | Ga0055543_10021901 | 199 |
| 238 | 3300005262 | Ga0065165_1003399 | Ga0065165_10033994 | 199 |
| 239 | 3300005288 | Ga0065714_10003219 | Ga0065714_1000321912 | 199 |
| 240 | 3300005289 | Ga0065704_10275364 | Ga0065704_102753641 | 199 |
| 241 | 3300005327 | Ga0070658_10220642 | Ga0070658_102206422 | 199 |
| 242 | 3300005331 | Ga0070670_100465219 | Ga0070670_1004652191 | 199 |
| 243 | 3300005334 | Ga0068869_100821021 | Ga0068869_1008210212 | 199 |
| 244 | 3300005338 | Ga0068868_100014255 | Ga0068868_1000142553 | 199 |
| 245 | 3300005338 | Ga0068868_100164794 | Ga0068868_1001647942 | 199 |
| 246 | 3300005344 | Ga0070661_100068133 | Ga0070661_1000681333 | 199 |
| 247 | 3300005347 | Ga0070668_100111555 | Ga0070668_1001115552 | 199 |
| 248 | 3300005353 | Ga0070669_100043608 | Ga0070669_1000436082 | 199 |
| 249 | 3300005356 | Ga0070674_100612924 | Ga0070674_1006129242 | 199 |
| 250 | 3300005367 | Ga0070667_100290148 | Ga0070667_1002901482 | 199 |
| 251 | 3300005455 | Ga0070663_100197648 | Ga0070663_1001976482 | 199 |
| 252 | 3300005456 | Ga0070678_100052297 | Ga0070678_1000522974 | 199 |
| 253 | 3300005456 | Ga0070678_100454674 | Ga0070678_1004546742 | 199 |
| 254 | 3300005456 | Ga0070678_100506453 | Ga0070678_1005064532 | 199 |
| 255 | 3300005457 | Ga0070662_100026306 | Ga0070662_1000263064 | 199 |
| 256 | 3300005459 | Ga0068867_100259949 | Ga0068867_1002599492 | 199 |
| 257 | 3300005459 | Ga0068867_100687106 | Ga0068867_1006871062 | 199 |
| 258 | 3300005539 | Ga0068853_100823620 | Ga0068853_1008236201 | 199 |
| 259 | 3300005547 | Ga0070693_100830647 | Ga0070693_1008306471 | 199 |
| 260 | 3300005548 | Ga0070665_100234720 | Ga0070665_1002347202 | 199 |
| 261 | 3300005548 | Ga0070665_100488021 | Ga0070665_1004880212 | 199 |
| 262 | 3300005548 | Ga0070665_100662473 | Ga0070665_1006624732 | 199 |
| 263 | 3300005563 | Ga0068855_100112017 | Ga0068855_1001120172 | 199 |
| 264 | 3300005563 | Ga0068855_100175809 | Ga0068855_1001758092 | 199 |
| 265 | 3300005564 | Ga0070664_100067201 | Ga0070664_1000672012 | 199 |
| 266 | 3300005577 | Ga0068857_100064951 | Ga0068857_1000649512 | 199 |
| 267 | 3300005578 | Ga0068854_100194092 | Ga0068854_1001940923 | 199 |
| 268 | 3300005614 | Ga0068856_100334978 | Ga0068856_1003349782 | 199 |
| 269 | 3300005618 | Ga0068864_100555712 | Ga0068864_1005557122 | 199 |
| 270 | 3300005834 | Ga0068851_10011783 | Ga0068851_100117834 | 199 |
| 271 | 3300005841 | Ga0068863_100155513 | Ga0068863_1001555133 | 199 |
| 272 | 3300005844 | Ga0068862_100109907 | Ga0068862_1001099073 | 199 |
| 273 | 3300006048 | Ga0075363_100017180 | Ga0075363_1000171803 | 199 |
| 274 | 3300006048 | Ga0075363_100065074 | Ga0075363_1000650742 | 199 |
| 275 | 3300006048 | Ga0075363_100171738 | Ga0075363_1001717382 | 199 |
| 276 | 3300006048 | Ga0075363_100264430 | Ga0075363_1002644302 | 199 |
| 277 | 3300006048 | Ga0075363_100280042 | Ga0075363_1002800422 | 199 |
| 278 | 3300006058 | Ga0075432_10074273 | Ga0075432_100742732 | 199 |
| 279 | 3300006058 | Ga0075432_10108319 | Ga0075432_101083192 | 199 |
| 280 | 3300006177 | Ga0075362_10002978 | Ga0075362_100029787 | 199 |
| 281 | 3300006177 | Ga0075362_10013006 | Ga0075362_100130062 | 199 |
| 282 | 3300006177 | Ga0075362_10019237 | Ga0075362_100192373 | 199 |
| 283 | 3300006186 | Ga0075369_10218994 | Ga0075369_102189942 | 199 |
| 284 | 3300006195 | Ga0075366_10072694 | Ga0075366_100726942 | 199 |
| 285 | 3300006195 | Ga0075366_10080886 | Ga0075366_100808862 | 199 |
| 286 | 3300006195 | Ga0075366_10100065 | Ga0075366_101000652 | 199 |
| 287 | 3300006195 | Ga0075366_10105913 | Ga0075366_101059132 | 199 |
| 288 | 3300006195 | Ga0075366_10124003 | Ga0075366_101240032 | 199 |
| 289 | 3300006195 | Ga0075366_10190135 | Ga0075366_101901352 | 199 |
| 290 | 3300006237 | Ga0097621_100246691 | Ga0097621_1002466912 | 199 |
| 291 | 3300006237 | Ga0097621_100797262 | Ga0097621_1007972622 | 199 |
| 292 | 3300006353 | Ga0075370_10001034 | Ga0075370_100010347 | 199 |
| 293 | 3300006353 | Ga0075370_10003779 | Ga0075370_100037794 | 199 |
| 294 | 3300006353 | Ga0075370_10023982 | Ga0075370_100239823 | 199 |
| 295 | 3300006353 | Ga0075370_10065741 | Ga0075370_100657413 | 199 |
| 296 | 3300006353 | Ga0075370_10071851 | Ga0075370_100718512 | 199 |
| 297 | 3300006358 | Ga0068871_100615614 | Ga0068871_1006156142 | 199 |
| 298 | 3300006846 | Ga0075430_100101548 | Ga0075430_1001015483 | 199 |
| 299 | 3300006847 | Ga0075431_100299414 | Ga0075431_1002994142 | 199 |
| 300 | 3300006880 | Ga0075429_100782157 | Ga0075429_1007821572 | 199 |
| 301 | 3300006948 | Ga0099826_10114653 | Ga0099826_101146532 | 199 |
| 302 | 3300009036 | Ga0105244_10036366 | Ga0105244_100363662 | 199 |
| 303 | 3300009036 | Ga0105244_10166189 | Ga0105244_101661892 | 199 |
| 304 | 3300009148 | Ga0105243_10001140 | Ga0105243_100011404 | 199 |
| 305 | 3300009148 | Ga0105243_10014072 | Ga0105243_100140725 | 199 |
| 306 | 3300009174 | Ga0105241_10031745 | Ga0105241_100317453 | 199 |
| 307 | 3300009176 | Ga0105242_11564768 | Ga0105242_115647681 | 199 |
| 308 | 3300009177 | Ga0105248_10206365 | Ga0105248_102063653 | 199 |
| 309 | 3300010375 | Ga0105239_10577955 | Ga0105239_105779552 | 199 |
| 310 | 3300010375 | Ga0105239_11018428 | Ga0105239_110184281 | 199 |
| 311 | 3300012502 | Ga0157347_1009909 | Ga0157347_10099092 | 199 |
| 312 | 3300013100 | Ga0157373_10095661 | Ga0157373_100956612 | 199 |
| 313 | 3300013104 | Ga0157370_10002450 | Ga0157370_100024504 | 199 |
| 314 | 3300013104 | Ga0157370_10240479 | Ga0157370_102404792 | 199 |
| 315 | 3300013306 | Ga0163162_11125515 | Ga0163162_111255151 | 199 |
| 316 | 3300013308 | Ga0157375_10822204 | Ga0157375_108222042 | 199 |
| 317 | 3300014325 | Ga0163163_10625101 | Ga0163163_106251012 | 199 |
| 318 | 3300014497 | Ga0182008_10000225 | Ga0182008_100002258 | 199 |
| 319 | 3300014497 | Ga0182008_10011230 | Ga0182008_100112302 | 199 |
| 320 | 3300014497 | Ga0182008_10014507 | Ga0182008_100145073 | 199 |
| 321 | 3300014497 | Ga0182008_10019854 | Ga0182008_100198542 | 199 |
| 322 | 3300014497 | Ga0182008_10040078 | Ga0182008_100400783 | 199 |
| 323 | 3300014497 | Ga0182008_10259584 | Ga0182008_102595842 | 199 |
| 324 | 3300014968 | Ga0157379_10512770 | Ga0157379_105127702 | 199 |
| 325 | 3300014969 | Ga0157376_10038395 | Ga0157376_100383954 | 199 |
| 326 | 3300014969 | Ga0157376_10405592 | Ga0157376_104055922 | 199 |
| 327 | 3300014969 | Ga0157376_10940372 | Ga0157376_109403722 | 199 |
| 328 | 3300015261 | Ga0182006_1010162 | Ga0182006_10101623 | 199 |
| 329 | 3300015261 | Ga0182006_1041803 | Ga0182006_10418032 | 199 |
| 330 | 3300015262 | Ga0182007_10003534 | Ga0182007_100035345 | 199 |
| 331 | 3300015262 | Ga0182007_10020624 | Ga0182007_100206242 | 199 |
| 332 | 3300015265 | Ga0182005_1016595 | Ga0182005_10165953 | 199 |
| 333 | 3300015265 | Ga0182005_1039584 | Ga0182005_10395841 | 199 |
| 334 | 3300015683 | Ga0183362_10005 | Ga0183362_10005340 | 199 |
| 335 | 3300017792 | Ga0163161_10000114 | Ga0163161_1000011438 | 199 |
| 336 | 3300017792 | Ga0163161_10051863 | Ga0163161_100518632 | 199 |
| 337 | 3300017792 | Ga0163161_10101427 | Ga0163161_101014272 | 199 |
| 338 | 3300017792 | Ga0163161_10232667 | Ga0163161_102326672 | 199 |
| 339 | 3300017792 | Ga0163161_10241309 | Ga0163161_102413092 | 199 |
| 340 | 3300017792 | Ga0163161_10679700 | Ga0163161_106797002 | 199 |
| 341 | 3300017792 | Ga0163161_11266573 | Ga0163161_112665731 | 199 |
| 342 | 3300021361 | Ga0213872_10005990 | Ga0213872_100059905 | 199 |
| 343 | 3300025228 | Ga0209672_100477 | Ga0209672_10047717 | 199 |
| 344 | 3300025229 | Ga0209147_101499 | Ga0209147_1014994 | 199 |
| 345 | 3300025242 | Ga0209258_100568 | Ga0209258_10056829 | 199 |
| 346 | 3300025245 | Ga0207425_1000069 | Ga0207425_100006998 | 199 |
| 347 | 3300025245 | Ga0207425_1007005 | Ga0207425_10070054 | 199 |
| 348 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033101 | 199 |
| 349 | 3300025258 | Ga0209129_1000233 | Ga0209129_100023367 | 199 |
| 350 | 3300025258 | Ga0209129_1001166 | Ga0209129_10011662 | 199 |
| 351 | 3300025258 | Ga0209129_1006462 | Ga0209129_10064624 | 199 |
| 352 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020387 | 199 |
| 353 | 3300025263 | Ga0209565_1000171 | Ga0209565_100017167 | 199 |
| 354 | 3300025263 | Ga0209565_1007159 | Ga0209565_10071592 | 199 |
| 355 | 3300025263 | Ga0209565_1047747 | Ga0209565_10477472 | 199 |
| 356 | 3300025273 | Ga0209673_1000295 | Ga0209673_100029581 | 199 |
| 357 | 3300025273 | Ga0209673_1000301 | Ga0209673_100030156 | 199 |
| 358 | 3300025273 | Ga0209673_1004394 | Ga0209673_10043947 | 199 |
| 359 | 3300025273 | Ga0209673_1009432 | Ga0209673_10094324 | 199 |
| 360 | 3300025273 | Ga0209673_1020108 | Ga0209673_10201082 | 199 |
| 361 | 3300025273 | Ga0209673_1020941 | Ga0209673_10209412 | 199 |
| 362 | 3300025284 | Ga0209130_1000193 | Ga0209130_100019344 | 199 |
| 363 | 3300025284 | Ga0209130_1000366 | Ga0209130_100036645 | 199 |
| 364 | 3300025284 | Ga0209130_1001843 | Ga0209130_10018435 | 199 |
| 365 | 3300025284 | Ga0209130_1025709 | Ga0209130_10257092 | 199 |
| 366 | 3300025291 | Ga0209675_1000014 | Ga0209675_1000014376 | 199 |
| 367 | 3300025291 | Ga0209675_1000236 | Ga0209675_100023667 | 199 |
| 368 | 3300025291 | Ga0209675_1000582 | Ga0209675_10005826 | 199 |
| 369 | 3300025291 | Ga0209675_1006428 | Ga0209675_10064284 | 199 |
| 370 | 3300025291 | Ga0209675_1008038 | Ga0209675_10080384 | 199 |
| 371 | 3300025292 | Ga0209676_1000048 | Ga0209676_1000048228 | 199 |
| 372 | 3300025292 | Ga0209676_1000098 | Ga0209676_100009845 | 199 |
| 373 | 3300025292 | Ga0209676_1000123 | Ga0209676_100012334 | 199 |
| 374 | 3300025292 | Ga0209676_1013512 | Ga0209676_10135123 | 199 |
| 375 | 3300025292 | Ga0209676_1018047 | Ga0209676_10180473 | 199 |
| 376 | 3300025292 | Ga0209676_1023673 | Ga0209676_10236733 | 199 |
| 377 | 3300025292 | Ga0209676_1043481 | Ga0209676_10434812 | 199 |
| 378 | 3300025292 | Ga0209676_1050949 | Ga0209676_10509492 | 199 |
| 379 | 3300025294 | Ga0209025_1000204 | Ga0209025_100020462 | 199 |
| 380 | 3300025294 | Ga0209025_1000264 | Ga0209025_100026467 | 199 |
| 381 | 3300025294 | Ga0209025_1000348 | Ga0209025_100034830 | 199 |
| 382 | 3300025294 | Ga0209025_1005823 | Ga0209025_10058232 | 199 |
| 383 | 3300025294 | Ga0209025_1019355 | Ga0209025_10193554 | 199 |
| 384 | 3300025294 | Ga0209025_1019870 | Ga0209025_10198704 | 199 |
| 385 | 3300025295 | Ga0209564_1000231 | Ga0209564_100023167 | 199 |
| 386 | 3300025295 | Ga0209564_1002077 | Ga0209564_100207715 | 199 |
| 387 | 3300025297 | Ga0209758_1000222 | Ga0209758_100022267 | 199 |
| 388 | 3300025297 | Ga0209758_1051551 | Ga0209758_10515512 | 199 |
| 389 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012228 | 199 |
| 390 | 3300025298 | Ga0209050_1001339 | Ga0209050_10013394 | 199 |
| 391 | 3300025298 | Ga0209050_1033105 | Ga0209050_10331052 | 199 |
| 392 | 3300025298 | Ga0209050_1035197 | Ga0209050_10351972 | 199 |
| 393 | 3300025299 | Ga0209256_1000095 | Ga0209256_100009559 | 199 |
| 394 | 3300025299 | Ga0209256_1000284 | Ga0209256_100028455 | 199 |
| 395 | 3300025299 | Ga0209256_1016014 | Ga0209256_10160142 | 199 |
| 396 | 3300025302 | Ga0207426_1000058 | Ga0207426_100005835 | 199 |
| 397 | 3300025302 | Ga0207426_1000349 | Ga0207426_100034944 | 199 |
| 398 | 3300025303 | Ga0209051_1000019 | Ga0209051_1000019147 | 199 |
| 399 | 3300025303 | Ga0209051_1000091 | Ga0209051_100009134 | 199 |
| 400 | 3300025303 | Ga0209051_1000098 | Ga0209051_100009845 | 199 |
| 401 | 3300025303 | Ga0209051_1000099 | Ga0209051_100009969 | 199 |
| 402 | 3300025303 | Ga0209051_1000342 | Ga0209051_100034232 | 199 |
| 403 | 3300025303 | Ga0209051_1001310 | Ga0209051_10013103 | 199 |
| 404 | 3300025303 | Ga0209051_1025182 | Ga0209051_10251822 | 199 |
| 405 | 3300025304 | Ga0209257_1000024 | Ga0209257_1000024174 | 199 |
| 406 | 3300025304 | Ga0209257_1000497 | Ga0209257_100049728 | 199 |
| 407 | 3300025304 | Ga0209257_1000677 | Ga0209257_100067767 | 199 |
| 408 | 3300025304 | Ga0209257_1003804 | Ga0209257_100380410 | 199 |
| 409 | 3300025304 | Ga0209257_1004226 | Ga0209257_10042262 | 199 |
| 410 | 3300025304 | Ga0209257_1052704 | Ga0209257_10527042 | 199 |
| 411 | 3300025321 | Ga0207656_10015819 | Ga0207656_100158193 | 199 |
| 412 | 3300025728 | Ga0207655_1000675 | Ga0207655_10006754 | 199 |
| 413 | 3300025893 | Ga0207682_10146311 | Ga0207682_101463112 | 199 |
| 414 | 3300025907 | Ga0207645_10135701 | Ga0207645_101357012 | 199 |
| 415 | 3300025923 | Ga0207681_10083126 | Ga0207681_100831262 | 199 |
| 416 | 3300025933 | Ga0207706_10035041 | Ga0207706_100350415 | 199 |
| 417 | 3300025935 | Ga0207709_10000331 | Ga0207709_1000033133 | 199 |
| 418 | 3300025935 | Ga0207709_10000464 | Ga0207709_1000046420 | 199 |
| 419 | 3300025935 | Ga0207709_10008913 | Ga0207709_100089136 | 199 |
| 420 | 3300025938 | Ga0207704_10797581 | Ga0207704_107975812 | 199 |
| 421 | 3300025940 | Ga0207691_10633910 | Ga0207691_106339102 | 199 |
| 422 | 3300025941 | Ga0207711_10129776 | Ga0207711_101297762 | 199 |
| 423 | 3300025942 | Ga0207689_10100011 | Ga0207689_101000113 | 199 |
| 424 | 3300025942 | Ga0207689_10588989 | Ga0207689_105889891 | 199 |
| 425 | 3300025945 | Ga0207679_10074547 | Ga0207679_100745474 | 199 |
| 426 | 3300025949 | Ga0207667_10099672 | Ga0207667_100996722 | 199 |
| 427 | 3300025949 | Ga0207667_10109713 | Ga0207667_101097134 | 199 |
| 428 | 3300025960 | Ga0207651_10206224 | Ga0207651_102062242 | 199 |
| 429 | 3300025981 | Ga0207640_10482424 | Ga0207640_104824242 | 199 |
| 430 | 3300025986 | Ga0207658_10255627 | Ga0207658_102556272 | 199 |
| 431 | 3300025986 | Ga0207658_10865360 | Ga0207658_108653601 | 199 |
| 432 | 3300026023 | Ga0207677_10018143 | Ga0207677_100181433 | 199 |
| 433 | 3300026023 | Ga0207677_10288768 | Ga0207677_102887682 | 199 |
| 434 | 3300026041 | Ga0207639_10020870 | Ga0207639_100208704 | 199 |
| 435 | 3300026078 | Ga0207702_10667621 | Ga0207702_106676212 | 199 |
| 436 | 3300026078 | Ga0207702_10725298 | Ga0207702_107252981 | 199 |
| 437 | 3300026088 | Ga0207641_10129708 | Ga0207641_101297083 | 199 |
| 438 | 3300026095 | Ga0207676_10681670 | Ga0207676_106816702 | 199 |
| 439 | 3300026116 | Ga0207674_10122845 | Ga0207674_101228452 | 199 |
| 440 | 3300026116 | Ga0207674_10269315 | Ga0207674_102693152 | 199 |
| 441 | 3300026116 | Ga0207674_10328358 | Ga0207674_103283582 | 199 |
| 442 | 3300026121 | Ga0207683_10092950 | Ga0207683_100929503 | 199 |
| 443 | 3300026121 | Ga0207683_10377433 | Ga0207683_103774332 | 199 |
| 444 | 3300026121 | Ga0207683_10427315 | Ga0207683_104273152 | 199 |
| 445 | 3300027666 | Ga0209282_1005738 | Ga0209282_10057384 | 199 |
| 446 | 3300027666 | Ga0209282_1093813 | Ga0209282_10938132 | 199 |
| 447 | 3300028379 | Ga0268266_10200059 | Ga0268266_102000592 | 199 |
| 448 | 3300028380 | Ga0268265_10021322 | Ga0268265_100213225 | 199 |
| 449 | 3300028794 | Ga0307515_10000040 | Ga0307515_10000040148 | 199 |
| 450 | 3300028794 | Ga0307515_10099599 | Ga0307515_100995992 | 199 |
| 451 | 3300030731 | Ga0316177_1099357 | Ga0316177_10993572 | 199 |
| 452 | 3300030732 | Ga0316176_1067430 | Ga0316176_10674302 | 199 |
| 453 | 3300030742 | Ga0316183_1086557 | Ga0316183_108655717 | 199 |
| 454 | 3300031235 | Ga0265330_10019471 | Ga0265330_100194713 | 199 |
| 455 | 3300031247 | Ga0265340_10217061 | Ga0265340_102170611 | 199 |
| 456 | 3300031251 | Ga0265327_10000746 | Ga0265327_1000074621 | 199 |
| 457 | 3300031251 | Ga0265327_10044923 | Ga0265327_100449232 | 199 |
| 458 | 3300031456 | Ga0307513_10113647 | Ga0307513_101136474 | 199 |
| 459 | 3300031456 | Ga0307513_10175863 | Ga0307513_101758632 | 199 |
| 460 | 3300031456 | Ga0307513_10313467 | Ga0307513_103134672 | 199 |
| 461 | 3300031548 | Ga0307408_100003650 | Ga0307408_1000036503 | 199 |
| 462 | 3300031548 | Ga0307408_100051116 | Ga0307408_1000511162 | 199 |
| 463 | 3300031548 | Ga0307408_100053852 | Ga0307408_1000538524 | 199 |
| 464 | 3300031548 | Ga0307408_100076112 | Ga0307408_1000761122 | 199 |
| 465 | 3300031548 | Ga0307408_101162263 | Ga0307408_1011622631 | 199 |
| 466 | 3300031649 | Ga0307514_10008104 | Ga0307514_100081045 | 199 |
| 467 | 3300031730 | Ga0307516_10077116 | Ga0307516_100771163 | 199 |
| 468 | 3300031731 | Ga0307405_10012930 | Ga0307405_100129305 | 199 |
| 469 | 3300031731 | Ga0307405_10027530 | Ga0307405_100275303 | 199 |
| 470 | 3300031731 | Ga0307405_10280752 | Ga0307405_102807522 | 199 |
| 471 | 3300031731 | Ga0307405_10546594 | Ga0307405_105465942 | 199 |
| 472 | 3300031731 | Ga0307405_10641943 | Ga0307405_106419432 | 199 |
| 473 | 3300031731 | Ga0307405_10695234 | Ga0307405_106952342 | 199 |
| 474 | 3300031731 | Ga0307405_11133808 | Ga0307405_111338081 | 199 |
| 475 | 3300031824 | Ga0307413_10055028 | Ga0307413_100550282 | 199 |
| 476 | 3300031824 | Ga0307413_10434456 | Ga0307413_104344562 | 199 |
| 477 | 3300031901 | Ga0307406_10000324 | Ga0307406_1000032427 | 199 |
| 478 | 3300031901 | Ga0307406_10059024 | Ga0307406_100590242 | 199 |
| 479 | 3300031901 | Ga0307406_10235516 | Ga0307406_102355162 | 199 |
| 480 | 3300031901 | Ga0307406_10260938 | Ga0307406_102609382 | 199 |
| 481 | 3300031901 | Ga0307406_10316864 | Ga0307406_103168642 | 199 |
| 482 | 3300031901 | Ga0307406_10750741 | Ga0307406_107507412 | 199 |
| 483 | 3300031903 | Ga0307407_10445024 | Ga0307407_104450242 | 199 |
| 484 | 3300031911 | Ga0307412_10030197 | Ga0307412_100301972 | 199 |
| 485 | 3300031911 | Ga0307412_10043892 | Ga0307412_100438924 | 199 |
| 486 | 3300031911 | Ga0307412_10077823 | Ga0307412_100778234 | 199 |
| 487 | 3300031911 | Ga0307412_10102742 | Ga0307412_101027422 | 199 |
| 488 | 3300031911 | Ga0307412_10247791 | Ga0307412_102477912 | 199 |
| 489 | 3300031995 | Ga0307409_101043332 | Ga0307409_1010433322 | 199 |
| 490 | 3300032002 | Ga0307416_100010896 | Ga0307416_1000108963 | 199 |
| 491 | 3300032004 | Ga0307414_10078062 | Ga0307414_100780621 | 199 |
| 492 | 3300032004 | Ga0307414_10610220 | Ga0307414_106102202 | 199 |
| 493 | 3300032004 | Ga0307414_10710933 | Ga0307414_107109332 | 199 |
| 494 | 3300032005 | Ga0307411_10001615 | Ga0307411_100016152 | 199 |
| 495 | 3300032005 | Ga0307411_10027661 | Ga0307411_100276612 | 199 |
| 496 | 3300032005 | Ga0307411_10578154 | Ga0307411_105781542 | 199 |
| 497 | 3300032126 | Ga0307415_100393587 | Ga0307415_1003935872 | 199 |
| 498 | 3300035691 | Ga0373931_0032340 | Ga0373931_0032340_313_915 | 199 |
| 499 | 3300036401 | Ga0373937_0627494 | Ga0373937_0627494_16_621 | 199 |
| 500 | 3300037312 | Ga0395899_0001018 | Ga0395899_0001018_18744_19349 | 199 |
| 501 | 3300037312 | Ga0395899_0322141 | Ga0395899_0322141_243_848 | 199 |
| 502 | 3300037312 | Ga0395899_0455726 | Ga0395899_0455726_144_746 | 199 |
| 503 | 3300037418 | Ga0395900_0040394 | Ga0395900_0040394_3306_3911 | 199 |
| 504 | 3300037418 | Ga0395900_0216421 | Ga0395900_0216421_1032_1637 | 199 |
| 505 | 3300037466 | Ga0395898_0008698 | Ga0395898_0008698_6272_6877 | 199 |
| 506 | 3300037466 | Ga0395898_0107645 | Ga0395898_0107645_578_1183 | 199 |
| 507 | 3300037466 | Ga0395898_0199014 | Ga0395898_0199014_64_666 | 199 |
| 508 | 3300037471 | Ga0395905_0002817 | Ga0395905_0002817_1883_2494 | 199 |
| 509 | 3300037471 | Ga0395905_0004508 | Ga0395905_0004508_6637_7242 | 199 |
| 510 | 3300037471 | Ga0395905_0008661 | Ga0395905_0008661_8556_9161 | 199 |
| 511 | 3300037471 | Ga0395905_0052347 | Ga0395905_0052347_1780_2385 | 199 |
| 512 | 3300037471 | Ga0395905_0065940 | Ga0395905_0065940_2650_3276 | 199 |
| 513 | 3300037471 | Ga0395905_0089643 | Ga0395905_0089643_589_1194 | 199 |
| 514 | 3300037471 | Ga0395905_0206749 | Ga0395905_0206749_846_1454 | 199 |
| 515 | 3300037471 | Ga0395905_0228685 | Ga0395905_0228685_543_1148 | 199 |
| 516 | 3300037471 | Ga0395905_0795698 | Ga0395905_0795698_124_729 | 199 |
| 517 | 3300037471 | Ga0395905_0834446 | Ga0395905_0834446_185_793 | 199 |
| 518 | 3300038443 | Ga0395901_0022637 | Ga0395901_0022637_998_1603 | 199 |
| 519 | 3300038443 | Ga0395901_0097141 | Ga0395901_0097141_664_1269 | 199 |
| 520 | 3300038443 | Ga0395901_0366817 | Ga0395901_0366817_113_718 | 199 |
| 521 | 3300039447 | Ga0436361_0837231 | Ga0436361_0837231_542_1150 | 199 |
| 522 | 3300041404 | Ga0439436_0000586 | Ga0439436_0000586_8777_9376 | 199 |
| 523 | 3300041404 | Ga0439436_0003260 | Ga0439436_0003260_286_885 | 199 |
| 524 | 3300041404 | Ga0439436_0053662 | Ga0439436_0053662_63_662 | 199 |
| 525 | 3300041406 | Ga0439439_0007617 | Ga0439439_0007617_1493_2092 | 199 |
| 526 | 3300041406 | Ga0439439_0012633 | Ga0439439_0012633_1252_1851 | 199 |
| 527 | 3300041407 | Ga0439447_031943 | Ga0439447_031943_516_1115 | 199 |
| 528 | 3300041407 | Ga0439447_074976 | Ga0439447_074976_86_715 | 199 |
| 529 | 3300041407 | Ga0439447_080230 | Ga0439447_080230_29_628 | 199 |
| 530 | 3300041410 | Ga0439461_0001667 | Ga0439461_0001667_1647_2246 | 199 |
| 531 | 3300041411 | Ga0439466_0016222 | Ga0439466_0016222_425_1024 | 199 |
| 532 | 3300041411 | Ga0439466_0093318 | Ga0439466_0093318_217_816 | 199 |
| 533 | 3300041413 | Ga0439465_0000571 | Ga0439465_0000571_2276_2875 | 199 |
| 534 | 3300041498 | Ga0451841_1087416 | Ga0451841_1087416_47_646 | 199 |
| 535 | 3300041997 | Ga0439431_0000218 | Ga0439431_0000218_4433_5032 | 199 |
| 536 | 3300041997 | Ga0439431_0023674 | Ga0439431_0023674_135_734 | 199 |
| 537 | 3300041997 | Ga0439431_0045506 | Ga0439431_0045506_56_655 | 199 |
| 538 | 3300042000 | Ga0439437_023326 | Ga0439437_023326_74_691 | 199 |
| 539 | 3300042002 | Ga0439442_014583 | Ga0439442_014583_718_1317 | 199 |
| 540 | 3300042004 | Ga0439445_0005073 | Ga0439445_0005073_564_1163 | 199 |
| 541 | 3300042004 | Ga0439445_0060743 | Ga0439445_0060743_348_947 | 199 |
| 542 | 3300042004 | Ga0439445_0100640 | Ga0439445_0100640_17_616 | 199 |
| 543 | 3300042006 | Ga0439432_000464 | Ga0439432_000464_4197_4796 | 199 |
| 544 | 3300042006 | Ga0439432_013370 | Ga0439432_013370_2039_2638 | 199 |
| 545 | 3300042007 | Ga0439449_0001782 | Ga0439449_0001782_5897_6502 | 199 |
| 546 | 3300042007 | Ga0439449_0002685 | Ga0439449_0002685_2010_2609 | 199 |
| 547 | 3300042007 | Ga0439449_0232706 | Ga0439449_0232706_37_645 | 199 |
| 548 | 3300042010 | Ga0439452_009991 | Ga0439452_009991_402_1001 | 199 |
| 549 | 3300042012 | Ga0439455_0031067 | Ga0439455_0031067_109_708 | 199 |
| 550 | 3300042014 | Ga0439457_021851 | Ga0439457_021851_175_774 | 199 |
| 551 | 3300042014 | Ga0439457_039645 | Ga0439457_039645_146_745 | 199 |
| 552 | 3300042014 | Ga0439457_045282 | Ga0439457_045282_71_676 | 199 |
| 553 | 3300042014 | Ga0439457_067131 | Ga0439457_067131_174_773 | 199 |
| 554 | 3300042015 | Ga0439462_0001912 | Ga0439462_0001912_2069_2668 | 199 |
| 555 | 3300042015 | Ga0439462_0006154 | Ga0439462_0006154_264_863 | 199 |
| 556 | 3300042015 | Ga0439462_0007329 | Ga0439462_0007329_1568_2173 | 199 |
| 557 | 3300042015 | Ga0439462_0029151 | Ga0439462_0029151_135_734 | 199 |
| 558 | 3300042015 | Ga0439462_0033550 | Ga0439462_0033550_124_723 | 199 |
| 559 | 3300042115 | Ga0450911_000496 | Ga0450911_000496_5571_6170 | 199 |
| 560 | 3300042121 | Ga0450919_008525 | Ga0450919_008525_62_661 | 199 |
| 561 | 3300042131 | Ga0450894_011246 | Ga0450894_011246_461_1060 | 199 |
| 562 | 3300042145 | Ga0450906_014085 | Ga0450906_014085_280_879 | 199 |
| 563 | 3300042147 | Ga0450910_001247 | Ga0450910_001247_1230_1829 | 199 |
| 564 | 3300042156 | Ga0439446_0088038 | Ga0439446_0088038_250_849 | 199 |
| 565 | 3300042156 | Ga0439446_0219893 | Ga0439446_0219893_18_623 | 199 |
| 566 | 3300042184 | Ga0450908_004376 | Ga0450908_004376_1957_2556 | 199 |
| 567 | 3300042185 | Ga0450909_014761 | Ga0450909_014761_284_883 | 199 |
| 568 | 3300042185 | Ga0450909_026382 | Ga0450909_026382_169_774 | 199 |
| 569 | 3300042435 | Ga0439434_0000517 | Ga0439434_0000517_453_1052 | 199 |
| 570 | 3300042435 | Ga0439434_0009050 | Ga0439434_0009050_1846_2445 | 199 |
| 571 | 3300042461 | Ga0439460_0030740 | Ga0439460_0030740_255_860 | 199 |
| 572 | 3300042531 | Ga0450918_006667 | Ga0450918_006667_61_660 | 199 |
| 573 | 3300042531 | Ga0450918_024708 | Ga0450918_024708_228_827 | 199 |
| 574 | 3300042876 | Ga0451577_0101455 | Ga0451577_0101455_134_739 | 199 |
| 575 | 3300044656 | Ga0466969_0021587 | Ga0466969_0021587_2689_3294 | 199 |
| 576 | 3300044656 | Ga0466969_0038894 | Ga0466969_0038894_677_1282 | 199 |
| 577 | 3300044673 | Ga0453683_0006241 | Ga0453683_0006241_6127_6732 | 199 |
| 578 | 3300044683 | Ga0466965_0370169 | Ga0466965_0370169_37_636 | 199 |
| 579 | 3300044684 | Ga0466966_0138717 | Ga0466966_0138717_153_758 | 199 |
| 580 | 3300044693 | Ga0466961_0099502 | Ga0466961_0099502_246_851 | 199 |
| 581 | 3300044765 | Ga0466970_0037823 | Ga0466970_0037823_1020_1625 | 199 |
| 582 | 3300044842 | Ga0466957_0396785 | Ga0466957_0396785_147_752 | 199 |
| 583 | 3300044901 | Ga0466960_0265159 | Ga0466960_0265159_320_919 | 199 |
| 584 | 3300045049 | Ga0466959_0036604 | Ga0466959_0036604_2143_2748 | 199 |
| 585 | 3300045049 | Ga0466959_0454665 | Ga0466959_0454665_145_753 | 199 |
| 586 | 3300045051 | Ga0451576_0017383 | Ga0451576_0017383_5203_5808 | 199 |
| 587 | 3300046453 | Ga0495627_057008 | Ga0495627_057008_396_995 | 199 |
| 588 | 3300046457 | Ga0495590_0080524 | Ga0495590_0080524_280_879 | 199 |
| 589 | 3300046459 | Ga0495629_0211632 | Ga0495629_0211632_589_1188 | 199 |
| 590 | 3300046460 | Ga0495638_0019572 | Ga0495638_0019572_1777_2376 | 199 |
| 591 | 3300046512 | Ga0495610_0021660 | Ga0495610_0021660_1514_2113 | 199 |
| 592 | 3300046513 | Ga0495616_0003870 | Ga0495616_0003870_8332_8931 | 199 |
| 593 | 3300046518 | Ga0495631_0000163 | Ga0495631_0000163_38995_39594 | 199 |
| 594 | 3300046520 | Ga0495637_0006475 | Ga0495637_0006475_2220_2819 | 199 |
| 595 | 3300046525 | Ga0495663_0037328 | Ga0495663_0037328_822_1421 | 199 |
| 596 | 3300046528 | Ga0495642_0081622 | Ga0495642_0081622_324_929 | 199 |
| 597 | 3300046530 | Ga0495654_0022427 | Ga0495654_0022427_1337_1936 | 199 |
| 598 | 3300046530 | Ga0495654_0201393 | Ga0495654_0201393_224_823 | 199 |
| 599 | 3300046557 | Ga0495622_0262361 | Ga0495622_0262361_48_647 | 199 |
| 600 | 3300046558 | Ga0495633_0148210 | Ga0495633_0148210_112_711 | 199 |
| 601 | 3300046615 | Ga0495656_0000163 | Ga0495656_0000163_18890_19489 | 199 |
| 602 | 3300046615 | Ga0495656_0111103 | Ga0495656_0111103_286_891 | 199 |
| 603 | 3300046615 | Ga0495656_0124913 | Ga0495656_0124913_381_986 | 199 |
| 604 | 3300046660 | Ga0495625_0000045 | Ga0495625_0000045_142026_142625 | 199 |
| 605 | 3300046660 | Ga0495625_0060501 | Ga0495625_0060501_543_1142 | 199 |
| 606 | 3300046674 | Ga0495588_0255079 | Ga0495588_0255079_205_804 | 199 |
| 607 | 3300046683 | Ga0495658_0115048 | Ga0495658_0115048_10_609 | 199 |
| 608 | 3300046691 | Ga0495670_0100652 | Ga0495670_0100652_459_1058 | 199 |
| 609 | 3300046692 | Ga0495671_0015415 | Ga0495671_0015415_2320_2919 | 199 |
| 610 | 3300046810 | Ga0495660_0045443 | Ga0495660_0045443_55_654 | 199 |
| 611 | 3300047321 | Ga0495676_0058877 | Ga0495676_0058877_2347_2946 | 199 |
| 612 | 3300047470 | Ga0495681_0253262 | Ga0495681_0253262_66_671 | 199 |
| 613 | 3300047673 | Ga0495593_0002104 | Ga0495593_0002104_282_881 | 199 |
| 614 | 3300048089 | Ga0495614_0088545 | Ga0495614_0088545_70_669 | 199 |
| 615 | 3300048903 | Ga0496100_0099001 | Ga0496100_0099001_852_1457 | 199 |
| 616 | 3300048904 | Ga0496101_0003542 | Ga0496101_0003542_3687_4292 | 199 |
| 617 | 3300048904 | Ga0496101_0059835 | Ga0496101_0059835_1318_1917 | 199 |
| 618 | 3300048905 | Ga0496102_0008409 | Ga0496102_0008409_3910_4515 | 199 |
| 619 | 3300048905 | Ga0496102_0266002 | Ga0496102_0266002_546_1145 | 199 |
| 620 | 3300048907 | Ga0496104_0116799 | Ga0496104_0116799_11_616 | 199 |
| 621 | 3300048908 | Ga0496105_0050318 | Ga0496105_0050318_175_780 | 199 |
| 622 | 3300048913 | Ga0496110_0013319 | Ga0496110_0013319_334_939 | 199 |
| 623 | 3300048914 | Ga0496111_0400359 | Ga0496111_0400359_364_969 | 199 |
| 624 | 3300048917 | Ga0496114_0371118 | Ga0496114_0371118_377_982 | 199 |
| 625 | 3300048919 | Ga0496116_0064554 | Ga0496116_0064554_687_1286 | 199 |
| 626 | 3300048919 | Ga0496116_0158318 | Ga0496116_0158318_504_1103 | 199 |
| 627 | 3300048920 | Ga0496117_0028929 | Ga0496117_0028929_2941_3540 | 199 |
| 628 | 3300048920 | Ga0496117_0059066 | Ga0496117_0059066_614_1213 | 199 |
| 629 | 3300048920 | Ga0496117_0112317 | Ga0496117_0112317_780_1379 | 199 |
| 630 | 3300048921 | Ga0496118_0032009 | Ga0496118_0032009_1208_1807 | 199 |
| 631 | 3300048921 | Ga0496118_0282758 | Ga0496118_0282758_85_690 | 199 |
| 632 | 3300048921 | Ga0496118_0297641 | Ga0496118_0297641_242_841 | 199 |
| 633 | 3300048922 | Ga0496119_0162441 | Ga0496119_0162441_193_792 | 199 |
| 634 | 3300048924 | Ga0496121_0006773 | Ga0496121_0006773_5640_6239 | 199 |
| 635 | 3300048924 | Ga0496121_0094623 | Ga0496121_0094623_41_640 | 199 |
| 636 | 3300048924 | Ga0496121_0146946 | Ga0496121_0146946_79_678 | 199 |
| 637 | 3300048924 | Ga0496121_0269007 | Ga0496121_0269007_147_746 | 199 |
| 638 | 3300048924 | Ga0496121_0316496 | Ga0496121_0316496_413_1012 | 199 |
| 639 | 3300048925 | Ga0496122_0000331 | Ga0496122_0000331_45655_46254 | 199 |
| 640 | 3300048925 | Ga0496122_0133772 | Ga0496122_0133772_386_985 | 199 |
| 641 | 3300048925 | Ga0496122_0162021 | Ga0496122_0162021_527_1126 | 199 |
| 642 | 3300048925 | Ga0496122_0367184 | Ga0496122_0367184_38_643 | 199 |
| 643 | 3300048926 | Ga0496123_0000124 | Ga0496123_0000124_17561_18160 | 199 |
| 644 | 3300048926 | Ga0496123_0040092 | Ga0496123_0040092_2282_2899 | 199 |
| 645 | 3300048926 | Ga0496123_0042013 | Ga0496123_0042013_1926_2525 | 199 |
| 646 | 3300048926 | Ga0496123_0161843 | Ga0496123_0161843_100_699 | 199 |
| 647 | 3300048927 | Ga0496124_0052777 | Ga0496124_0052777_2181_2780 | 199 |
| 648 | 3300048927 | Ga0496124_0141472 | Ga0496124_0141472_537_1136 | 199 |
| 649 | 3300048927 | Ga0496124_0183400 | Ga0496124_0183400_641_1246 | 199 |
| 650 | 3300048928 | Ga0496125_0014888 | Ga0496125_0014888_2187_2786 | 199 |
| 651 | 3300048928 | Ga0496125_0032434 | Ga0496125_0032434_2826_3425 | 199 |
| 652 | 3300048928 | Ga0496125_0032803 | Ga0496125_0032803_2502_3101 | 199 |
| 653 | 3300048928 | Ga0496125_0056027 | Ga0496125_0056027_194_793 | 199 |
| 654 | 3300048928 | Ga0496125_0128324 | Ga0496125_0128324_1048_1647 | 199 |
| 655 | 3300048928 | Ga0496125_0202642 | Ga0496125_0202642_488_1087 | 199 |
| 656 | 3300048929 | Ga0496126_0385908 | Ga0496126_0385908_34_633 | 199 |
| 657 | 3300048929 | Ga0496126_0427765 | Ga0496126_0427765_29_628 | 199 |
| 658 | 3300049459 | Ga0495678_120977 | Ga0495678_120977_105_704 | 199 |
| 659 | 3300049569 | Ga0501032_0279026 | Ga0501032_0279026_14_619 | 199 |
| 660 | 3300049570 | Ga0501033_0222049 | Ga0501033_0222049_508_1119 | 199 |
| 661 | 3300049571 | Ga0501034_0028787 | Ga0501034_0028787_2538_3143 | 199 |
| 662 | 3300049572 | Ga0501036_0544306 | Ga0501036_0544306_39_644 | 199 |
| 663 | 3300049579 | Ga0501043_0493917 | Ga0501043_0493917_280_885 | 199 |
| 664 | 3300049581 | Ga0501047_0050858 | Ga0501047_0050858_2553_3158 | 199 |
| 665 | 3300049581 | Ga0501047_0072718 | Ga0501047_0072718_2194_2799 | 199 |
| 666 | 3300049581 | Ga0501047_0360049 | Ga0501047_0360049_274_885 | 199 |
| 667 | 3300049742 | Ga0501080_0122319 | Ga0501080_0122319_1262_1864 | 199 |
| 668 | 3300049759 | Ga0501262_000120 | Ga0501262_000120_6953_7561 | 199 |
| 669 | 3300049822 | Ga0501035_0166450 | Ga0501035_0166450_1225_1830 | 199 |
| 670 | 3300049823 | Ga0501044_0504748 | Ga0501044_0504748_21_632 | 199 |
| 671 | 3300050489 | nmdc:mga03683_3109_c1 | nmdc:mga03683_3109_c1_4328_4933 | 199 |
| 672 | 3300050490 | nmdc:mga03n38_221925_c1 | nmdc:mga03n38_221925_c1_366_965 | 199 |
| 673 | 3300050490 | nmdc:mga03n38_97708_c1 | nmdc:mga03n38_97708_c1_123_722 | 199 |
| 674 | 3300050491 | nmdc:mga00v17_193484_c1 | nmdc:mga00v17_193484_c1_429_1028 | 199 |
| 675 | 3300050492 | nmdc:mga0yw44_22552_c1 | nmdc:mga0yw44_22552_c1_1641_2240 | 199 |
| 676 | 3300050492 | nmdc:mga0yw44_284841_c1 | nmdc:mga0yw44_284841_c1_470_1075 | 199 |
| 677 | 3300050493 | nmdc:mga0k408_290334_c1 | nmdc:mga0k408_290334_c1_339_941 | 199 |
| 678 | 3300050493 | nmdc:mga0k408_78444_c1 | nmdc:mga0k408_78444_c1_729_1328 | 199 |
| 679 | 3300050493 | nmdc:mga0k408_79978_c1 | nmdc:mga0k408_79978_c1_658_1257 | 199 |
| 680 | 3300050494 | nmdc:mga06z11_193123_c1 | nmdc:mga06z11_193123_c1_90_689 | 199 |
| 681 | 3300050494 | nmdc:mga06z11_301054_c1 | nmdc:mga06z11_301054_c1_216_815 | 199 |
| 682 | 3300050494 | nmdc:mga06z11_459275_c1 | nmdc:mga06z11_459275_c1_55_657 | 199 |
| 683 | 3300050496 | nmdc:mga07m45_17711_c1 | nmdc:mga07m45_17711_c1_876_1475 | 199 |
| 684 | 3300050496 | nmdc:mga07m45_29343_c2 | nmdc:mga07m45_29343_c2_1175_1774 | 199 |
| 685 | 3300050496 | nmdc:mga07m45_297175_c1 | nmdc:mga07m45_297175_c1_324_923 | 199 |
| 686 | 3300050496 | nmdc:mga07m45_5781_c1 | nmdc:mga07m45_5781_c1_2813_3418 | 199 |
| 687 | 3300050496 | nmdc:mga07m45_605_c1 | nmdc:mga07m45_605_c1_10548_11147 | 199 |
| 688 | 3300050496 | nmdc:mga07m45_62136_c1 | nmdc:mga07m45_62136_c1_1074_1673 | 199 |
| 689 | 3300050496 | nmdc:mga07m45_8102_c1 | nmdc:mga07m45_8102_c1_4611_5213 | 199 |
| 690 | 3300050508 | nmdc:mga09592_673856_c1 | nmdc:mga09592_673856_c1_177_779 | 199 |
| 691 | 3300053079 | Ga0500610_0000014 | Ga0500610_0000014_1945_2544 | 199 |
| 692 | 3300053079 | Ga0500610_0000021 | Ga0500610_0000021_2720_3319 | 199 |
| 693 | 3300053087 | Ga0500643_025509 | Ga0500643_025509_567_1166 | 199 |
| 694 | 3300053093 | Ga0500651_0000560 | Ga0500651_0000560_10751_11350 | 199 |
| 695 | 3300053094 | Ga0500566_0176662 | Ga0500566_0176662_482_1081 | 199 |
| 696 | 3300053110 | Ga0500571_026455 | Ga0500571_026455_531_1130 | 199 |
| 697 | 3300053111 | Ga0500572_061989 | Ga0500572_061989_122_721 | 199 |
| 698 | 3300053117 | Ga0500593_000644 | Ga0500593_000644_11422_12021 | 199 |
| 699 | 3300053118 | Ga0500594_0000473 | Ga0500594_0000473_2056_2655 | 199 |
| 700 | 3300053121 | Ga0500607_000674 | Ga0500607_000674_27426_28025 | 199 |
| 701 | 3300053121 | Ga0500607_125994 | Ga0500607_125994_324_923 | 199 |
| 702 | 3300053122 | Ga0500608_116280 | Ga0500608_116280_473_1075 | 199 |
| 703 | 3300053128 | Ga0500626_036089 | Ga0500626_036089_179_778 | 199 |
| 704 | 3300053134 | Ga0500658_0000034 | Ga0500658_0000034_84366_84965 | 199 |
| 705 | 3300053134 | Ga0500658_0001015 | Ga0500658_0001015_3813_4412 | 199 |
| 706 | 3300053136 | Ga0500559_0000367 | Ga0500559_0000367_30532_31131 | 199 |
| 707 | 3300053138 | Ga0500564_151480 | Ga0500564_151480_180_779 | 199 |
| 708 | 3300053139 | Ga0500568_0000490 | Ga0500568_0000490_1274_1873 | 199 |
| 709 | 3300053151 | Ga0500604_0148557 | Ga0500604_0148557_156_755 | 199 |
| 710 | 3300053153 | Ga0500616_0119166 | Ga0500616_0119166_477_1076 | 199 |
| 711 | 3300053158 | Ga0500627_0001528 | Ga0500627_0001528_5118_5717 | 199 |
| 712 | 3300053158 | Ga0500627_0175674 | Ga0500627_0175674_234_833 | 199 |
| 713 | 3300053161 | Ga0500634_0006252 | Ga0500634_0006252_258_857 | 199 |
| 714 | 3300053161 | Ga0500634_0122059 | Ga0500634_0122059_109_708 | 199 |
| 715 | 3300053162 | Ga0500638_132157 | Ga0500638_132157_282_881 | 199 |
| 716 | 3300053177 | Ga0500636_0046985 | Ga0500636_0046985_1382_1981 | 199 |
| 717 | 3300053723 | Ga0500567_099967 | Ga0500567_099967_132_731 | 199 |
| 718 | 3300053734 | Ga0500565_002430 | Ga0500565_002430_325_924 | 199 |
| 719 | 3300059424 | Ga0590075_007587 | Ga0590075_007587_137_742 | 199 |
| 720 | 3300061719 | Ga0466962_0250788 | Ga0466962_0250788_54_659 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.968 | 3 | 194 |
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.9532 | 3 | 194 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.9186 | 1 | 197 |
| 3tqu-assembly2.cif.gz_D | structure of a ham1 protein from coxiella burnetii | 0.9178 | 1 | 196 |
| 2dvn-assembly1.cif.gz_A | structure of ph1917 protein with the complex of imp from pyrococcus horikoshii | 0.9102 | 1 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9738 | 1 | 196 | 3.90.950.10 |
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9592 | 1 | 196 | 3.90.950.10 |
| af_Q2FZC5_1_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9305 | 2 | 198 | 3.90.950.10 |
| 3s86D00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9186 | 1 | 197 | 3.90.950.10 |
| af_Q9UU89_2_186_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9156 | 2 | 196 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522SJC3-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9974 | 1 | 199 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A1V6ET71-F1-model_v4 | DITP/XTP pyrophosphatase (EC 3.6.1.19) | 0.9955 | 74 | 199 |
GO:0005829
GO:0009117 GO:0009143 GO:0047429 |
| AF-A0A6G8CR52-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9946 | 1 | 199 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A7X9U394-F1-model_v4 | deleted | 0.9927 | 1 | 199 |
|
| AF-A0A1M5EUG2-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9923 | 1 | 199 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar