F477223

General Info

Members Datasets Scaffolds Average Seq Length
719 233 1438 155

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100840575|Ga0070708_1008405751
Length 180
Sequence MADHVLERRVWLPRPRAEVFAFFADARNLALVNSPTGRLRWLTPPPPTLSAGAVIDFSIRAGGLPLPWRVFVREFDPPHRFVDVQLWGPFARWEHRHRFVEGPPAEGAGGPAGTWVEDRVTYRLPLGALGRLAHALGVERKIAGLFDYRERRLRELLGDVATAPPAAGGPRGSGPVTKRV

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
171 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
187 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
213 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.56
Rhizosphere 99.44
Stem 0
Stem Tuber 0
Unclassified 26.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100840575 3300005445 Unclassified 863
2 Ga0070676_10199710 3300005328 Unclassified 1310
3 Ga0070670_100004773 3300005331 Bacteria 11382
4 Ga0068869_100001420 3300005334 Bacteria 14186
5 Ga0068869_100019732 3300005334 Bacteria 4613
6 Ga0070666_10146655 3300005335 Bacteria 1645
7 Ga0070680_100011269 3300005336 Bacteria 6913
8 Ga0070680_100042681 3300005336 Bacteria 3681
9 Ga0070680_100516364 3300005336 Bacteria 1023
10 Ga0070682_100001024 3300005337 Bacteria 16151
11 Ga0068868_101421557 3300005338 Unclassified 647
12 Ga0070660_100088242 3300005339 Bacteria 2442
13 Ga0070689_100158000 3300005340 Unclassified 1831
14 Ga0070691_10006183 3300005341 Bacteria 5463
15 Ga0070691_10013868 3300005341 Bacteria 3699
16 Ga0070691_10106124 3300005341 Bacteria 1400
17 Ga0070687_100041377 3300005343 Bacteria 2329
18 Ga0070661_100000569 3300005344 Bacteria 27992
19 Ga0070668_101344838 3300005347 Unclassified 650
20 Ga0070669_100087569 3300005353 Unclassified 2329
21 Ga0070669_100217940 3300005353 Unclassified 1508
22 Ga0070669_100245781 3300005353 Unclassified 1423
23 Ga0070669_100527803 3300005353 Unclassified 982
24 Ga0070675_100488187 3300005354 Bacteria 1109
25 Ga0070688_100132020 3300005365 Bacteria 1686
26 Ga0070659_100001060 3300005366 Bacteria 20115
27 Ga0070667_100103002 3300005367 Bacteria 2467
28 Ga0070703_10001586 3300005406 Bacteria 6759
29 Ga0070703_10006867 3300005406 Bacteria 3194
30 Ga0070701_10795383 3300005438 Bacteria 645
31 Ga0070711_100028539 3300005439 Unclassified 3673
32 Ga0070705_100001398 3300005440 Bacteria 12804
33 Ga0070705_100013695 3300005440 Bacteria 4152
34 Ga0070705_100018913 3300005440 Bacteria 3618
35 Ga0070705_100042575 3300005440 Bacteria 2597
36 Ga0070705_100189995 3300005440 Unclassified 1399
37 Ga0070705_100248388 3300005440 Bacteria 1247
38 Ga0070705_100491844 3300005440 Bacteria 929
39 Ga0070705_100666830 3300005440 Bacteria 813
40 Ga0070700_100574055 3300005441 Bacteria 880
41 Ga0070700_100867396 3300005441 Bacteria 732
42 Ga0070694_100000661 3300005444 Bacteria 19051
43 Ga0070694_100002832 3300005444 Bacteria 10302
44 Ga0070694_100061322 3300005444 Bacteria 2566
45 Ga0070694_100153340 3300005444 Unclassified 1684
46 Ga0070694_100260806 3300005444 Bacteria 1314
47 Ga0070694_100326674 3300005444 Bacteria 1182
48 Ga0070694_100403538 3300005444 Bacteria 1071
49 Ga0070694_100633064 3300005444 Bacteria 864
50 Ga0070708_100000550 3300005445 Bacteria 28024
51 Ga0070708_100012907 3300005445 Bacteria 6824
52 Ga0070708_100013311 3300005445 Bacteria 6732
53 Ga0070708_100017124 3300005445 Bacteria 6035
54 Ga0070708_100032223 3300005445 Bacteria 4544
55 Ga0070708_100042220 3300005445 Unclassified 4002
56 Ga0070708_100116735 3300005445 Bacteria 2458
57 Ga0070708_100131560 3300005445 Bacteria 2316
58 Ga0070708_100226052 3300005445 Bacteria 1756
59 Ga0070708_100247318 3300005445 Bacteria 1675
60 Ga0070708_100345359 3300005445 Bacteria 1402
61 Ga0070708_100808990 3300005445 Unclassified 881
62 Ga0070663_100196761 3300005455 Bacteria 1571
63 Ga0070662_100071908 3300005457 Bacteria 2552
64 Ga0070662_100188872 3300005457 Bacteria 1628
65 Ga0070662_100484474 3300005457 Unclassified 1030
66 Ga0070681_10065173 3300005458 Bacteria 3612
67 Ga0068867_100002280 3300005459 Bacteria 13493
68 Ga0068867_100177291 3300005459 Bacteria 1692
69 Ga0070706_100003907 3300005467 Bacteria 14536
70 Ga0070706_100074668 3300005467 Unclassified 3138
71 Ga0070706_100084370 3300005467 Bacteria 2943
72 Ga0070706_100195498 3300005467 Unclassified 1889
73 Ga0070706_100265375 3300005467 Bacteria 1602
74 Ga0070707_100002748 3300005468 Bacteria 16755
75 Ga0070707_100004066 3300005468 Bacteria 13744
76 Ga0070707_100012641 3300005468 Bacteria 7884
77 Ga0070707_100020697 3300005468 Bacteria 6208
78 Ga0070707_100021414 3300005468 Bacteria 6110
79 Ga0070707_100078852 3300005468 Unclassified 3178
80 Ga0070707_100124514 3300005468 Unclassified 2504
81 Ga0070707_100365010 3300005468 Bacteria 1403
82 Ga0070707_100401141 3300005468 Bacteria 1331
83 Ga0070707_100548287 3300005468 Unclassified 1118
84 Ga0070707_100581284 3300005468 Bacteria 1082
85 Ga0070707_100639518 3300005468 Bacteria 1026
86 Ga0070698_100002741 3300005471 Bacteria 19362
87 Ga0070698_100004610 3300005471 Bacteria 15139
88 Ga0070698_100006046 3300005471 Bacteria 13182
89 Ga0070698_100307380 3300005471 Bacteria 1516
90 Ga0070698_100564841 3300005471 Unclassified 1077
91 Ga0070698_100647995 3300005471 Bacteria 997
92 Ga0070698_101229437 3300005471 Unclassified 699
93 Ga0070698_101323114 3300005471 Unclassified 671
94 Ga0070699_100001007 3300005518 Bacteria 26235
95 Ga0070699_100027404 3300005518 Bacteria 4914
96 Ga0070699_100028690 3300005518 Bacteria 4800
97 Ga0070699_100029730 3300005518 Bacteria 4712
98 Ga0070699_100053143 3300005518 Bacteria 3506
99 Ga0070699_100054565 3300005518 Bacteria 3459
100 Ga0070699_100060554 3300005518 Bacteria 3281
101 Ga0070699_100082338 3300005518 Unclassified 2805
102 Ga0070699_100156743 3300005518 Unclassified 2015
103 Ga0070699_100183729 3300005518 Unclassified 1856
104 Ga0070679_100000659 3300005530 Bacteria 29432
105 Ga0070684_100130099 3300005535 Bacteria 2270
106 Ga0070697_100001230 3300005536 Bacteria 19342
107 Ga0070697_100006613 3300005536 Bacteria 8988
108 Ga0070697_100028490 3300005536 Bacteria 4472
109 Ga0070697_100139974 3300005536 Bacteria 2035
110 Ga0070697_100189889 3300005536 Bacteria 1743
111 Ga0070697_100222348 3300005536 Unclassified 1609
112 Ga0070697_100251227 3300005536 Bacteria 1512
113 Ga0070697_100565599 3300005536 Bacteria 998
114 Ga0068853_100009727 3300005539 Bacteria 7756
115 Ga0070672_100064206 3300005543 Bacteria 2900
116 Ga0070686_100455334 3300005544 Bacteria 985
117 Ga0070695_100001860 3300005545 Bacteria 11920
118 Ga0070695_100004997 3300005545 Bacteria 7818
119 Ga0070695_100023118 3300005545 Bacteria 3817
120 Ga0070695_100130942 3300005545 Unclassified 1729
121 Ga0070695_100712425 3300005545 Bacteria 797
122 Ga0070695_100816542 3300005545 Bacteria 748
123 Ga0070696_100011049 3300005546 Bacteria 6046
124 Ga0070696_100147814 3300005546 Bacteria 1722
125 Ga0070696_100192468 3300005546 Unclassified 1518
126 Ga0070696_100614592 3300005546 Bacteria 878
127 Ga0070696_100620041 3300005546 Bacteria 874
128 Ga0070693_100009028 3300005547 Bacteria 4948
129 Ga0070693_100016142 3300005547 Bacteria 3860
130 Ga0070704_100000277 3300005549 Bacteria 22523
131 Ga0070704_100030506 3300005549 Unclassified 3613
132 Ga0070704_100048862 3300005549 Bacteria 2963
133 Ga0070704_100099840 3300005549 Unclassified 2184
134 Ga0070704_100111317 3300005549 Bacteria 2084
135 Ga0070704_100128146 3300005549 Unclassified 1962
136 Ga0070704_100141993 3300005549 Bacteria 1876
137 Ga0070704_100165001 3300005549 Bacteria 1755
138 Ga0070704_100694595 3300005549 Bacteria 902
139 Ga0070704_100852637 3300005549 Unclassified 817
140 Ga0068855_100043047 3300005563 Bacteria 5350
141 Ga0070664_100012429 3300005564 Bacteria 6919
142 Ga0068857_100042870 3300005577 Bacteria 4014
143 Ga0068857_100077031 3300005577 Unclassified 2975
144 Ga0068857_100616828 3300005577 Bacteria 1026
145 Ga0068854_100008829 3300005578 Bacteria 6487
146 Ga0068854_101549749 3300005578 Bacteria 603
147 Ga0068856_100002323 3300005614 Bacteria 19588
148 Ga0070702_100036407 3300005615 Bacteria 2726
149 Ga0068859_100002005 3300005617 Bacteria 20777
150 Ga0068859_100395260 3300005617 Unclassified 1478
151 Ga0068859_100413888 3300005617 Unclassified 1444
152 Ga0068859_101488382 3300005617 Bacteria 747
153 Ga0068864_100008207 3300005618 Bacteria 8612
154 Ga0068866_10489557 3300005718 Unclassified 812
155 Ga0068861_100070513 3300005719 Bacteria 2706
156 Ga0068861_100705037 3300005719 Bacteria 938
157 Ga0068870_10000084 3300005840 Bacteria 30832
158 Ga0068870_10074345 3300005840 Bacteria 1862
159 Ga0068863_100049461 3300005841 Bacteria 3987
160 Ga0068863_100166033 3300005841 Unclassified 2117
161 Ga0068858_100141680 3300005842 Unclassified 2257
162 Ga0068858_100339579 3300005842 Bacteria 1437
163 Ga0068858_100570510 3300005842 Unclassified 1096
164 Ga0068860_100079448 3300005843 Bacteria 3119
165 Ga0068860_100132188 3300005843 Bacteria 2395
166 Ga0068860_100152598 3300005843 Bacteria 2225
167 Ga0068860_100343170 3300005843 Unclassified 1469
168 Ga0068860_100864182 3300005843 Unclassified 920
169 Ga0068862_100005058 3300005844 Bacteria 11094
170 Ga0068862_100021656 3300005844 Bacteria 5374
171 Ga0068862_100030811 3300005844 Bacteria 4522
172 Ga0068862_100072717 3300005844 Unclassified 2971
173 Ga0068862_100090911 3300005844 Bacteria 2658
174 Ga0081455_10000275 3300005937 Bacteria 68073
175 Ga0081540_1093062 3300005983 Bacteria 1321
176 Ga0081540_1173074 3300005983 Unclassified 819
177 Ga0081539_10000092 3300005985 Bacteria 208968
178 Ga0070716_100006866 3300006173 Bacteria 5581
179 Ga0070716_100751187 3300006173 Unclassified 750
180 Ga0070712_100126804 3300006175 Unclassified 1929
181 Ga0070712_100136429 3300006175 Bacteria 1866
182 Ga0075428_100000866 3300006844 Bacteria 31861
183 Ga0075428_100008670 3300006844 Bacteria 11276
184 Ga0075428_100009178 3300006844 Bacteria 10971
185 Ga0075428_100019119 3300006844 Bacteria 7576
186 Ga0075428_100033009 3300006844 Bacteria 5716
187 Ga0075428_100063721 3300006844 Bacteria 4036
188 Ga0075428_100466575 3300006844 Bacteria 1352
189 Ga0075428_100793064 3300006844 Bacteria 1007
190 Ga0075428_100872610 3300006844 Unclassified 955
191 Ga0075430_100031413 3300006846 Bacteria 4506
192 Ga0075430_100124942 3300006846 Bacteria 2144
193 Ga0075430_100139698 3300006846 Bacteria 2017
194 Ga0075430_100165427 3300006846 Bacteria 1841
195 Ga0075430_100203022 3300006846 Bacteria 1646
196 Ga0075430_100533737 3300006846 Unclassified 968
197 Ga0075431_100000679 3300006847 Bacteria 29116
198 Ga0075431_100002363 3300006847 Bacteria 18122
199 Ga0075431_100012958 3300006847 Bacteria 8417
200 Ga0075431_100017043 3300006847 Bacteria 7379
201 Ga0075431_100059102 3300006847 Bacteria 3957
202 Ga0075431_100161653 3300006847 Bacteria 2303
203 Ga0075431_100177407 3300006847 Unclassified 2188
204 Ga0075431_100345461 3300006847 Unclassified 1497
205 Ga0075431_100376048 3300006847 Bacteria 1425
206 Ga0075431_100445692 3300006847 Bacteria 1291
207 Ga0075431_100511878 3300006847 Bacteria 1190
208 Ga0075433_10000825 3300006852 Bacteria 21651
209 Ga0075433_10001196 3300006852 Bacteria 18893
210 Ga0075433_10001864 3300006852 Bacteria 15840
211 Ga0075433_10060084 3300006852 Bacteria 3327
212 Ga0075433_10080224 3300006852 Unclassified 2876
213 Ga0075433_10114955 3300006852 Bacteria 2388
214 Ga0075433_10122694 3300006852 Bacteria 2307
215 Ga0075433_10283572 3300006852 Unclassified 1467
216 Ga0075433_11275785 3300006852 Unclassified 637
217 Ga0075434_100001806 3300006871 Bacteria 18509
218 Ga0075434_100022833 3300006871 Bacteria 6090
219 Ga0075434_100031860 3300006871 Bacteria 5199
220 Ga0075434_100072055 3300006871 Bacteria 3447
221 Ga0075434_100117436 3300006871 Bacteria 2673
222 Ga0075434_100124330 3300006871 Bacteria 2596
223 Ga0075434_100175424 3300006871 Unclassified 2163
224 Ga0075434_100228431 3300006871 Bacteria 1880
225 Ga0075434_100263222 3300006871 Unclassified 1744
226 Ga0075434_100376413 3300006871 Bacteria 1441
227 Ga0075434_100385832 3300006871 Unclassified 1422
228 Ga0075434_100431820 3300006871 Unclassified 1338
229 Ga0075434_100579315 3300006871 Unclassified 1141
230 Ga0075434_100804032 3300006871 Unclassified 956
231 Ga0075429_100009002 3300006880 Bacteria 8672
232 Ga0075429_100016735 3300006880 Bacteria 6351
233 Ga0075429_100038550 3300006880 Unclassified 4160
234 Ga0075429_100040742 3300006880 Bacteria 4044
235 Ga0075429_100061543 3300006880 Bacteria 3270
236 Ga0075429_100453149 3300006880 Unclassified 1124
237 Ga0068865_100974846 3300006881 Bacteria 741
238 Ga0075436_100000822 3300006914 Bacteria 20664
239 Ga0075436_100025292 3300006914 Bacteria 4085
240 Ga0075436_100110475 3300006914 Unclassified 1919
241 Ga0075436_100161371 3300006914 Viruses 1580
242 Ga0075436_100165609 3300006914 Bacteria 1559
243 Ga0097620_100002005 3300006931 Bacteria 20777
244 Ga0097620_100395241 3300006931 Unclassified 1478
245 Ga0097620_100413859 3300006931 Unclassified 1444
246 Ga0097620_101488128 3300006931 Bacteria 747
247 Ga0075435_100003611 3300007076 Bacteria 10523
248 Ga0075435_100010923 3300007076 Bacteria 6654
249 Ga0075435_100056718 3300007076 Bacteria 3167
250 Ga0075435_100109696 3300007076 Unclassified 2294
251 Ga0075435_100115764 3300007076 Unclassified 2232
252 Ga0075435_100332610 3300007076 Bacteria 1301
253 Ga0099794_10004336 3300007265 Bacteria 5555
254 Ga0099794_10007668 3300007265 Bacteria 4445
255 Ga0099794_10056188 3300007265 Bacteria 1904
256 Ga0099794_10642955 3300007265 Unclassified 563
257 Ga0111539_10000238 3300009094 Bacteria 65613
258 Ga0111539_10011454 3300009094 Bacteria 11133
259 Ga0111539_10029172 3300009094 Bacteria 6725
260 Ga0111539_10238902 3300009094 Unclassified 2115
261 Ga0111539_10569511 3300009094 Unclassified 1319
262 Ga0111539_11299392 3300009094 Bacteria 844
263 Ga0114129_10000026 3300009147 Bacteria 113517
264 Ga0114129_10000123 3300009147 Bacteria 78131
265 Ga0114129_10000605 3300009147 Bacteria 44376
266 Ga0114129_10015880 3300009147 Bacteria 10708
267 Ga0114129_10019333 3300009147 Bacteria 9701
268 Ga0114129_10027698 3300009147 Bacteria 8023
269 Ga0114129_10033595 3300009147 Bacteria 7248
270 Ga0114129_10052052 3300009147 Bacteria 5747
271 Ga0114129_10061840 3300009147 Bacteria 5233
272 Ga0114129_10064740 3300009147 Bacteria 5102
273 Ga0114129_10096220 3300009147 Bacteria 4099
274 Ga0114129_10182323 3300009147 Unclassified 2856
275 Ga0114129_10215063 3300009147 Bacteria 2596
276 Ga0114129_10337103 3300009147 Bacteria 2001
277 Ga0114129_10459569 3300009147 Bacteria 1668
278 Ga0114129_10479599 3300009147 Unclassified 1627
279 Ga0114129_10585218 3300009147 Unclassified 1448
280 Ga0114129_10730554 3300009147 Bacteria 1269
281 Ga0114129_11124752 3300009147 Bacteria 982
282 Ga0114129_12484139 3300009147 Unclassified 620
283 Ga0105243_10039386 3300009148 Bacteria 3683
284 Ga0105243_10312859 3300009148 Bacteria 1428
285 Ga0105241_10000570 3300009174 Bacteria 27713
286 Ga0105242_10074866 3300009176 Bacteria 2818
287 Ga0105242_11067662 3300009176 Unclassified 819
288 Ga0105248_10128725 3300009177 Bacteria 2856
289 Ga0105237_10085568 3300009545 Bacteria 3142
290 Ga0105249_10036088 3300009553 Bacteria 4484
291 Ga0105249_10134737 3300009553 Bacteria 2362
292 Ga0105249_11026973 3300009553 Bacteria 894
293 Ga0105249_11835325 3300009553 Unclassified 679
294 Ga0105249_12062601 3300009553 Bacteria 643
295 Ga0105239_10217701 3300010375 Bacteria 2141
296 Ga0105246_10070435 3300011119 Bacteria 2460
297 Ga0157373_10005215 3300013100 Bacteria 9763
298 Ga0157370_10067579 3300013104 Bacteria 3378
299 Ga0157378_10167484 3300013297 Unclassified 2059
300 Ga0163162_10077184 3300013306 Unclassified 3394
301 Ga0163162_10516634 3300013306 Bacteria 1324
302 Ga0163162_10714754 3300013306 Bacteria 1123
303 Ga0157372_10016574 3300013307 Bacteria 7907
304 Ga0157375_10657864 3300013308 Bacteria 1204
305 Ga0163163_10032287 3300014325 Bacteria 5056
306 Ga0157380_10363991 3300014326 Bacteria 1358
307 Ga0157380_10445990 3300014326 Unclassified 1241
308 Ga0157377_10223324 3300014745 Unclassified 1207
309 Ga0182007_10031130 3300015262 Bacteria 1820
310 Ga0207653_10020578 3300025885 Bacteria 2089
311 Ga0207653_10024233 3300025885 Bacteria 1936
312 Ga0207653_10136241 3300025885 Bacteria 895
313 Ga0207642_10227492 3300025899 Unclassified 1046
314 Ga0207688_10019849 3300025901 Bacteria 3664
315 Ga0207647_10103243 3300025904 Bacteria 1690
316 Ga0207699_10066767 3300025906 Bacteria 2185
317 Ga0207645_10000796 3300025907 Bacteria 26432
318 Ga0207645_10423331 3300025907 Unclassified 897
319 Ga0207643_10000190 3300025908 Bacteria 42348
320 Ga0207643_10094492 3300025908 Bacteria 1747
321 Ga0207684_10000468 3300025910 Bacteria 52461
322 Ga0207684_10003352 3300025910 Bacteria 15705
323 Ga0207684_10039774 3300025910 Bacteria 3986
324 Ga0207684_10067966 3300025910 Bacteria 3029
325 Ga0207684_10106974 3300025910 Unclassified 2393
326 Ga0207684_10231780 3300025910 Unclassified 1593
327 Ga0207684_10242223 3300025910 Bacteria 1556
328 Ga0207684_10284735 3300025910 Unclassified 1425
329 Ga0207684_10290677 3300025910 Bacteria 1409
330 Ga0207684_10324749 3300025910 Unclassified 1326
331 Ga0207684_10418454 3300025910 Bacteria 1151
332 Ga0207684_10706353 3300025910 Bacteria 856
333 Ga0207684_10886577 3300025910 Unclassified 751
334 Ga0207654_10004022 3300025911 Bacteria 7400
335 Ga0207707_10000579 3300025912 Bacteria 37210
336 Ga0207693_10032191 3300025915 Bacteria 4140
337 Ga0207663_10037028 3300025916 Bacteria 2939
338 Ga0207660_10002743 3300025917 Bacteria 11534
339 Ga0207660_10675730 3300025917 Bacteria 842
340 Ga0207657_10000212 3300025919 Bacteria 60365
341 Ga0207649_10001553 3300025920 Bacteria 13451
342 Ga0207652_10017812 3300025921 Bacteria 5819
343 Ga0207646_10000497 3300025922 Bacteria 52656
344 Ga0207646_10005111 3300025922 Bacteria 13919
345 Ga0207646_10007193 3300025922 Bacteria 11361
346 Ga0207646_10014048 3300025922 Bacteria 7617
347 Ga0207646_10260332 3300025922 Bacteria 1568
348 Ga0207646_10372280 3300025922 Bacteria 1290
349 Ga0207646_10387045 3300025922 Bacteria 1263
350 Ga0207646_10413404 3300025922 Bacteria 1218
351 Ga0207646_10455464 3300025922 Unclassified 1154
352 Ga0207681_10111443 3300025923 Bacteria 1991
353 Ga0207650_10020305 3300025925 Bacteria 4683
354 Ga0207687_10525897 3300025927 Bacteria 990
355 Ga0207687_10730325 3300025927 Unclassified 842
356 Ga0207644_10147999 3300025931 Bacteria 1815
357 Ga0207690_10000963 3300025932 Bacteria 18395
358 Ga0207706_10038901 3300025933 Bacteria 4218
359 Ga0207706_10085796 3300025933 Bacteria 2768
360 Ga0207706_10190660 3300025933 Bacteria 1799
361 Ga0207709_10033307 3300025935 Bacteria 3024
362 Ga0207709_10781061 3300025935 Bacteria 770
363 Ga0207665_10002311 3300025939 Bacteria 12868
364 Ga0207691_10076791 3300025940 Bacteria 3010
365 Ga0207711_10385768 3300025941 Unclassified 1300
366 Ga0207711_10625556 3300025941 Bacteria 1004
367 Ga0207689_10000122 3300025942 Bacteria 64915
368 Ga0207689_10123875 3300025942 Bacteria 2126
369 Ga0207679_10018583 3300025945 Bacteria 4659
370 Ga0207667_10004750 3300025949 Bacteria 16616
371 Ga0207712_10338975 3300025961 Unclassified 1246
372 Ga0207640_10013138 3300025981 Bacteria 4737
373 Ga0207640_10603696 3300025981 Bacteria 929
374 Ga0207640_10620026 3300025981 Unclassified 918
375 Ga0207677_11372604 3300026023 Unclassified 650
376 Ga0207703_10656321 3300026035 Bacteria 995
377 Ga0207639_10012840 3300026041 Bacteria 5844
378 Ga0207678_10063700 3300026067 Bacteria 3168
379 Ga0207708_10027350 3300026075 Bacteria 4317
380 Ga0207708_10388866 3300026075 Bacteria 1151
381 Ga0207702_10013693 3300026078 Bacteria 6736
382 Ga0207641_10302001 3300026088 Unclassified 1512
383 Ga0207641_10338226 3300026088 Bacteria 1432
384 Ga0207641_10659504 3300026088 Unclassified 1028
385 Ga0207648_10015590 3300026089 Bacteria 6983
386 Ga0207648_10079484 3300026089 Bacteria 2861
387 Ga0207676_10061260 3300026095 Bacteria 2978
388 Ga0207676_11103301 3300026095 Bacteria 784
389 Ga0207674_10003859 3300026116 Bacteria 18264
390 Ga0207674_10012454 3300026116 Bacteria 9504
391 Ga0207674_10121642 3300026116 Bacteria 2577
392 Ga0207675_100103379 3300026118 Bacteria 2685
393 Ga0209970_1004566 3300027614 Bacteria 2295
394 Ga0209983_1002617 3300027665 Bacteria 3915
395 Ga0209588_1007603 3300027671 Bacteria 3193
396 Ga0209971_1000023 3300027682 Bacteria 56858
397 Ga0209971_1007837 3300027682 Bacteria 2533
398 Ga0209998_10000214 3300027717 Bacteria 20068
399 Ga0209974_10024658 3300027876 Bacteria 1990
400 Ga0207428_10000054 3300027907 Bacteria 175237
401 Ga0207428_10007975 3300027907 Bacteria 9612
402 Ga0207428_10023551 3300027907 Bacteria 5177
403 Ga0207428_10136240 3300027907 Unclassified 1877
404 Ga0268265_10005400 3300028380 Bacteria 8749
405 Ga0268265_10009518 3300028380 Bacteria 6562
406 Ga0268265_10014959 3300028380 Bacteria 5299
407 Ga0268265_10024043 3300028380 Bacteria 4304
408 Ga0268265_10049093 3300028380 Bacteria 3172
409 Ga0268265_11482274 3300028380 Unclassified 682
410 Ga0268264_10061388 3300028381 Bacteria 3153
411 Ga0268264_10064116 3300028381 Bacteria 3091
412 Ga0268264_10072351 3300028381 Bacteria 2924
413 Ga0268264_10104388 3300028381 Bacteria 2470
414 Ga0307408_100085113 3300031548 Bacteria 2373
415 Ga0307408_100220768 3300031548 Bacteria 1546
416 Ga0307408_100316985 3300031548 Bacteria 1312
417 Ga0307408_100550195 3300031548 Bacteria 1018
418 Ga0307405_10160702 3300031731 Unclassified 1591
419 Ga0307405_10991456 3300031731 Bacteria 716
420 Ga0307410_10187081 3300031852 Bacteria 1572
421 Ga0307407_10081583 3300031903 Bacteria 1958
422 Ga0307412_10167704 3300031911 Unclassified 1639
423 Ga0307409_100858597 3300031995 Unclassified 919
424 Ga0307416_100116710 3300032002 Bacteria 2367
425 Ga0307416_100543990 3300032002 Unclassified 1233
426 Ga0307416_100595750 3300032002 Unclassified 1184
427 Ga0307415_100099139 3300032126 Unclassified 2132
428 Ga0373948_0007951 3300034817 Bacteria 1796
429 Ga0373948_0045980 3300034817 Bacteria 926
430 Ga0373948_0060088 3300034817 Unclassified 833
431 Ga0373959_0004587 3300034820 Bacteria 2232
432 Ga0373928_0013196 3300035084 Unclassified 1657
433 Ga0373940_0006139 3300035088 Unclassified 2646
434 Ga0373949_0088002 3300035090 Bacteria 836
435 Ga0373951_0009247 3300035091 Bacteria 2220
436 Ga0373951_0058119 3300035091 Bacteria 964
437 Ga0373932_0033499 3300035112 Bacteria 1443
438 Ga0373932_0075501 3300035112 Unclassified 1054
439 Ga0373932_0119041 3300035112 Bacteria 879
440 Ga0373939_0028736 3300035114 Unclassified 1585
441 Ga0373941_0026641 3300035115 Bacteria 1680
442 Ga0373960_0193828 3300035121 Bacteria 715
443 Ga0373961_0015719 3300035241 Bacteria 1939
444 Ga0373961_0394557 3300035241 Unclassified 530
445 Ga0373962_0072300 3300035242 Unclassified 1033
446 Ga0373962_0212002 3300035242 Bacteria 659
447 Ga0395900_0310591 3300037418 Bacteria 1560
448 Ga0395905_0762746 3300037471 Bacteria 870
449 Ga0395901_0422302 3300038443 Unclassified 1367
450 Ga0242420_014342 3300038996 Unclassified 1359
451 Ga0439441_014575 3300042001 Bacteria 1380
452 Ga0439448_0022429 3300042005 Bacteria 1962
453 Ga0439460_0004709 3300042461 Bacteria 3327
454 Ga0451577_0002471 3300042876 Bacteria 21982
455 Ga0451577_0004587 3300042876 Bacteria 14516
456 Ga0451577_0046808 3300042876 Bacteria 3868
457 Ga0451577_0188772 3300042876 Bacteria 1859
458 Ga0453683_0020442 3300044673 Bacteria 4231
459 Ga0453683_0074469 3300044673 Bacteria 2126
460 Ga0453683_0214041 3300044673 Bacteria 1224
461 Ga0453684_0005153 3300044712 Bacteria 26296
462 Ga0453684_0128158 3300044712 Bacteria 3050
463 Ga0453684_1763767 3300044712 Unclassified 630
464 Ga0451576_0008153 3300045051 Bacteria 12333
465 Ga0451576_0053473 3300045051 Bacteria 4230
466 Ga0451576_0073598 3300045051 Unclassified 3555
467 Ga0451576_0218935 3300045051 Bacteria 1988
468 Ga0451576_0294614 3300045051 Unclassified 1696
469 Ga0451576_0436315 3300045051 Bacteria 1374
470 Ga0451576_0565736 3300045051 Unclassified 1194
471 Ga0451576_0814317 3300045051 Bacteria 980
472 Ga0495580_0053708 3300046472 Unclassified 2842
473 Ga0495580_0070815 3300046472 Bacteria 2436
474 Ga0495580_0358565 3300046472 Bacteria 987
475 Ga0495584_0055616 3300046491 Unclassified 1991
476 Ga0495584_0650786 3300046491 Archaea 537
477 Ga0495669_0111370 3300046684 Unclassified 1278
478 Ga0495636_0049185 3300047318 Bacteria 1763
479 Ga0495636_0486669 3300047318 Unclassified 595
480 Ga0496106_0108132 3300048909 Bacteria 2163
481 Ga0496107_0439805 3300048910 Bacteria 969
482 Ga0496110_0433509 3300048913 Bacteria 1198
483 Ga0496113_0618948 3300048916 Unclassified 867
484 Ga0501297_060631 3300049520 Bacteria 577
485 Ga0501299_084187 3300049522 Unclassified 712
486 Ga0501031_0334693 3300049568 Unclassified 980
487 Ga0501031_0363983 3300049568 Bacteria 936
488 Ga0501031_0420255 3300049568 Bacteria 864
489 Ga0501031_0499114 3300049568 Unclassified 785
490 Ga0501032_0182848 3300049569 Bacteria 1372
491 Ga0501033_0120993 3300049570 Unclassified 1900
492 Ga0501033_0877285 3300049570 Unclassified 604
493 Ga0501034_1245740 3300049571 Unclassified 622
494 Ga0501036_0219394 3300049572 Bacteria 1597
495 Ga0501036_0329524 3300049572 Unclassified 1275
496 Ga0501036_0786462 3300049572 Bacteria 784
497 Ga0501038_0133865 3300049574 Unclassified 2032
498 Ga0501038_0215067 3300049574 Bacteria 1536
499 Ga0501038_0970992 3300049574 Unclassified 625
500 Ga0501039_0005513 3300049575 Bacteria 9572
501 Ga0501039_0022073 3300049575 Bacteria 4885
502 Ga0501039_0027775 3300049575 Bacteria 4352
503 Ga0501039_0378538 3300049575 Bacteria 1112
504 Ga0501039_0478498 3300049575 Bacteria 978
505 Ga0501040_0006460 3300049576 Bacteria 7611
506 Ga0501040_0027102 3300049576 Bacteria 3857
507 Ga0501040_0115149 3300049576 Unclassified 1882
508 Ga0501040_0204332 3300049576 Bacteria 1403
509 Ga0501040_0280917 3300049576 Bacteria 1189
510 Ga0501040_0316760 3300049576 Bacteria 1115
511 Ga0501040_0914870 3300049576 Unclassified 635
512 Ga0501041_0004325 3300049577 Bacteria 8210
513 Ga0501041_0006139 3300049577 Bacteria 7021
514 Ga0501041_0105630 3300049577 Unclassified 1745
515 Ga0501041_0296622 3300049577 Bacteria 1018
516 Ga0501041_0394672 3300049577 Unclassified 876
517 Ga0501041_0413913 3300049577 Unclassified 854
518 Ga0501041_1055317 3300049577 Unclassified 523
519 Ga0501042_0081883 3300049578 Bacteria 2314
520 Ga0501042_0292232 3300049578 Unclassified 1177
521 Ga0501042_0303033 3300049578 Unclassified 1154
522 Ga0501042_0515086 3300049578 Bacteria 869
523 Ga0501043_0196469 3300049579 Unclassified 1567
524 Ga0501043_0292231 3300049579 Bacteria 1247
525 Ga0501046_0011306 3300049580 Bacteria 7639
526 Ga0501046_0039763 3300049580 Bacteria 3763
527 Ga0501046_0112094 3300049580 Bacteria 2083
528 Ga0501046_0240067 3300049580 Bacteria 1336
529 Ga0501046_0830489 3300049580 Unclassified 647
530 Ga0501047_0022256 3300049581 Bacteria 6089
531 Ga0501048_0026670 3300049582 Bacteria 4205
532 Ga0501048_0115038 3300049582 Bacteria 1900
533 Ga0501048_0162529 3300049582 Bacteria 1581
534 Ga0501067_0003389 3300049583 Bacteria 8767
535 Ga0501067_0322053 3300049583 Bacteria 861
536 Ga0501068_0015534 3300049584 Bacteria 4374
537 Ga0501068_0156769 3300049584 Bacteria 1434
538 Ga0501068_0674153 3300049584 Unclassified 676
539 Ga0501068_0679991 3300049584 Unclassified 672
540 Ga0501069_0006253 3300049585 Bacteria 6225
541 Ga0501069_0258527 3300049585 Unclassified 1016
542 Ga0501070_0711371 3300049586 Unclassified 794
543 Ga0501071_0119476 3300049587 Bacteria 1953
544 Ga0501071_0238396 3300049587 Unclassified 1371
545 Ga0501071_0261313 3300049587 Bacteria 1308
546 Ga0501071_0267818 3300049587 Bacteria 1291
547 Ga0501072_0008156 3300049588 Bacteria 7949
548 Ga0501072_0013994 3300049588 Bacteria 6148
549 Ga0501072_0089071 3300049588 Bacteria 2449
550 Ga0501072_0145348 3300049588 Bacteria 1891
551 Ga0501072_0153601 3300049588 Unclassified 1835
552 Ga0501072_0257836 3300049588 Unclassified 1388
553 Ga0501072_0376812 3300049588 Bacteria 1126
554 Ga0501072_1229878 3300049588 Bacteria 581
555 Ga0501074_0005416 3300049590 Bacteria 9182
556 Ga0501074_0139706 3300049590 Bacteria 1733
557 Ga0501074_0205998 3300049590 Unclassified 1401
558 Ga0501074_0401623 3300049590 Bacteria 972
559 Ga0501075_0005738 3300049591 Bacteria 8496
560 Ga0501075_0028650 3300049591 Bacteria 4111
561 Ga0501075_0043969 3300049591 Bacteria 3351
562 Ga0501075_0113990 3300049591 Unclassified 2055
563 Ga0501075_0203006 3300049591 Unclassified 1512
564 Ga0501075_0360034 3300049591 Bacteria 1109
565 Ga0501075_0442212 3300049591 Bacteria 991
566 Ga0501075_0706384 3300049591 Unclassified 768
567 Ga0501075_0918204 3300049591 Unclassified 665
568 Ga0501076_0005952 3300049592 Bacteria 8808
569 Ga0501076_0012366 3300049592 Bacteria 6381
570 Ga0501076_0023957 3300049592 Bacteria 4711
571 Ga0501076_0042767 3300049592 Bacteria 3568
572 Ga0501076_0418304 3300049592 Unclassified 1103
573 Ga0501076_0441899 3300049592 Bacteria 1071
574 Ga0501076_1369508 3300049592 Unclassified 581
575 Ga0501076_1396614 3300049592 Archaea 575
576 Ga0501077_0005778 3300049593 Bacteria 7535
577 Ga0501077_0050043 3300049593 Bacteria 2656
578 Ga0501077_0099744 3300049593 Bacteria 1840
579 Ga0501077_0180349 3300049593 Bacteria 1342
580 Ga0501077_0231466 3300049593 Unclassified 1174
581 Ga0501198_120304 3300049649 Bacteria 552
582 Ga0501219_004276 3300049703 Bacteria 1017
583 Ga0501079_0003821 3300049741 Bacteria 11131
584 Ga0501079_0017446 3300049741 Bacteria 5482
585 Ga0501079_0029254 3300049741 Bacteria 4229
586 Ga0501079_0050401 3300049741 Bacteria 3214
587 Ga0501079_0111995 3300049741 Bacteria 2121
588 Ga0501079_0183664 3300049741 Bacteria 1632
589 Ga0501079_0276572 3300049741 Unclassified 1313
590 Ga0501079_0283938 3300049741 Bacteria 1294
591 Ga0501079_0326789 3300049741 Bacteria 1201
592 Ga0501080_0113850 3300049742 Bacteria 2508
593 Ga0501080_0452854 3300049742 Unclassified 1150
594 Ga0501080_0467057 3300049742 Bacteria 1130
595 Ga0501081_0005537 3300049743 Bacteria 8150
596 Ga0501081_0006788 3300049743 Bacteria 7444
597 Ga0501081_0049660 3300049743 Unclassified 2889
598 Ga0501081_0077526 3300049743 Bacteria 2323
599 Ga0501081_0114223 3300049743 Bacteria 1918
600 Ga0501081_0497234 3300049743 Bacteria 908
601 Ga0501083_0514821 3300049744 Unclassified 779
602 Ga0501035_0132399 3300049822 Unclassified 2173
603 Ga0501035_0156277 3300049822 Bacteria 1977
604 Ga0501035_0431149 3300049822 Bacteria 1093
605 Ga0501035_1480726 3300049822 Bacteria 518
606 Ga0501044_0366593 3300049823 Unclassified 1358
607 Ga0501045_0000613 3300049824 Bacteria 22528
608 Ga0501045_0029396 3300049824 Bacteria 3972
609 Ga0501045_0095831 3300049824 Bacteria 2195
610 Ga0501045_0139982 3300049824 Bacteria 1799
611 Ga0501045_0168788 3300049824 Bacteria 1630
612 Ga0501045_0193626 3300049824 Bacteria 1515
613 Ga0501045_0512376 3300049824 Unclassified 891
614 Ga0501045_0692191 3300049824 Bacteria 752
615 nmdc:mga05p37_107326_c2 3300050507 Unclassified 1367
616 nmdc:mga05p37_131595_c1 3300050507 Bacteria 3070
617 nmdc:mga05p37_146389_c1 3300050507 Bacteria 2892
618 nmdc:mga05p37_158524_c1 3300050507 Bacteria 2765
619 nmdc:mga05p37_1587_c1 3300050507 Bacteria 26397
620 nmdc:mga05p37_197023_c1 3300050507 Unclassified 2442
621 nmdc:mga05p37_321_c1 3300050507 Bacteria 51084
622 nmdc:mga05p37_331085_c1 3300050507 Unclassified 1497
623 nmdc:mga05p37_411400_c1 3300050507 Bacteria 1577
624 nmdc:mga05p37_718_c1 3300050507 Bacteria 36658
625 nmdc:mga05p37_852799_c1 3300050507 Bacteria 989
626 nmdc:mga05p37_87373_c1 3300050507 Bacteria 3842
627 nmdc:mga05p37_88069_c1 3300050507 Bacteria 3827
628 nmdc:mga05p37_8962_c1 3300050507 Bacteria 11833
629 nmdc:mga09592_140355_c1 3300050508 Unclassified 2082
630 nmdc:mga09592_18833_c1 3300050508 Bacteria 5664
631 nmdc:mga09592_21539_c1 3300050508 Bacteria 5313
632 nmdc:mga09592_22208_c1 3300050508 Bacteria 5236
633 nmdc:mga09592_47828_c1 3300050508 Bacteria 3606
634 nmdc:mga09592_6245_c1 3300050508 Bacteria 9703
635 nmdc:mga09592_686632_c1 3300050508 Unclassified 872
636 nmdc:mga09592_85461_c1 3300050508 Bacteria 2691
637 nmdc:mga0qj67_163659_c1 3300050509 Bacteria 1806
638 nmdc:mga0qj67_16535_c2 3300050509 Bacteria 5088
639 nmdc:mga0qj67_177790_c1 3300050509 Bacteria 1728
640 nmdc:mga0qj67_18413_c1 3300050509 Bacteria 5322
641 nmdc:mga0qj67_3491_c1 3300050509 Bacteria 11328
642 nmdc:mga0qj67_715905_c1 3300050509 Unclassified 796
643 nmdc:mga06r32_152111_c1 3300050510 Bacteria 2293
644 nmdc:mga06r32_160187_c1 3300050510 Unclassified 2233
645 nmdc:mga06r32_175439_c1 3300050510 Bacteria 2127
646 nmdc:mga06r32_17819_c1 3300050510 Bacteria 6490
647 nmdc:mga06r32_29129_c1 3300050510 Bacteria 5172
648 nmdc:mga06r32_341856_c1 3300050510 Unclassified 1481
649 nmdc:mga06r32_531247_c1 3300050510 Bacteria 1151
650 nmdc:mga06r32_5489_c1 3300050510 Bacteria 11417
651 nmdc:mga06r32_641902_c1 3300050510 Bacteria 1030
652 nmdc:mga06r32_87034_c1 3300050510 Bacteria 3048
653 nmdc:mga06r32_95446_c1 3300050510 Bacteria 2911
654 nmdc:mga08y16_12103_c1 3300050511 Bacteria 9066
655 nmdc:mga08y16_24679_c1 3300050511 Bacteria 6345
656 nmdc:mga08y16_2555_c1 3300050511 Bacteria 18717
657 nmdc:mga08y16_483820_c1 3300050511 Unclassified 1259
658 nmdc:mga0n895_1016464_c1 3300050512 Unclassified 810
659 nmdc:mga0n895_118551_c1 3300050512 Unclassified 2667
660 nmdc:mga0n895_158319_c1 3300050512 Bacteria 2296
661 nmdc:mga0n895_174626_c1 3300050512 Unclassified 2180
662 nmdc:mga0n895_19324_c1 3300050512 Bacteria 6331
663 nmdc:mga0n895_2206_c1 3300050512 Bacteria 15063
664 nmdc:mga0n895_39320_c1 3300050512 Bacteria 4590
665 nmdc:mga0n895_456803_c1 3300050512 Unclassified 1289
666 nmdc:mga0n895_498729_c1 3300050512 Unclassified 1227
667 nmdc:mga0n895_66299_c1 3300050512 Bacteria 3575
668 nmdc:mga0n895_750781_c1 3300050512 Unclassified 969
669 nmdc:mga0n895_808305_c1 3300050512 Unclassified 928
670 nmdc:mga0rr50_1023502_c1 3300050513 Unclassified 703
671 nmdc:mga0rr50_112111_c1 3300050513 Unclassified 2160
672 nmdc:mga0rr50_122745_c1 3300050513 Bacteria 2070
673 nmdc:mga0rr50_163955_c1 3300050513 Unclassified 1806
674 nmdc:mga0rr50_171934_c1 3300050513 Bacteria 1766
675 nmdc:mga0rr50_242682_c1 3300050513 Unclassified 1494
676 nmdc:mga0rr50_41253_c1 3300050513 Viruses 3362
677 nmdc:mga0rr50_55943_c1 3300050513 Bacteria 2946
678 nmdc:mga0rr50_80064_c1 3300050513 Unclassified 2518
679 nmdc:mga0rr50_818141_c1 3300050513 Bacteria 795
680 nmdc:mga0rr50_932_c1 3300050513 Bacteria 15818
681 nmdc:mga0rr50_9457_c1 3300050513 Bacteria 6129
682 nmdc:mga08x19_12254_c1 3300050514 Bacteria 5162
683 nmdc:mga08x19_1275_c1 3300050514 Bacteria 15628
684 nmdc:mga08x19_304694_c1 3300050514 Bacteria 1107
685 nmdc:mga08x19_48583_c1 3300050514 Unclassified 2719
686 nmdc:mga08x19_63756_c1 3300050514 Unclassified 2391
687 nmdc:mga0a205_13782_c1 3300050515 Bacteria 7537
688 nmdc:mga0a205_1806_c1 3300050515 Bacteria 18502
689 nmdc:mga0a205_206980_c1 3300050515 Bacteria 1851
690 nmdc:mga0a205_26562_c1 3300050515 Bacteria 5523
691 nmdc:mga0a205_28508_c1 3300050515 Bacteria 5340
692 nmdc:mga0a205_289396_c1 3300050515 Bacteria 1513
693 nmdc:mga0a205_29536_c1 3300050515 Bacteria 5247
694 nmdc:mga0a205_33668_c1 3300050515 Bacteria 4913
695 nmdc:mga0a205_41982_c1 3300050515 Unclassified 4407
696 nmdc:mga0a205_484418_c1 3300050515 Bacteria 1095
697 nmdc:mga0a205_58074_c1 3300050515 Unclassified 3737
698 nmdc:mga0a205_92492_c1 3300050515 Unclassified 2922
699 Ga0501084_0005434 3300054114 Bacteria 10450
700 Ga0501084_0006439 3300054114 Bacteria 9650
701 Ga0501084_0016588 3300054114 Bacteria 6116
702 Ga0501084_0025100 3300054114 Bacteria 4972
703 Ga0501084_0131498 3300054114 Bacteria 2107
704 Ga0501084_0321853 3300054114 Unclassified 1306
705 Ga0501084_0666181 3300054114 Bacteria 878
706 Ga0501084_0924501 3300054114 Unclassified 733
707 Ga0590074_092839 3300059423 Unclassified 584
708 Ga0501082_0000132 3300060353 Bacteria 61079
709 Ga0501082_0011019 3300060353 Bacteria 7775
710 Ga0501082_0018400 3300060353 Bacteria 6017
711 Ga0501082_0068023 3300060353 Bacteria 3067
712 Ga0501082_0113399 3300060353 Unclassified 2347
713 Ga0530510_0005457 3300061734 Bacteria 8801
714 Ga0530510_0058736 3300061734 Unclassified 2781
715 Ga0530510_0072308 3300061734 Bacteria 2503
716 Ga0530510_0091866 3300061734 Bacteria 2215
717 Ga0530510_0402257 3300061734 Unclassified 1032
718 Ga0530510_0402807 3300061734 Bacteria 1031
719 Ga0530510_0417175 3300061734 Bacteria 1013
720 Ga0070708_100840575
721 Ga0070676_10199710
722 Ga0070670_100004773
723 Ga0068869_100001420
724 Ga0068869_100019732
725 Ga0070666_10146655
726 Ga0070680_100011269
727 Ga0070680_100042681
728 Ga0070680_100516364
729 Ga0070682_100001024
730 Ga0068868_101421557
731 Ga0070660_100088242
732 Ga0070689_100158000
733 Ga0070691_10006183
734 Ga0070691_10013868
735 Ga0070691_10106124
736 Ga0070687_100041377
737 Ga0070661_100000569
738 Ga0070668_101344838
739 Ga0070669_100087569
740 Ga0070669_100217940
741 Ga0070669_100245781
742 Ga0070669_100527803
743 Ga0070675_100488187
744 Ga0070688_100132020
745 Ga0070659_100001060
746 Ga0070667_100103002
747 Ga0070703_10001586
748 Ga0070703_10006867
749 Ga0070701_10795383
750 Ga0070711_100028539
751 Ga0070705_100001398
752 Ga0070705_100013695
753 Ga0070705_100018913
754 Ga0070705_100042575
755 Ga0070705_100189995
756 Ga0070705_100248388
757 Ga0070705_100491844
758 Ga0070705_100666830
759 Ga0070700_100574055
760 Ga0070700_100867396
761 Ga0070694_100000661
762 Ga0070694_100002832
763 Ga0070694_100061322
764 Ga0070694_100153340
765 Ga0070694_100260806
766 Ga0070694_100326674
767 Ga0070694_100403538
768 Ga0070694_100633064
769 Ga0070708_100000550
770 Ga0070708_100012907
771 Ga0070708_100013311
772 Ga0070708_100017124
773 Ga0070708_100032223
774 Ga0070708_100042220
775 Ga0070708_100116735
776 Ga0070708_100131560
777 Ga0070708_100226052
778 Ga0070708_100247318
779 Ga0070708_100345359
780 Ga0070708_100808990
781 Ga0070663_100196761
782 Ga0070662_100071908
783 Ga0070662_100188872
784 Ga0070662_100484474
785 Ga0070681_10065173
786 Ga0068867_100002280
787 Ga0068867_100177291
788 Ga0070706_100003907
789 Ga0070706_100074668
790 Ga0070706_100084370
791 Ga0070706_100195498
792 Ga0070706_100265375
793 Ga0070707_100002748
794 Ga0070707_100004066
795 Ga0070707_100012641
796 Ga0070707_100020697
797 Ga0070707_100021414
798 Ga0070707_100078852
799 Ga0070707_100124514
800 Ga0070707_100365010
801 Ga0070707_100401141
802 Ga0070707_100548287
803 Ga0070707_100581284
804 Ga0070707_100639518
805 Ga0070698_100002741
806 Ga0070698_100004610
807 Ga0070698_100006046
808 Ga0070698_100307380
809 Ga0070698_100564841
810 Ga0070698_100647995
811 Ga0070698_101229437
812 Ga0070698_101323114
813 Ga0070699_100001007
814 Ga0070699_100027404
815 Ga0070699_100028690
816 Ga0070699_100029730
817 Ga0070699_100053143
818 Ga0070699_100054565
819 Ga0070699_100060554
820 Ga0070699_100082338
821 Ga0070699_100156743
822 Ga0070699_100183729
823 Ga0070679_100000659
824 Ga0070684_100130099
825 Ga0070697_100001230
826 Ga0070697_100006613
827 Ga0070697_100028490
828 Ga0070697_100139974
829 Ga0070697_100189889
830 Ga0070697_100222348
831 Ga0070697_100251227
832 Ga0070697_100565599
833 Ga0068853_100009727
834 Ga0070672_100064206
835 Ga0070686_100455334
836 Ga0070695_100001860
837 Ga0070695_100004997
838 Ga0070695_100023118
839 Ga0070695_100130942
840 Ga0070695_100712425
841 Ga0070695_100816542
842 Ga0070696_100011049
843 Ga0070696_100147814
844 Ga0070696_100192468
845 Ga0070696_100614592
846 Ga0070696_100620041
847 Ga0070693_100009028
848 Ga0070693_100016142
849 Ga0070704_100000277
850 Ga0070704_100030506
851 Ga0070704_100048862
852 Ga0070704_100099840
853 Ga0070704_100111317
854 Ga0070704_100128146
855 Ga0070704_100141993
856 Ga0070704_100165001
857 Ga0070704_100694595
858 Ga0070704_100852637
859 Ga0068855_100043047
860 Ga0070664_100012429
861 Ga0068857_100042870
862 Ga0068857_100077031
863 Ga0068857_100616828
864 Ga0068854_100008829
865 Ga0068854_101549749
866 Ga0068856_100002323
867 Ga0070702_100036407
868 Ga0068859_100002005
869 Ga0068859_100395260
870 Ga0068859_100413888
871 Ga0068859_101488382
872 Ga0068864_100008207
873 Ga0068866_10489557
874 Ga0068861_100070513
875 Ga0068861_100705037
876 Ga0068870_10000084
877 Ga0068870_10074345
878 Ga0068863_100049461
879 Ga0068863_100166033
880 Ga0068858_100141680
881 Ga0068858_100339579
882 Ga0068858_100570510
883 Ga0068860_100079448
884 Ga0068860_100132188
885 Ga0068860_100152598
886 Ga0068860_100343170
887 Ga0068860_100864182
888 Ga0068862_100005058
889 Ga0068862_100021656
890 Ga0068862_100030811
891 Ga0068862_100072717
892 Ga0068862_100090911
893 Ga0081455_10000275
894 Ga0081540_1093062
895 Ga0081540_1173074
896 Ga0081539_10000092
897 Ga0070716_100006866
898 Ga0070716_100751187
899 Ga0070712_100126804
900 Ga0070712_100136429
901 Ga0075428_100000866
902 Ga0075428_100008670
903 Ga0075428_100009178
904 Ga0075428_100019119
905 Ga0075428_100033009
906 Ga0075428_100063721
907 Ga0075428_100466575
908 Ga0075428_100793064
909 Ga0075428_100872610
910 Ga0075430_100031413
911 Ga0075430_100124942
912 Ga0075430_100139698
913 Ga0075430_100165427
914 Ga0075430_100203022
915 Ga0075430_100533737
916 Ga0075431_100000679
917 Ga0075431_100002363
918 Ga0075431_100012958
919 Ga0075431_100017043
920 Ga0075431_100059102
921 Ga0075431_100161653
922 Ga0075431_100177407
923 Ga0075431_100345461
924 Ga0075431_100376048
925 Ga0075431_100445692
926 Ga0075431_100511878
927 Ga0075433_10000825
928 Ga0075433_10001196
929 Ga0075433_10001864
930 Ga0075433_10060084
931 Ga0075433_10080224
932 Ga0075433_10114955
933 Ga0075433_10122694
934 Ga0075433_10283572
935 Ga0075433_11275785
936 Ga0075434_100001806
937 Ga0075434_100022833
938 Ga0075434_100031860
939 Ga0075434_100072055
940 Ga0075434_100117436
941 Ga0075434_100124330
942 Ga0075434_100175424
943 Ga0075434_100228431
944 Ga0075434_100263222
945 Ga0075434_100376413
946 Ga0075434_100385832
947 Ga0075434_100431820
948 Ga0075434_100579315
949 Ga0075434_100804032
950 Ga0075429_100009002
951 Ga0075429_100016735
952 Ga0075429_100038550
953 Ga0075429_100040742
954 Ga0075429_100061543
955 Ga0075429_100453149
956 Ga0068865_100974846
957 Ga0075436_100000822
958 Ga0075436_100025292
959 Ga0075436_100110475
960 Ga0075436_100161371
961 Ga0075436_100165609
962 Ga0097620_100002005
963 Ga0097620_100395241
964 Ga0097620_100413859
965 Ga0097620_101488128
966 Ga0075435_100003611
967 Ga0075435_100010923
968 Ga0075435_100056718
969 Ga0075435_100109696
970 Ga0075435_100115764
971 Ga0075435_100332610
972 Ga0099794_10004336
973 Ga0099794_10007668
974 Ga0099794_10056188
975 Ga0099794_10642955
976 Ga0111539_10000238
977 Ga0111539_10011454
978 Ga0111539_10029172
979 Ga0111539_10238902
980 Ga0111539_10569511
981 Ga0111539_11299392
982 Ga0114129_10000026
983 Ga0114129_10000123
984 Ga0114129_10000605
985 Ga0114129_10015880
986 Ga0114129_10019333
987 Ga0114129_10027698
988 Ga0114129_10033595
989 Ga0114129_10052052
990 Ga0114129_10061840
991 Ga0114129_10064740
992 Ga0114129_10096220
993 Ga0114129_10182323
994 Ga0114129_10215063
995 Ga0114129_10337103
996 Ga0114129_10459569
997 Ga0114129_10479599
998 Ga0114129_10585218
999 Ga0114129_10730554
1000 Ga0114129_11124752
1001 Ga0114129_12484139
1002 Ga0105243_10039386
1003 Ga0105243_10312859
1004 Ga0105241_10000570
1005 Ga0105242_10074866
1006 Ga0105242_11067662
1007 Ga0105248_10128725
1008 Ga0105237_10085568
1009 Ga0105249_10036088
1010 Ga0105249_10134737
1011 Ga0105249_11026973
1012 Ga0105249_11835325
1013 Ga0105249_12062601
1014 Ga0105239_10217701
1015 Ga0105246_10070435
1016 Ga0157373_10005215
1017 Ga0157370_10067579
1018 Ga0157378_10167484
1019 Ga0163162_10077184
1020 Ga0163162_10516634
1021 Ga0163162_10714754
1022 Ga0157372_10016574
1023 Ga0157375_10657864
1024 Ga0163163_10032287
1025 Ga0157380_10363991
1026 Ga0157380_10445990
1027 Ga0157377_10223324
1028 Ga0182007_10031130
1029 Ga0207653_10020578
1030 Ga0207653_10024233
1031 Ga0207653_10136241
1032 Ga0207642_10227492
1033 Ga0207688_10019849
1034 Ga0207647_10103243
1035 Ga0207699_10066767
1036 Ga0207645_10000796
1037 Ga0207645_10423331
1038 Ga0207643_10000190
1039 Ga0207643_10094492
1040 Ga0207684_10000468
1041 Ga0207684_10003352
1042 Ga0207684_10039774
1043 Ga0207684_10067966
1044 Ga0207684_10106974
1045 Ga0207684_10231780
1046 Ga0207684_10242223
1047 Ga0207684_10284735
1048 Ga0207684_10290677
1049 Ga0207684_10324749
1050 Ga0207684_10418454
1051 Ga0207684_10706353
1052 Ga0207684_10886577
1053 Ga0207654_10004022
1054 Ga0207707_10000579
1055 Ga0207693_10032191
1056 Ga0207663_10037028
1057 Ga0207660_10002743
1058 Ga0207660_10675730
1059 Ga0207657_10000212
1060 Ga0207649_10001553
1061 Ga0207652_10017812
1062 Ga0207646_10000497
1063 Ga0207646_10005111
1064 Ga0207646_10007193
1065 Ga0207646_10014048
1066 Ga0207646_10260332
1067 Ga0207646_10372280
1068 Ga0207646_10387045
1069 Ga0207646_10413404
1070 Ga0207646_10455464
1071 Ga0207681_10111443
1072 Ga0207650_10020305
1073 Ga0207687_10525897
1074 Ga0207687_10730325
1075 Ga0207644_10147999
1076 Ga0207690_10000963
1077 Ga0207706_10038901
1078 Ga0207706_10085796
1079 Ga0207706_10190660
1080 Ga0207709_10033307
1081 Ga0207709_10781061
1082 Ga0207665_10002311
1083 Ga0207691_10076791
1084 Ga0207711_10385768
1085 Ga0207711_10625556
1086 Ga0207689_10000122
1087 Ga0207689_10123875
1088 Ga0207679_10018583
1089 Ga0207667_10004750
1090 Ga0207712_10338975
1091 Ga0207640_10013138
1092 Ga0207640_10603696
1093 Ga0207640_10620026
1094 Ga0207677_11372604
1095 Ga0207703_10656321
1096 Ga0207639_10012840
1097 Ga0207678_10063700
1098 Ga0207708_10027350
1099 Ga0207708_10388866
1100 Ga0207702_10013693
1101 Ga0207641_10302001
1102 Ga0207641_10338226
1103 Ga0207641_10659504
1104 Ga0207648_10015590
1105 Ga0207648_10079484
1106 Ga0207676_10061260
1107 Ga0207676_11103301
1108 Ga0207674_10003859
1109 Ga0207674_10012454
1110 Ga0207674_10121642
1111 Ga0207675_100103379
1112 Ga0209970_1004566
1113 Ga0209983_1002617
1114 Ga0209588_1007603
1115 Ga0209971_1000023
1116 Ga0209971_1007837
1117 Ga0209998_10000214
1118 Ga0209974_10024658
1119 Ga0207428_10000054
1120 Ga0207428_10007975
1121 Ga0207428_10023551
1122 Ga0207428_10136240
1123 Ga0268265_10005400
1124 Ga0268265_10009518
1125 Ga0268265_10014959
1126 Ga0268265_10024043
1127 Ga0268265_10049093
1128 Ga0268265_11482274
1129 Ga0268264_10061388
1130 Ga0268264_10064116
1131 Ga0268264_10072351
1132 Ga0268264_10104388
1133 Ga0307408_100085113
1134 Ga0307408_100220768
1135 Ga0307408_100316985
1136 Ga0307408_100550195
1137 Ga0307405_10160702
1138 Ga0307405_10991456
1139 Ga0307410_10187081
1140 Ga0307407_10081583
1141 Ga0307412_10167704
1142 Ga0307409_100858597
1143 Ga0307416_100116710
1144 Ga0307416_100543990
1145 Ga0307416_100595750
1146 Ga0307415_100099139
1147 Ga0373948_0007951
1148 Ga0373948_0045980
1149 Ga0373948_0060088
1150 Ga0373959_0004587
1151 Ga0373928_0013196
1152 Ga0373940_0006139
1153 Ga0373949_0088002
1154 Ga0373951_0009247
1155 Ga0373951_0058119
1156 Ga0373932_0033499
1157 Ga0373932_0075501
1158 Ga0373932_0119041
1159 Ga0373939_0028736
1160 Ga0373941_0026641
1161 Ga0373960_0193828
1162 Ga0373961_0015719
1163 Ga0373961_0394557
1164 Ga0373962_0072300
1165 Ga0373962_0212002
1166 Ga0395900_0310591
1167 Ga0395905_0762746
1168 Ga0395901_0422302
1169 Ga0242420_014342
1170 Ga0439441_014575
1171 Ga0439448_0022429
1172 Ga0439460_0004709
1173 Ga0451577_0002471
1174 Ga0451577_0004587
1175 Ga0451577_0046808
1176 Ga0451577_0188772
1177 Ga0453683_0020442
1178 Ga0453683_0074469
1179 Ga0453683_0214041
1180 Ga0453684_0005153
1181 Ga0453684_0128158
1182 Ga0453684_1763767
1183 Ga0451576_0008153
1184 Ga0451576_0053473
1185 Ga0451576_0073598
1186 Ga0451576_0218935
1187 Ga0451576_0294614
1188 Ga0451576_0436315
1189 Ga0451576_0565736
1190 Ga0451576_0814317
1191 Ga0495580_0053708
1192 Ga0495580_0070815
1193 Ga0495580_0358565
1194 Ga0495584_0055616
1195 Ga0495584_0650786
1196 Ga0495669_0111370
1197 Ga0495636_0049185
1198 Ga0495636_0486669
1199 Ga0496106_0108132
1200 Ga0496107_0439805
1201 Ga0496110_0433509
1202 Ga0496113_0618948
1203 Ga0501297_060631
1204 Ga0501299_084187
1205 Ga0501031_0334693
1206 Ga0501031_0363983
1207 Ga0501031_0420255
1208 Ga0501031_0499114
1209 Ga0501032_0182848
1210 Ga0501033_0120993
1211 Ga0501033_0877285
1212 Ga0501034_1245740
1213 Ga0501036_0219394
1214 Ga0501036_0329524
1215 Ga0501036_0786462
1216 Ga0501038_0133865
1217 Ga0501038_0215067
1218 Ga0501038_0970992
1219 Ga0501039_0005513
1220 Ga0501039_0022073
1221 Ga0501039_0027775
1222 Ga0501039_0378538
1223 Ga0501039_0478498
1224 Ga0501040_0006460
1225 Ga0501040_0027102
1226 Ga0501040_0115149
1227 Ga0501040_0204332
1228 Ga0501040_0280917
1229 Ga0501040_0316760
1230 Ga0501040_0914870
1231 Ga0501041_0004325
1232 Ga0501041_0006139
1233 Ga0501041_0105630
1234 Ga0501041_0296622
1235 Ga0501041_0394672
1236 Ga0501041_0413913
1237 Ga0501041_1055317
1238 Ga0501042_0081883
1239 Ga0501042_0292232
1240 Ga0501042_0303033
1241 Ga0501042_0515086
1242 Ga0501043_0196469
1243 Ga0501043_0292231
1244 Ga0501046_0011306
1245 Ga0501046_0039763
1246 Ga0501046_0112094
1247 Ga0501046_0240067
1248 Ga0501046_0830489
1249 Ga0501047_0022256
1250 Ga0501048_0026670
1251 Ga0501048_0115038
1252 Ga0501048_0162529
1253 Ga0501067_0003389
1254 Ga0501067_0322053
1255 Ga0501068_0015534
1256 Ga0501068_0156769
1257 Ga0501068_0674153
1258 Ga0501068_0679991
1259 Ga0501069_0006253
1260 Ga0501069_0258527
1261 Ga0501070_0711371
1262 Ga0501071_0119476
1263 Ga0501071_0238396
1264 Ga0501071_0261313
1265 Ga0501071_0267818
1266 Ga0501072_0008156
1267 Ga0501072_0013994
1268 Ga0501072_0089071
1269 Ga0501072_0145348
1270 Ga0501072_0153601
1271 Ga0501072_0257836
1272 Ga0501072_0376812
1273 Ga0501072_1229878
1274 Ga0501074_0005416
1275 Ga0501074_0139706
1276 Ga0501074_0205998
1277 Ga0501074_0401623
1278 Ga0501075_0005738
1279 Ga0501075_0028650
1280 Ga0501075_0043969
1281 Ga0501075_0113990
1282 Ga0501075_0203006
1283 Ga0501075_0360034
1284 Ga0501075_0442212
1285 Ga0501075_0706384
1286 Ga0501075_0918204
1287 Ga0501076_0005952
1288 Ga0501076_0012366
1289 Ga0501076_0023957
1290 Ga0501076_0042767
1291 Ga0501076_0418304
1292 Ga0501076_0441899
1293 Ga0501076_1369508
1294 Ga0501076_1396614
1295 Ga0501077_0005778
1296 Ga0501077_0050043
1297 Ga0501077_0099744
1298 Ga0501077_0180349
1299 Ga0501077_0231466
1300 Ga0501198_120304
1301 Ga0501219_004276
1302 Ga0501079_0003821
1303 Ga0501079_0017446
1304 Ga0501079_0029254
1305 Ga0501079_0050401
1306 Ga0501079_0111995
1307 Ga0501079_0183664
1308 Ga0501079_0276572
1309 Ga0501079_0283938
1310 Ga0501079_0326789
1311 Ga0501080_0113850
1312 Ga0501080_0452854
1313 Ga0501080_0467057
1314 Ga0501081_0005537
1315 Ga0501081_0006788
1316 Ga0501081_0049660
1317 Ga0501081_0077526
1318 Ga0501081_0114223
1319 Ga0501081_0497234
1320 Ga0501083_0514821
1321 Ga0501035_0132399
1322 Ga0501035_0156277
1323 Ga0501035_0431149
1324 Ga0501035_1480726
1325 Ga0501044_0366593
1326 Ga0501045_0000613
1327 Ga0501045_0029396
1328 Ga0501045_0095831
1329 Ga0501045_0139982
1330 Ga0501045_0168788
1331 Ga0501045_0193626
1332 Ga0501045_0512376
1333 Ga0501045_0692191
1334 nmdc:mga05p37_107326_c2
1335 nmdc:mga05p37_131595_c1
1336 nmdc:mga05p37_146389_c1
1337 nmdc:mga05p37_158524_c1
1338 nmdc:mga05p37_1587_c1
1339 nmdc:mga05p37_197023_c1
1340 nmdc:mga05p37_321_c1
1341 nmdc:mga05p37_331085_c1
1342 nmdc:mga05p37_411400_c1
1343 nmdc:mga05p37_718_c1
1344 nmdc:mga05p37_852799_c1
1345 nmdc:mga05p37_87373_c1
1346 nmdc:mga05p37_88069_c1
1347 nmdc:mga05p37_8962_c1
1348 nmdc:mga09592_140355_c1
1349 nmdc:mga09592_18833_c1
1350 nmdc:mga09592_21539_c1
1351 nmdc:mga09592_22208_c1
1352 nmdc:mga09592_47828_c1
1353 nmdc:mga09592_6245_c1
1354 nmdc:mga09592_686632_c1
1355 nmdc:mga09592_85461_c1
1356 nmdc:mga0qj67_163659_c1
1357 nmdc:mga0qj67_16535_c2
1358 nmdc:mga0qj67_177790_c1
1359 nmdc:mga0qj67_18413_c1
1360 nmdc:mga0qj67_3491_c1
1361 nmdc:mga0qj67_715905_c1
1362 nmdc:mga06r32_152111_c1
1363 nmdc:mga06r32_160187_c1
1364 nmdc:mga06r32_175439_c1
1365 nmdc:mga06r32_17819_c1
1366 nmdc:mga06r32_29129_c1
1367 nmdc:mga06r32_341856_c1
1368 nmdc:mga06r32_531247_c1
1369 nmdc:mga06r32_5489_c1
1370 nmdc:mga06r32_641902_c1
1371 nmdc:mga06r32_87034_c1
1372 nmdc:mga06r32_95446_c1
1373 nmdc:mga08y16_12103_c1
1374 nmdc:mga08y16_24679_c1
1375 nmdc:mga08y16_2555_c1
1376 nmdc:mga08y16_483820_c1
1377 nmdc:mga0n895_1016464_c1
1378 nmdc:mga0n895_118551_c1
1379 nmdc:mga0n895_158319_c1
1380 nmdc:mga0n895_174626_c1
1381 nmdc:mga0n895_19324_c1
1382 nmdc:mga0n895_2206_c1
1383 nmdc:mga0n895_39320_c1
1384 nmdc:mga0n895_456803_c1
1385 nmdc:mga0n895_498729_c1
1386 nmdc:mga0n895_66299_c1
1387 nmdc:mga0n895_750781_c1
1388 nmdc:mga0n895_808305_c1
1389 nmdc:mga0rr50_1023502_c1
1390 nmdc:mga0rr50_112111_c1
1391 nmdc:mga0rr50_122745_c1
1392 nmdc:mga0rr50_163955_c1
1393 nmdc:mga0rr50_171934_c1
1394 nmdc:mga0rr50_242682_c1
1395 nmdc:mga0rr50_41253_c1
1396 nmdc:mga0rr50_55943_c1
1397 nmdc:mga0rr50_80064_c1
1398 nmdc:mga0rr50_818141_c1
1399 nmdc:mga0rr50_932_c1
1400 nmdc:mga0rr50_9457_c1
1401 nmdc:mga08x19_12254_c1
1402 nmdc:mga08x19_1275_c1
1403 nmdc:mga08x19_304694_c1
1404 nmdc:mga08x19_48583_c1
1405 nmdc:mga08x19_63756_c1
1406 nmdc:mga0a205_13782_c1
1407 nmdc:mga0a205_1806_c1
1408 nmdc:mga0a205_206980_c1
1409 nmdc:mga0a205_26562_c1
1410 nmdc:mga0a205_28508_c1
1411 nmdc:mga0a205_289396_c1
1412 nmdc:mga0a205_29536_c1
1413 nmdc:mga0a205_33668_c1
1414 nmdc:mga0a205_41982_c1
1415 nmdc:mga0a205_484418_c1
1416 nmdc:mga0a205_58074_c1
1417 nmdc:mga0a205_92492_c1
1418 Ga0501084_0005434
1419 Ga0501084_0006439
1420 Ga0501084_0016588
1421 Ga0501084_0025100
1422 Ga0501084_0131498
1423 Ga0501084_0321853
1424 Ga0501084_0666181
1425 Ga0501084_0924501
1426 Ga0590074_092839
1427 Ga0501082_0000132
1428 Ga0501082_0011019
1429 Ga0501082_0018400
1430 Ga0501082_0068023
1431 Ga0501082_0113399
1432 Ga0530510_0005457
1433 Ga0530510_0058736
1434 Ga0530510_0072308
1435 Ga0530510_0091866
1436 Ga0530510_0402257
1437 Ga0530510_0402807
1438 Ga0530510_0417175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

12

144

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7887 1 150
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.788 2 150
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.7779 2 150
5ur6-assembly1.cif.gz_A-2 pyr1 bound to the rationally designed agonist cyanabactin 0.7772 2 152
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7743 1 150
ID Description Score Start End Superfamily
af_O53520_5_114_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8075 6 137 1.10.390.10
3ijtB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7806 1 150 3.30.530.20
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7721 1 150 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7695 6 153 3.30.530.20
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7672 1 150 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7V4EPZ5-F1-model_v4 Cyclase 0.9529 1 150
AF-A0A1I1SRR2-F1-model_v4 TIGR01777 family protein 0.9428 5 150
AF-A0A2E7JML9-F1-model_v4 CDP-paratose 2-epimerase 0.939 1 151
AF-A0A5C5VY89-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9381 3 152
AF-A0A2E4WJ14-F1-model_v4 CDP-paratose 2-epimerase 0.9359 1 151

Map