F477214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 307 | 716 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100494320|Ga0070683_1004943201 |
| Length | 208 |
| Sequence | MLLTSGDWPKARSCQGADGRKRKLDTPNPARKTSFDLQGLLACARGELFGPGNPQLPLPPMLMFDRIVKISDTGGSANKGEIEAELDVNPNLWFFKCHFLGDPVMPGCLGVDAMWQMLGFFLGWLGGLGRGRALGVGEVKFTGMVLPTAKKVSYYIDLKRVVMRRLVLGIADGIVKVDGKTIFEAKDLRVGLFTDAAAALARTAAQPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 2 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 3 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 182 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 186 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 191 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 192 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 208 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 293 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 295 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 296 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 297 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 299 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 300 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 301 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 302 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 304 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.75 |
| Metatranscriptomes | 0.83 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.98 |
| Nodule | 0 |
| Rhizoplane | 0.42 |
| Rhizosphere | 91.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10084318 | 3300001979 | Bacteria | 828 |
| 2 | JGI24735J21928_10132198 | 3300002067 | Bacteria | 719 |
| 3 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 4 | JGI25153J46596_10000362 | 3300003215 | Bacteria | 31305 |
| 5 | Ga0055531_10026506 | 3300003794 | Bacteria | 2065 |
| 6 | Ga0058863_11751868 | 3300004799 | Bacteria | 1012 |
| 7 | Ga0065165_1044999 | 3300005262 | Bacteria | 1288 |
| 8 | Ga0070658_10068667 | 3300005327 | Bacteria | 2898 |
| 9 | Ga0070658_10073106 | 3300005327 | Bacteria | 2811 |
| 10 | Ga0070658_10158451 | 3300005327 | Bacteria | 1898 |
| 11 | Ga0070676_10035640 | 3300005328 | Bacteria | 2862 |
| 12 | Ga0070676_10285350 | 3300005328 | Bacteria | 1114 |
| 13 | Ga0070683_100033947 | 3300005329 | Bacteria | 4656 |
| 14 | Ga0070683_100207763 | 3300005329 | Bacteria | 1860 |
| 15 | Ga0070683_100494320 | 3300005329 | Bacteria | 1168 |
| 16 | Ga0070690_100115009 | 3300005330 | Bacteria | 1800 |
| 17 | Ga0070677_10110348 | 3300005333 | Bacteria | 1227 |
| 18 | Ga0068869_100131986 | 3300005334 | Bacteria | 1921 |
| 19 | Ga0068869_100397420 | 3300005334 | Bacteria | 1133 |
| 20 | Ga0068869_100943635 | 3300005334 | Bacteria | 749 |
| 21 | Ga0070666_10073561 | 3300005335 | Bacteria | 2328 |
| 22 | Ga0070666_10168118 | 3300005335 | Bacteria | 1535 |
| 23 | Ga0070680_100006785 | 3300005336 | Bacteria | 8721 |
| 24 | Ga0070680_100019163 | 3300005336 | Bacteria | 5420 |
| 25 | Ga0070680_100169100 | 3300005336 | Bacteria | 1839 |
| 26 | Ga0070680_100761467 | 3300005336 | Bacteria | 834 |
| 27 | Ga0070682_100232679 | 3300005337 | Bacteria | 1318 |
| 28 | Ga0070682_100990295 | 3300005337 | Bacteria | 697 |
| 29 | Ga0068868_100038243 | 3300005338 | Bacteria | 3724 |
| 30 | Ga0068868_100057362 | 3300005338 | Bacteria | 3076 |
| 31 | Ga0068868_100158380 | 3300005338 | Bacteria | 1868 |
| 32 | Ga0070660_100013047 | 3300005339 | Bacteria | 5948 |
| 33 | Ga0070660_100053117 | 3300005339 | Bacteria | 3125 |
| 34 | Ga0070691_10006515 | 3300005341 | Bacteria | 5339 |
| 35 | Ga0070691_10033661 | 3300005341 | Bacteria | 2412 |
| 36 | Ga0070661_100053235 | 3300005344 | Bacteria | 2962 |
| 37 | Ga0070661_100279089 | 3300005344 | Bacteria | 1296 |
| 38 | Ga0070675_100117750 | 3300005354 | Bacteria | 2255 |
| 39 | Ga0070675_100158737 | 3300005354 | Bacteria | 1944 |
| 40 | Ga0070671_100135004 | 3300005355 | Bacteria | 2080 |
| 41 | Ga0070671_100343986 | 3300005355 | Bacteria | 1272 |
| 42 | Ga0070674_100606420 | 3300005356 | Bacteria | 926 |
| 43 | Ga0070674_100771809 | 3300005356 | Bacteria | 828 |
| 44 | Ga0070673_100158736 | 3300005364 | Bacteria | 1921 |
| 45 | Ga0070673_101207637 | 3300005364 | Bacteria | 709 |
| 46 | Ga0070659_100033717 | 3300005366 | Bacteria | 3979 |
| 47 | Ga0070659_100650536 | 3300005366 | Bacteria | 909 |
| 48 | Ga0070667_100034132 | 3300005367 | Bacteria | 4254 |
| 49 | Ga0070709_10227564 | 3300005434 | Bacteria | 1333 |
| 50 | Ga0070714_100108291 | 3300005435 | Bacteria | 2457 |
| 51 | Ga0070713_100159253 | 3300005436 | Bacteria | 2014 |
| 52 | Ga0070710_10474489 | 3300005437 | Bacteria | 852 |
| 53 | Ga0070700_100533575 | 3300005441 | Bacteria | 909 |
| 54 | Ga0070708_100249640 | 3300005445 | Bacteria | 1667 |
| 55 | Ga0070678_100008608 | 3300005456 | Bacteria | 6117 |
| 56 | Ga0070678_100151089 | 3300005456 | Bacteria | 1871 |
| 57 | Ga0070678_100189794 | 3300005456 | Bacteria | 1689 |
| 58 | Ga0070678_100403021 | 3300005456 | Bacteria | 1189 |
| 59 | Ga0070678_100599862 | 3300005456 | Bacteria | 983 |
| 60 | Ga0070662_100690571 | 3300005457 | Bacteria | 863 |
| 61 | Ga0070662_100726784 | 3300005457 | Bacteria | 841 |
| 62 | Ga0070681_10000002 | 3300005458 | Bacteria | 821814 |
| 63 | Ga0070681_10003070 | 3300005458 | Bacteria | 15491 |
| 64 | Ga0070681_10072889 | 3300005458 | Bacteria | 3396 |
| 65 | Ga0070681_10121171 | 3300005458 | Bacteria | 2550 |
| 66 | Ga0070681_10410599 | 3300005458 | Bacteria | 1266 |
| 67 | Ga0070681_10427701 | 3300005458 | Bacteria | 1236 |
| 68 | Ga0068867_100007771 | 3300005459 | Bacteria | 7580 |
| 69 | Ga0068867_100088193 | 3300005459 | Bacteria | 2351 |
| 70 | Ga0068867_100397773 | 3300005459 | Bacteria | 1161 |
| 71 | Ga0068867_100634065 | 3300005459 | Bacteria | 936 |
| 72 | Ga0070685_11135120 | 3300005466 | Bacteria | 592 |
| 73 | Ga0070699_100385633 | 3300005518 | Bacteria | 1265 |
| 74 | Ga0070679_100000035 | 3300005530 | Bacteria | 103095 |
| 75 | Ga0070679_100004953 | 3300005530 | Bacteria | 12291 |
| 76 | Ga0070679_100014205 | 3300005530 | Bacteria | 7642 |
| 77 | Ga0070679_100039445 | 3300005530 | Bacteria | 4693 |
| 78 | Ga0070684_100119853 | 3300005535 | Bacteria | 2367 |
| 79 | Ga0070684_100412945 | 3300005535 | Bacteria | 1245 |
| 80 | Ga0070697_100020390 | 3300005536 | Bacteria | 5244 |
| 81 | Ga0068853_100036211 | 3300005539 | Bacteria | 4195 |
| 82 | Ga0068853_100267120 | 3300005539 | Bacteria | 1574 |
| 83 | Ga0068853_100291840 | 3300005539 | Bacteria | 1505 |
| 84 | Ga0068853_100793324 | 3300005539 | Bacteria | 907 |
| 85 | Ga0070672_100429275 | 3300005543 | Bacteria | 1136 |
| 86 | Ga0070695_101421002 | 3300005545 | Bacteria | 576 |
| 87 | Ga0070693_100096925 | 3300005547 | Bacteria | 1789 |
| 88 | Ga0070693_100149993 | 3300005547 | Bacteria | 1476 |
| 89 | Ga0070693_100320061 | 3300005547 | Bacteria | 1052 |
| 90 | Ga0070665_100000322 | 3300005548 | Bacteria | 73995 |
| 91 | Ga0070665_100043912 | 3300005548 | Bacteria | 4489 |
| 92 | Ga0070665_100057177 | 3300005548 | Bacteria | 3911 |
| 93 | Ga0070665_100136234 | 3300005548 | Bacteria | 2458 |
| 94 | Ga0070665_100213662 | 3300005548 | Bacteria | 1930 |
| 95 | Ga0070665_100356014 | 3300005548 | Bacteria | 1469 |
| 96 | Ga0068855_100000038 | 3300005563 | Bacteria | 157738 |
| 97 | Ga0068855_100016691 | 3300005563 | Bacteria | 8830 |
| 98 | Ga0068855_100022893 | 3300005563 | Bacteria | 7487 |
| 99 | Ga0068855_100176837 | 3300005563 | Bacteria | 2414 |
| 100 | Ga0068855_100241094 | 3300005563 | Bacteria | 2020 |
| 101 | Ga0068855_100431255 | 3300005563 | Bacteria | 1441 |
| 102 | Ga0068855_100624837 | 3300005563 | Bacteria | 1159 |
| 103 | Ga0068855_101073526 | 3300005563 | Bacteria | 843 |
| 104 | Ga0070664_100039851 | 3300005564 | Bacteria | 3960 |
| 105 | Ga0068854_100463577 | 3300005578 | Bacteria | 1061 |
| 106 | Ga0068854_100692116 | 3300005578 | Bacteria | 879 |
| 107 | Ga0068854_100965265 | 3300005578 | Bacteria | 753 |
| 108 | Ga0068854_101091332 | 3300005578 | Bacteria | 711 |
| 109 | Ga0068856_100173470 | 3300005614 | Bacteria | 2169 |
| 110 | Ga0068856_100217518 | 3300005614 | Bacteria | 1925 |
| 111 | Ga0068856_100256297 | 3300005614 | Bacteria | 1764 |
| 112 | Ga0068856_100400148 | 3300005614 | Bacteria | 1393 |
| 113 | Ga0068856_100548606 | 3300005614 | Bacteria | 1177 |
| 114 | Ga0068856_100721512 | 3300005614 | Bacteria | 1017 |
| 115 | Ga0068856_101291640 | 3300005614 | Bacteria | 745 |
| 116 | Ga0070702_100173141 | 3300005615 | Bacteria | 1406 |
| 117 | Ga0068852_100230981 | 3300005616 | Bacteria | 1763 |
| 118 | Ga0068859_100380549 | 3300005617 | Bacteria | 1507 |
| 119 | Ga0068864_101788348 | 3300005618 | Bacteria | 620 |
| 120 | Ga0068866_10050112 | 3300005718 | Bacteria | 2119 |
| 121 | Ga0068861_100220098 | 3300005719 | Bacteria | 1604 |
| 122 | Ga0068851_10188533 | 3300005834 | Bacteria | 1145 |
| 123 | Ga0068870_10186449 | 3300005840 | Bacteria | 1249 |
| 124 | Ga0068863_100028187 | 3300005841 | Bacteria | 5361 |
| 125 | Ga0068863_100072686 | 3300005841 | Bacteria | 3254 |
| 126 | Ga0068858_100121471 | 3300005842 | Bacteria | 2443 |
| 127 | Ga0068860_100139352 | 3300005843 | Bacteria | 2330 |
| 128 | Ga0068862_100560421 | 3300005844 | Bacteria | 1092 |
| 129 | Ga0081455_10004726 | 3300005937 | Bacteria | 15138 |
| 130 | Ga0081455_10015332 | 3300005937 | Bacteria | 7452 |
| 131 | Ga0075368_10130818 | 3300006042 | Bacteria | 1043 |
| 132 | Ga0075364_10195880 | 3300006051 | Bacteria | 1369 |
| 133 | Ga0070712_100401652 | 3300006175 | Bacteria | 1132 |
| 134 | Ga0075362_10100852 | 3300006177 | Bacteria | 1350 |
| 135 | Ga0075366_10025120 | 3300006195 | Bacteria | 3477 |
| 136 | Ga0075366_10076019 | 3300006195 | Bacteria | 2004 |
| 137 | Ga0097621_100000270 | 3300006237 | Bacteria | 35158 |
| 138 | Ga0097621_100017434 | 3300006237 | Bacteria | 5453 |
| 139 | Ga0097621_100026161 | 3300006237 | Bacteria | 4574 |
| 140 | Ga0097621_100040414 | 3300006237 | Bacteria | 3750 |
| 141 | Ga0097621_100065040 | 3300006237 | Bacteria | 3000 |
| 142 | Ga0097621_100108423 | 3300006237 | Bacteria | 2344 |
| 143 | Ga0097621_100173694 | 3300006237 | Bacteria | 1859 |
| 144 | Ga0097621_100324292 | 3300006237 | Bacteria | 1365 |
| 145 | Ga0097621_100739948 | 3300006237 | Bacteria | 908 |
| 146 | Ga0068871_100001246 | 3300006358 | Bacteria | 17001 |
| 147 | Ga0068871_100004963 | 3300006358 | Bacteria | 9293 |
| 148 | Ga0068871_100008068 | 3300006358 | Bacteria | 7558 |
| 149 | Ga0068871_100313372 | 3300006358 | Bacteria | 1380 |
| 150 | Ga0068871_100775055 | 3300006358 | Bacteria | 883 |
| 151 | Ga0075430_100435485 | 3300006846 | Bacteria | 1082 |
| 152 | Ga0068865_100009233 | 3300006881 | Bacteria | 6107 |
| 153 | Ga0068865_100565311 | 3300006881 | Bacteria | 957 |
| 154 | Ga0097620_100380580 | 3300006931 | Bacteria | 1507 |
| 155 | Ga0099794_10029829 | 3300007265 | Bacteria | 2543 |
| 156 | Ga0099795_10089700 | 3300007788 | Bacteria | 1190 |
| 157 | Ga0105240_10000811 | 3300009093 | Bacteria | 56752 |
| 158 | Ga0105240_10024659 | 3300009093 | Bacteria | 7923 |
| 159 | Ga0105240_10098517 | 3300009093 | Bacteria | 3560 |
| 160 | Ga0105240_10119729 | 3300009093 | Bacteria | 3171 |
| 161 | Ga0105240_10120223 | 3300009093 | Bacteria | 3163 |
| 162 | Ga0105240_10331431 | 3300009093 | Bacteria | 1732 |
| 163 | Ga0105240_10729961 | 3300009093 | Bacteria | 1079 |
| 164 | Ga0105240_10752730 | 3300009093 | Bacteria | 1059 |
| 165 | Ga0111539_10549739 | 3300009094 | Bacteria | 1345 |
| 166 | Ga0105247_10616997 | 3300009101 | Bacteria | 806 |
| 167 | Ga0105247_10727352 | 3300009101 | Bacteria | 750 |
| 168 | Ga0105241_10058504 | 3300009174 | Bacteria | 2960 |
| 169 | Ga0105241_10221743 | 3300009174 | Bacteria | 1590 |
| 170 | Ga0105241_10985457 | 3300009174 | Bacteria | 788 |
| 171 | Ga0105242_10031665 | 3300009176 | Bacteria | 4227 |
| 172 | Ga0105242_10080115 | 3300009176 | Bacteria | 2729 |
| 173 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 174 | Ga0105248_10023048 | 3300009177 | Bacteria | 6914 |
| 175 | Ga0105248_10197276 | 3300009177 | Bacteria | 2268 |
| 176 | Ga0105248_10338310 | 3300009177 | Bacteria | 1695 |
| 177 | Ga0105248_10528402 | 3300009177 | Bacteria | 1330 |
| 178 | Ga0105237_10168332 | 3300009545 | Bacteria | 2191 |
| 179 | Ga0105237_10202867 | 3300009545 | Bacteria | 1983 |
| 180 | Ga0105237_10253338 | 3300009545 | Bacteria | 1762 |
| 181 | Ga0105237_10286443 | 3300009545 | Bacteria | 1650 |
| 182 | Ga0105237_10520761 | 3300009545 | Bacteria | 1196 |
| 183 | Ga0105238_10017545 | 3300009551 | Bacteria | 7279 |
| 184 | Ga0105238_10023226 | 3300009551 | Bacteria | 6321 |
| 185 | Ga0105238_10023345 | 3300009551 | Bacteria | 6305 |
| 186 | Ga0105238_10040277 | 3300009551 | Bacteria | 4735 |
| 187 | Ga0105238_10126332 | 3300009551 | Bacteria | 2536 |
| 188 | Ga0105238_10225310 | 3300009551 | Bacteria | 1851 |
| 189 | Ga0105238_10268138 | 3300009551 | Bacteria | 1688 |
| 190 | Ga0105238_10409055 | 3300009551 | Bacteria | 1351 |
| 191 | Ga0105032_110166 | 3300009979 | Bacteria | 763 |
| 192 | Ga0099796_10090638 | 3300010159 | Bacteria | 1136 |
| 193 | Ga0105239_10013755 | 3300010375 | Bacteria | 8981 |
| 194 | Ga0105239_10050719 | 3300010375 | Bacteria | 4550 |
| 195 | Ga0105239_10239180 | 3300010375 | Bacteria | 2038 |
| 196 | Ga0105239_10249747 | 3300010375 | Bacteria | 1992 |
| 197 | Ga0105239_10288313 | 3300010375 | Bacteria | 1849 |
| 198 | Ga0105239_10295637 | 3300010375 | Bacteria | 1823 |
| 199 | Ga0105239_10329723 | 3300010375 | Bacteria | 1722 |
| 200 | Ga0105239_10695239 | 3300010375 | Bacteria | 1163 |
| 201 | Ga0105246_10003863 | 3300011119 | Bacteria | 9080 |
| 202 | Ga0105246_10008743 | 3300011119 | Bacteria | 6230 |
| 203 | Ga0105246_10158827 | 3300011119 | Bacteria | 1720 |
| 204 | Ga0105246_10307077 | 3300011119 | Bacteria | 1283 |
| 205 | Ga0157373_10054979 | 3300013100 | Bacteria | 2828 |
| 206 | Ga0157373_10179545 | 3300013100 | Bacteria | 1490 |
| 207 | Ga0157373_10181968 | 3300013100 | Bacteria | 1480 |
| 208 | Ga0157373_10189989 | 3300013100 | Bacteria | 1447 |
| 209 | Ga0157373_10347984 | 3300013100 | Bacteria | 1057 |
| 210 | Ga0157370_10015573 | 3300013104 | Bacteria | 7730 |
| 211 | Ga0157370_10021189 | 3300013104 | Bacteria | 6480 |
| 212 | Ga0157370_10030406 | 3300013104 | Bacteria | 5291 |
| 213 | Ga0157370_10280674 | 3300013104 | Bacteria | 1539 |
| 214 | Ga0157370_10295092 | 3300013104 | Bacteria | 1497 |
| 215 | Ga0157370_10536870 | 3300013104 | Bacteria | 1073 |
| 216 | Ga0157369_10012438 | 3300013105 | Bacteria | 9660 |
| 217 | Ga0157369_10018818 | 3300013105 | Bacteria | 7741 |
| 218 | Ga0157369_10179243 | 3300013105 | Bacteria | 2230 |
| 219 | Ga0157369_10234935 | 3300013105 | Bacteria | 1916 |
| 220 | Ga0157369_10367091 | 3300013105 | Bacteria | 1494 |
| 221 | Ga0157369_10671519 | 3300013105 | Bacteria | 1068 |
| 222 | Ga0157374_10164342 | 3300013296 | Bacteria | 2163 |
| 223 | Ga0157374_10502181 | 3300013296 | Bacteria | 1217 |
| 224 | Ga0157374_10761745 | 3300013296 | Bacteria | 983 |
| 225 | Ga0157378_10046417 | 3300013297 | Bacteria | 3862 |
| 226 | Ga0157378_10172713 | 3300013297 | Bacteria | 2028 |
| 227 | Ga0157378_10204427 | 3300013297 | Bacteria | 1870 |
| 228 | Ga0157378_10572345 | 3300013297 | Bacteria | 1138 |
| 229 | Ga0163162_10076766 | 3300013306 | Bacteria | 3403 |
| 230 | Ga0163162_10104104 | 3300013306 | Bacteria | 2932 |
| 231 | Ga0163162_10316708 | 3300013306 | Bacteria | 1693 |
| 232 | Ga0163162_11201673 | 3300013306 | Bacteria | 860 |
| 233 | Ga0163162_11598777 | 3300013306 | Bacteria | 743 |
| 234 | Ga0163162_12064324 | 3300013306 | Bacteria | 654 |
| 235 | Ga0157372_10003810 | 3300013307 | Bacteria | 16195 |
| 236 | Ga0157372_10009068 | 3300013307 | Bacteria | 10570 |
| 237 | Ga0157372_10060167 | 3300013307 | Bacteria | 4250 |
| 238 | Ga0157372_10453199 | 3300013307 | Bacteria | 1495 |
| 239 | Ga0157372_10681606 | 3300013307 | Bacteria | 1196 |
| 240 | Ga0157372_11105412 | 3300013307 | Bacteria | 917 |
| 241 | Ga0157375_10349546 | 3300013308 | Bacteria | 1644 |
| 242 | Ga0157375_10530579 | 3300013308 | Bacteria | 1340 |
| 243 | Ga0163163_10000004 | 3300014325 | Bacteria | 416569 |
| 244 | Ga0163163_10135841 | 3300014325 | Bacteria | 2501 |
| 245 | Ga0157380_10636452 | 3300014326 | Bacteria | 1061 |
| 246 | Ga0157379_10032277 | 3300014968 | Bacteria | 4668 |
| 247 | Ga0157379_10480513 | 3300014968 | Bacteria | 1150 |
| 248 | Ga0157379_10532001 | 3300014968 | Bacteria | 1092 |
| 249 | Ga0157376_10196304 | 3300014969 | Bacteria | 1854 |
| 250 | Ga0157376_10244420 | 3300014969 | Bacteria | 1673 |
| 251 | Ga0163161_10029520 | 3300017792 | Bacteria | 3899 |
| 252 | Ga0163161_10626802 | 3300017792 | Bacteria | 889 |
| 253 | Ga0206356_10376855 | 3300020070 | Bacteria | 1332 |
| 254 | Ga0213872_10013025 | 3300021361 | Bacteria | 3899 |
| 255 | Ga0213872_10016435 | 3300021361 | Bacteria | 3435 |
| 256 | Ga0213876_10000131 | 3300021384 | Bacteria | 81694 |
| 257 | Ga0213876_10000223 | 3300021384 | Bacteria | 56685 |
| 258 | Ga0207427_105282 | 3300025231 | Bacteria | 1858 |
| 259 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 260 | Ga0209233_1003621 | 3300025261 | Bacteria | 5415 |
| 261 | Ga0209455_1010456 | 3300025272 | Bacteria | 2357 |
| 262 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 263 | Ga0209758_1003752 | 3300025297 | Bacteria | 13449 |
| 264 | Ga0209758_1084595 | 3300025297 | Bacteria | 948 |
| 265 | Ga0209050_1000053 | 3300025298 | Bacteria | 349521 |
| 266 | Ga0209257_1000419 | 3300025304 | Bacteria | 81956 |
| 267 | Ga0207692_10147698 | 3300025898 | Bacteria | 1343 |
| 268 | Ga0207642_10146555 | 3300025899 | Bacteria | 1251 |
| 269 | Ga0207710_10080081 | 3300025900 | Bacteria | 1514 |
| 270 | Ga0207710_10197057 | 3300025900 | Bacteria | 994 |
| 271 | Ga0207680_10032102 | 3300025903 | Bacteria | 2981 |
| 272 | Ga0207680_10082795 | 3300025903 | Bacteria | 2020 |
| 273 | Ga0207647_10105871 | 3300025904 | Bacteria | 1666 |
| 274 | Ga0207645_10162572 | 3300025907 | Bacteria | 1461 |
| 275 | Ga0207643_10173027 | 3300025908 | Bacteria | 1304 |
| 276 | Ga0207705_10000039 | 3300025909 | Bacteria | 193592 |
| 277 | Ga0207705_10009613 | 3300025909 | Bacteria | 7031 |
| 278 | Ga0207705_10312637 | 3300025909 | Bacteria | 1206 |
| 279 | Ga0207654_10045253 | 3300025911 | Bacteria | 2504 |
| 280 | Ga0207654_10325848 | 3300025911 | Bacteria | 1051 |
| 281 | Ga0207654_10610420 | 3300025911 | Bacteria | 779 |
| 282 | Ga0207654_10807849 | 3300025911 | Bacteria | 677 |
| 283 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 284 | Ga0207707_10001894 | 3300025912 | Bacteria | 19063 |
| 285 | Ga0207707_10060914 | 3300025912 | Bacteria | 3283 |
| 286 | Ga0207707_10103499 | 3300025912 | Bacteria | 2489 |
| 287 | Ga0207707_10134172 | 3300025912 | Bacteria | 2165 |
| 288 | Ga0207707_11082288 | 3300025912 | Bacteria | 654 |
| 289 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 290 | Ga0207695_10044089 | 3300025913 | Bacteria | 4747 |
| 291 | Ga0207695_10048638 | 3300025913 | Bacteria | 4477 |
| 292 | Ga0207695_10079077 | 3300025913 | Bacteria | 3334 |
| 293 | Ga0207695_10088395 | 3300025913 | Bacteria | 3119 |
| 294 | Ga0207695_10096933 | 3300025913 | Bacteria | 2950 |
| 295 | Ga0207695_10166309 | 3300025913 | Bacteria | 2134 |
| 296 | Ga0207695_10355867 | 3300025913 | Bacteria | 1351 |
| 297 | Ga0207695_10611593 | 3300025913 | Bacteria | 971 |
| 298 | Ga0207695_10615498 | 3300025913 | Bacteria | 967 |
| 299 | Ga0207695_10665892 | 3300025913 | Bacteria | 922 |
| 300 | Ga0207671_10132903 | 3300025914 | Bacteria | 1911 |
| 301 | Ga0207671_10155108 | 3300025914 | Bacteria | 1771 |
| 302 | Ga0207671_10363464 | 3300025914 | Bacteria | 1149 |
| 303 | Ga0207671_10446785 | 3300025914 | Bacteria | 1030 |
| 304 | Ga0207660_10000299 | 3300025917 | Bacteria | 32732 |
| 305 | Ga0207660_10003148 | 3300025917 | Bacteria | 10803 |
| 306 | Ga0207657_10000182 | 3300025919 | Bacteria | 65095 |
| 307 | Ga0207657_10011088 | 3300025919 | Bacteria | 8957 |
| 308 | Ga0207657_10205154 | 3300025919 | Bacteria | 1584 |
| 309 | Ga0207657_10693657 | 3300025919 | Bacteria | 791 |
| 310 | Ga0207649_10000202 | 3300025920 | Bacteria | 49803 |
| 311 | Ga0207649_10021139 | 3300025920 | Bacteria | 3741 |
| 312 | Ga0207649_10294347 | 3300025920 | Bacteria | 1185 |
| 313 | Ga0207652_10003023 | 3300025921 | Bacteria | 14035 |
| 314 | Ga0207652_10009127 | 3300025921 | Bacteria | 7987 |
| 315 | Ga0207652_10062359 | 3300025921 | Bacteria | 3221 |
| 316 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 317 | Ga0207694_10140414 | 3300025924 | Bacteria | 1942 |
| 318 | Ga0207694_10183137 | 3300025924 | Bacteria | 1699 |
| 319 | Ga0207694_10274019 | 3300025924 | Bacteria | 1385 |
| 320 | Ga0207694_10373893 | 3300025924 | Bacteria | 1182 |
| 321 | Ga0207687_10249059 | 3300025927 | Bacteria | 1411 |
| 322 | Ga0207687_10780031 | 3300025927 | Bacteria | 814 |
| 323 | Ga0207700_10274633 | 3300025928 | Bacteria | 1447 |
| 324 | Ga0207700_10339414 | 3300025928 | Bacteria | 1306 |
| 325 | Ga0207700_10442737 | 3300025928 | Bacteria | 1144 |
| 326 | Ga0207700_10786996 | 3300025928 | Bacteria | 850 |
| 327 | Ga0207664_10437401 | 3300025929 | Bacteria | 1166 |
| 328 | Ga0207664_10796365 | 3300025929 | Bacteria | 850 |
| 329 | Ga0207644_10123603 | 3300025931 | Bacteria | 1973 |
| 330 | Ga0207690_10041072 | 3300025932 | Bacteria | 3029 |
| 331 | Ga0207690_10184616 | 3300025932 | Bacteria | 1573 |
| 332 | Ga0207706_10142314 | 3300025933 | Bacteria | 2110 |
| 333 | Ga0207686_10011116 | 3300025934 | Bacteria | 4920 |
| 334 | Ga0207686_10059565 | 3300025934 | Bacteria | 2413 |
| 335 | Ga0207670_10776784 | 3300025936 | Bacteria | 797 |
| 336 | Ga0207670_11195642 | 3300025936 | Bacteria | 643 |
| 337 | Ga0207669_10203483 | 3300025937 | Bacteria | 1439 |
| 338 | Ga0207669_10407195 | 3300025937 | Bacteria | 1067 |
| 339 | Ga0207669_10415730 | 3300025937 | Bacteria | 1057 |
| 340 | Ga0207704_10006263 | 3300025938 | Bacteria | 5534 |
| 341 | Ga0207704_10567784 | 3300025938 | Bacteria | 924 |
| 342 | Ga0207691_10171370 | 3300025940 | Bacteria | 1900 |
| 343 | Ga0207691_10606844 | 3300025940 | Bacteria | 926 |
| 344 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 345 | Ga0207711_10002944 | 3300025941 | Bacteria | 14891 |
| 346 | Ga0207689_10293945 | 3300025942 | Bacteria | 1346 |
| 347 | Ga0207689_10400083 | 3300025942 | Bacteria | 1145 |
| 348 | Ga0207661_10588777 | 3300025944 | Bacteria | 1021 |
| 349 | Ga0207679_10012712 | 3300025945 | Bacteria | 5497 |
| 350 | Ga0207667_10000106 | 3300025949 | Bacteria | 133162 |
| 351 | Ga0207667_10043252 | 3300025949 | Bacteria | 4781 |
| 352 | Ga0207667_10070622 | 3300025949 | Bacteria | 3634 |
| 353 | Ga0207667_10091694 | 3300025949 | Bacteria | 3138 |
| 354 | Ga0207667_10128147 | 3300025949 | Bacteria | 2614 |
| 355 | Ga0207667_10173042 | 3300025949 | Bacteria | 2219 |
| 356 | Ga0207667_10215868 | 3300025949 | Bacteria | 1966 |
| 357 | Ga0207667_10221570 | 3300025949 | Bacteria | 1938 |
| 358 | Ga0207667_10338456 | 3300025949 | Bacteria | 1536 |
| 359 | Ga0207667_10921077 | 3300025949 | Bacteria | 865 |
| 360 | Ga0207651_10324631 | 3300025960 | Bacteria | 1288 |
| 361 | Ga0207651_10790529 | 3300025960 | Bacteria | 841 |
| 362 | Ga0207712_10173194 | 3300025961 | Bacteria | 1689 |
| 363 | Ga0207668_10249845 | 3300025972 | Bacteria | 1440 |
| 364 | Ga0207640_10110715 | 3300025981 | Bacteria | 1946 |
| 365 | Ga0207640_10206006 | 3300025981 | Bacteria | 1494 |
| 366 | Ga0207640_10712703 | 3300025981 | Bacteria | 861 |
| 367 | Ga0207658_10207346 | 3300025986 | Bacteria | 1640 |
| 368 | Ga0207677_10022754 | 3300026023 | Bacteria | 3858 |
| 369 | Ga0207677_10205256 | 3300026023 | Bacteria | 1569 |
| 370 | Ga0207703_10039615 | 3300026035 | Bacteria | 3766 |
| 371 | Ga0207639_10007079 | 3300026041 | Bacteria | 7650 |
| 372 | Ga0207639_10022836 | 3300026041 | Bacteria | 4510 |
| 373 | Ga0207639_10051462 | 3300026041 | Bacteria | 3133 |
| 374 | Ga0207639_10456328 | 3300026041 | Bacteria | 1161 |
| 375 | Ga0207639_10458611 | 3300026041 | Bacteria | 1158 |
| 376 | Ga0207702_10045794 | 3300026078 | Bacteria | 3680 |
| 377 | Ga0207702_10128865 | 3300026078 | Bacteria | 2275 |
| 378 | Ga0207702_10183578 | 3300026078 | Bacteria | 1928 |
| 379 | Ga0207702_10244340 | 3300026078 | Bacteria | 1683 |
| 380 | Ga0207702_11154633 | 3300026078 | Bacteria | 769 |
| 381 | Ga0207641_10018113 | 3300026088 | Bacteria | 5771 |
| 382 | Ga0207641_10051374 | 3300026088 | Bacteria | 3491 |
| 383 | Ga0207648_10018030 | 3300026089 | Bacteria | 6397 |
| 384 | Ga0207648_10288660 | 3300026089 | Bacteria | 1468 |
| 385 | Ga0207648_10444665 | 3300026089 | Bacteria | 1179 |
| 386 | Ga0207674_10074152 | 3300026116 | Bacteria | 3415 |
| 387 | Ga0207674_10412185 | 3300026116 | Bacteria | 1306 |
| 388 | Ga0207675_100332284 | 3300026118 | Bacteria | 1486 |
| 389 | Ga0207675_100829136 | 3300026118 | Bacteria | 939 |
| 390 | Ga0207683_10011944 | 3300026121 | Bacteria | 7413 |
| 391 | Ga0207683_10146834 | 3300026121 | Bacteria | 2127 |
| 392 | Ga0207683_10192413 | 3300026121 | Bacteria | 1852 |
| 393 | Ga0207683_10398651 | 3300026121 | Bacteria | 1266 |
| 394 | Ga0207698_10011195 | 3300026142 | Bacteria | 5805 |
| 395 | Ga0207698_10138264 | 3300026142 | Bacteria | 2094 |
| 396 | Ga0207698_10142313 | 3300026142 | Bacteria | 2068 |
| 397 | Ga0209813_10021479 | 3300027866 | Bacteria | 1816 |
| 398 | Ga0268266_10009800 | 3300028379 | Bacteria | 8426 |
| 399 | Ga0268266_10049299 | 3300028379 | Bacteria | 3611 |
| 400 | Ga0268266_10095391 | 3300028379 | Bacteria | 2612 |
| 401 | Ga0268266_10247947 | 3300028379 | Bacteria | 1646 |
| 402 | Ga0268266_10715328 | 3300028379 | Bacteria | 965 |
| 403 | Ga0268265_10245102 | 3300028380 | Bacteria | 1584 |
| 404 | Ga0268265_10456052 | 3300028380 | Bacteria | 1195 |
| 405 | Ga0268264_11256986 | 3300028381 | Bacteria | 750 |
| 406 | Ga0265334_10040829 | 3300028573 | Bacteria | 1815 |
| 407 | Ga0265318_10000125 | 3300028577 | Bacteria | 70978 |
| 408 | Ga0265323_10151707 | 3300028653 | Bacteria | 742 |
| 409 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 410 | Ga0265338_10011053 | 3300028800 | Bacteria | 10473 |
| 411 | Ga0265330_10009650 | 3300031235 | Bacteria | 4577 |
| 412 | Ga0265330_10266738 | 3300031235 | Bacteria | 721 |
| 413 | Ga0265332_10012624 | 3300031238 | Bacteria | 3746 |
| 414 | Ga0265332_10015641 | 3300031238 | Bacteria | 3349 |
| 415 | Ga0265332_10045584 | 3300031238 | Bacteria | 1890 |
| 416 | Ga0265328_10000120 | 3300031239 | Bacteria | 37260 |
| 417 | Ga0265328_10192501 | 3300031239 | Bacteria | 773 |
| 418 | Ga0265325_10000002 | 3300031241 | Bacteria | 396758 |
| 419 | Ga0265325_10117778 | 3300031241 | Bacteria | 1284 |
| 420 | Ga0265329_10022488 | 3300031242 | Bacteria | 2108 |
| 421 | Ga0265340_10004297 | 3300031247 | Bacteria | 7988 |
| 422 | Ga0265340_10034266 | 3300031247 | Bacteria | 2526 |
| 423 | Ga0265339_10000210 | 3300031249 | Bacteria | 48022 |
| 424 | Ga0265339_10148637 | 3300031249 | Bacteria | 1187 |
| 425 | Ga0265331_10000008 | 3300031250 | Bacteria | 324311 |
| 426 | Ga0265331_10007067 | 3300031250 | Bacteria | 6546 |
| 427 | Ga0265331_10027552 | 3300031250 | Bacteria | 2848 |
| 428 | Ga0265327_10000007 | 3300031251 | Bacteria | 678515 |
| 429 | Ga0265327_10000378 | 3300031251 | Bacteria | 83787 |
| 430 | Ga0265327_10000448 | 3300031251 | Bacteria | 74589 |
| 431 | Ga0265316_10000166 | 3300031344 | Bacteria | 74574 |
| 432 | Ga0265316_10029385 | 3300031344 | Bacteria | 4521 |
| 433 | Ga0265316_10365180 | 3300031344 | Bacteria | 1043 |
| 434 | Ga0307513_10382286 | 3300031456 | Bacteria | 1147 |
| 435 | Ga0265313_10003445 | 3300031595 | Bacteria | 12798 |
| 436 | Ga0265313_10029414 | 3300031595 | Bacteria | 2842 |
| 437 | Ga0265313_10037366 | 3300031595 | Bacteria | 2429 |
| 438 | Ga0265313_10226760 | 3300031595 | Bacteria | 769 |
| 439 | Ga0316575_10008759 | 3300031665 | Bacteria | 3693 |
| 440 | Ga0316579_10006719 | 3300031691 | Bacteria | 4711 |
| 441 | Ga0265314_10010428 | 3300031711 | Bacteria | 7751 |
| 442 | Ga0265314_10017005 | 3300031711 | Bacteria | 5720 |
| 443 | Ga0265314_10045723 | 3300031711 | Bacteria | 3093 |
| 444 | Ga0265314_10060570 | 3300031711 | Bacteria | 2583 |
| 445 | Ga0265314_10083518 | 3300031711 | Bacteria | 2099 |
| 446 | Ga0265314_10426199 | 3300031711 | Bacteria | 712 |
| 447 | Ga0265342_10004548 | 3300031712 | Bacteria | 10857 |
| 448 | Ga0265342_10021542 | 3300031712 | Bacteria | 4113 |
| 449 | Ga0265342_10042949 | 3300031712 | Bacteria | 2729 |
| 450 | Ga0265342_10079237 | 3300031712 | Bacteria | 1900 |
| 451 | Ga0316576_10137592 | 3300031727 | Bacteria | 1838 |
| 452 | Ga0316578_10008260 | 3300031728 | Bacteria | 5286 |
| 453 | Ga0307516_10032110 | 3300031730 | Bacteria | 5288 |
| 454 | Ga0307516_10053974 | 3300031730 | Bacteria | 3928 |
| 455 | Ga0316577_10007601 | 3300031733 | Bacteria | 5784 |
| 456 | Ga0307411_10401480 | 3300032005 | Bacteria | 1133 |
| 457 | Ga0316583_10008084 | 3300032133 | Bacteria | 3791 |
| 458 | Ga0316585_10097959 | 3300032137 | Bacteria | 961 |
| 459 | Ga0316593_10050086 | 3300032168 | Bacteria | 1408 |
| 460 | Ga0316593_10137636 | 3300032168 | Bacteria | 884 |
| 461 | Ga0316586_1024394 | 3300033527 | Bacteria | 1014 |
| 462 | Ga0316596_1009559 | 3300033541 | Bacteria | 2328 |
| 463 | Ga0373926_0033443 | 3300035083 | Bacteria | 1817 |
| 464 | Ga0373944_0250575 | 3300035089 | Bacteria | 653 |
| 465 | Ga0373923_0091651 | 3300035111 | Bacteria | 1330 |
| 466 | Ga0373943_0011712 | 3300035170 | Bacteria | 3948 |
| 467 | Ga0373942_0082712 | 3300035207 | Bacteria | 956 |
| 468 | Ga0316574_0069703 | 3300035398 | Bacteria | 2220 |
| 469 | Ga0316574_0286496 | 3300035398 | Bacteria | 1049 |
| 470 | Ga0373931_0017524 | 3300035691 | Bacteria | 3546 |
| 471 | Ga0373931_0208770 | 3300035691 | Bacteria | 1170 |
| 472 | Ga0373935_0013398 | 3300035692 | Bacteria | 4947 |
| 473 | Ga0373935_0758070 | 3300035692 | Bacteria | 715 |
| 474 | Ga0373935_0760682 | 3300035692 | Bacteria | 714 |
| 475 | Ga0373927_0073947 | 3300035695 | Bacteria | 2207 |
| 476 | Ga0373927_0345719 | 3300035695 | Bacteria | 980 |
| 477 | Ga0373933_0022090 | 3300035724 | Bacteria | 3622 |
| 478 | Ga0373947_0002762 | 3300035725 | Bacteria | 10503 |
| 479 | Ga0373937_0022231 | 3300036401 | Bacteria | 5700 |
| 480 | Ga0373937_0235702 | 3300036401 | Bacteria | 1724 |
| 481 | Ga0373937_0455629 | 3300036401 | Bacteria | 1215 |
| 482 | Ga0316582_0007371 | 3300036647 | Bacteria | 5851 |
| 483 | Ga0316582_0018675 | 3300036647 | Bacteria | 4041 |
| 484 | Ga0316584_0073425 | 3300036712 | Bacteria | 2564 |
| 485 | Ga0316584_0152083 | 3300036712 | Bacteria | 1722 |
| 486 | Ga0316584_0203146 | 3300036712 | Bacteria | 1461 |
| 487 | Ga0316584_0398402 | 3300036712 | Bacteria | 981 |
| 488 | Ga0373925_0002319 | 3300037068 | Bacteria | 15305 |
| 489 | Ga0373925_0301831 | 3300037068 | Bacteria | 1293 |
| 490 | Ga0373925_0507374 | 3300037068 | Bacteria | 990 |
| 491 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 492 | Ga0395899_0028713 | 3300037312 | Bacteria | 4186 |
| 493 | Ga0395899_0111167 | 3300037312 | Bacteria | 1970 |
| 494 | Ga0395899_0113465 | 3300037312 | Bacteria | 1946 |
| 495 | Ga0395899_0170756 | 3300037312 | Bacteria | 1531 |
| 496 | Ga0395900_0023024 | 3300037418 | Bacteria | 6375 |
| 497 | Ga0395900_0106335 | 3300037418 | Bacteria | 2882 |
| 498 | Ga0395900_0126165 | 3300037418 | Bacteria | 2625 |
| 499 | Ga0395900_0914888 | 3300037418 | Bacteria | 800 |
| 500 | Ga0395898_0027033 | 3300037466 | Bacteria | 5764 |
| 501 | Ga0395898_0127038 | 3300037466 | Bacteria | 2443 |
| 502 | Ga0395901_0025294 | 3300038443 | Bacteria | 6094 |
| 503 | Ga0395901_0026613 | 3300038443 | Bacteria | 5939 |
| 504 | Ga0395901_0035463 | 3300038443 | Bacteria | 5153 |
| 505 | Ga0395901_0104585 | 3300038443 | Bacteria | 2971 |
| 506 | Ga0436365_0412683 | 3300039437 | Bacteria | 137628 |
| 507 | Ga0436365_0583194 | 3300039437 | Bacteria | 93933 |
| 508 | Ga0436365_0622716 | 3300039437 | Bacteria | 758 |
| 509 | Ga0436360_0032462 | 3300039438 | Bacteria | 1027 |
| 510 | Ga0436360_0052066 | 3300039438 | Bacteria | 6744 |
| 511 | Ga0436360_0299898 | 3300039438 | Bacteria | 1563 |
| 512 | Ga0436360_1107921 | 3300039438 | Bacteria | 705 |
| 513 | Ga0436361_0331544 | 3300039447 | Bacteria | 5779 |
| 514 | Ga0436361_1016532 | 3300039447 | Bacteria | 20016 |
| 515 | Ga0439465_0271522 | 3300041413 | Bacteria | 630 |
| 516 | Ga0466969_0059802 | 3300044656 | Bacteria | 1853 |
| 517 | Ga0466972_0182774 | 3300044658 | Bacteria | 983 |
| 518 | Ga0466965_0355330 | 3300044683 | Bacteria | 803 |
| 519 | Ga0466963_0022801 | 3300044694 | Bacteria | 3969 |
| 520 | Ga0453684_0013252 | 3300044712 | Bacteria | 13428 |
| 521 | Ga0466957_0137190 | 3300044842 | Bacteria | 1573 |
| 522 | Ga0466967_0045841 | 3300045976 | Bacteria | 3802 |
| 523 | Ga0466967_0199478 | 3300045976 | Bacteria | 1894 |
| 524 | Ga0495592_0077637 | 3300046454 | Bacteria | 2407 |
| 525 | Ga0495650_0180970 | 3300046471 | Bacteria | 741 |
| 526 | Ga0495580_0006646 | 3300046472 | Bacteria | 9395 |
| 527 | Ga0495582_0019757 | 3300046473 | Bacteria | 3683 |
| 528 | Ga0495664_0068218 | 3300046477 | Bacteria | 2122 |
| 529 | Ga0495664_0078945 | 3300046477 | Bacteria | 1972 |
| 530 | Ga0495583_0144926 | 3300046506 | Bacteria | 987 |
| 531 | Ga0495606_0152282 | 3300046507 | Bacteria | 1356 |
| 532 | Ga0495628_0240644 | 3300046516 | Bacteria | 1354 |
| 533 | Ga0495652_0130500 | 3300046529 | Bacteria | 1990 |
| 534 | Ga0495654_0177094 | 3300046530 | Bacteria | 926 |
| 535 | Ga0495587_0089424 | 3300046536 | Bacteria | 1780 |
| 536 | Ga0495587_0120377 | 3300046536 | Bacteria | 1504 |
| 537 | Ga0495645_0025828 | 3300046543 | Bacteria | 4264 |
| 538 | Ga0495622_0027198 | 3300046557 | Bacteria | 2669 |
| 539 | Ga0495668_0027699 | 3300046616 | Bacteria | 3211 |
| 540 | Ga0495625_0128771 | 3300046660 | Bacteria | 1716 |
| 541 | Ga0495661_0128297 | 3300046665 | Bacteria | 1393 |
| 542 | Ga0495658_0000786 | 3300046683 | Bacteria | 17094 |
| 543 | Ga0495658_0304952 | 3300046683 | Bacteria | 1008 |
| 544 | Ga0495671_0247488 | 3300046692 | Bacteria | 861 |
| 545 | Ga0495649_0096524 | 3300046694 | Bacteria | 1573 |
| 546 | Ga0495589_0060561 | 3300046794 | Bacteria | 1859 |
| 547 | Ga0495581_0220315 | 3300047315 | Bacteria | 1109 |
| 548 | Ga0495674_0818516 | 3300047319 | Bacteria | 723 |
| 549 | Ga0495672_0302653 | 3300047320 | Bacteria | 757 |
| 550 | Ga0495675_0100779 | 3300047444 | Bacteria | 1808 |
| 551 | Ga0495677_0261284 | 3300047445 | Bacteria | 678 |
| 552 | Ga0495681_0190725 | 3300047470 | Bacteria | 837 |
| 553 | Ga0495686_0051514 | 3300047472 | Bacteria | 2583 |
| 554 | Ga0496100_1033004 | 3300048903 | Bacteria | 647 |
| 555 | Ga0496113_0707092 | 3300048916 | Bacteria | 804 |
| 556 | Ga0496115_0922846 | 3300048918 | Bacteria | 672 |
| 557 | Ga0496121_0001329 | 3300048924 | Bacteria | 42366 |
| 558 | Ga0496125_0014570 | 3300048928 | Bacteria | 7651 |
| 559 | Ga0496126_0013404 | 3300048929 | Bacteria | 8340 |
| 560 | Ga0496126_0023833 | 3300048929 | Bacteria | 5925 |
| 561 | Ga0496126_0224789 | 3300048929 | Bacteria | 1575 |
| 562 | Ga0495682_0007197 | 3300049460 | Bacteria | 4443 |
| 563 | Ga0501031_0190379 | 3300049568 | Bacteria | 1340 |
| 564 | Ga0501032_0134742 | 3300049569 | Bacteria | 1628 |
| 565 | Ga0501032_0373633 | 3300049569 | Bacteria | 917 |
| 566 | Ga0501032_0575055 | 3300049569 | Bacteria | 718 |
| 567 | Ga0501033_0007822 | 3300049570 | Bacteria | 8284 |
| 568 | Ga0501033_0026925 | 3300049570 | Bacteria | 4325 |
| 569 | Ga0501033_0203755 | 3300049570 | Bacteria | 1412 |
| 570 | Ga0501033_0537907 | 3300049570 | Bacteria | 806 |
| 571 | Ga0501033_0844885 | 3300049570 | Bacteria | 617 |
| 572 | Ga0501034_0012128 | 3300049571 | Bacteria | 8909 |
| 573 | Ga0501034_0022018 | 3300049571 | Bacteria | 6493 |
| 574 | Ga0501034_0148872 | 3300049571 | Bacteria | 2317 |
| 575 | Ga0501034_0179678 | 3300049571 | Bacteria | 2081 |
| 576 | Ga0501034_0273951 | 3300049571 | Bacteria | 1628 |
| 577 | Ga0501034_0347153 | 3300049571 | Bacteria | 1413 |
| 578 | Ga0501034_0587790 | 3300049571 | Bacteria | 1020 |
| 579 | Ga0501034_0848918 | 3300049571 | Bacteria | 803 |
| 580 | Ga0501036_0032242 | 3300049572 | Bacteria | 4427 |
| 581 | Ga0501036_0062239 | 3300049572 | Bacteria | 3161 |
| 582 | Ga0501036_0127765 | 3300049572 | Bacteria | 2146 |
| 583 | Ga0501037_0004982 | 3300049573 | Bacteria | 9654 |
| 584 | Ga0501037_0042046 | 3300049573 | Bacteria | 3360 |
| 585 | Ga0501037_0163451 | 3300049573 | Bacteria | 1586 |
| 586 | Ga0501037_0195455 | 3300049573 | Bacteria | 1431 |
| 587 | Ga0501037_0267913 | 3300049573 | Bacteria | 1192 |
| 588 | Ga0501037_0374380 | 3300049573 | Bacteria | 980 |
| 589 | Ga0501038_0016935 | 3300049574 | Bacteria | 6596 |
| 590 | Ga0501038_0084195 | 3300049574 | Bacteria | 2676 |
| 591 | Ga0501038_0095289 | 3300049574 | Bacteria | 2486 |
| 592 | Ga0501039_0145112 | 3300049575 | Bacteria | 1865 |
| 593 | Ga0501039_0159743 | 3300049575 | Bacteria | 1771 |
| 594 | Ga0501041_0441680 | 3300049577 | Bacteria | 826 |
| 595 | Ga0501042_0190091 | 3300049578 | Bacteria | 1481 |
| 596 | Ga0501043_0006812 | 3300049579 | Bacteria | 9120 |
| 597 | Ga0501043_0053675 | 3300049579 | Bacteria | 3165 |
| 598 | Ga0501043_0106668 | 3300049579 | Bacteria | 2200 |
| 599 | Ga0501043_0186019 | 3300049579 | Bacteria | 1617 |
| 600 | Ga0501046_0041043 | 3300049580 | Bacteria | 3694 |
| 601 | Ga0501046_0052245 | 3300049580 | Bacteria | 3221 |
| 602 | Ga0501046_0079038 | 3300049580 | Bacteria | 2544 |
| 603 | Ga0501046_0192059 | 3300049580 | Bacteria | 1523 |
| 604 | Ga0501047_0003552 | 3300049581 | Bacteria | 14724 |
| 605 | Ga0501047_0004810 | 3300049581 | Bacteria | 12698 |
| 606 | Ga0501047_0017577 | 3300049581 | Bacteria | 6852 |
| 607 | Ga0501047_0023081 | 3300049581 | Bacteria | 5972 |
| 608 | Ga0501047_0101831 | 3300049581 | Bacteria | 2751 |
| 609 | Ga0501047_0188144 | 3300049581 | Bacteria | 1929 |
| 610 | Ga0501047_0207020 | 3300049581 | Bacteria | 1821 |
| 611 | Ga0501047_0208303 | 3300049581 | Bacteria | 1814 |
| 612 | Ga0501047_0367506 | 3300049581 | Bacteria | 1274 |
| 613 | Ga0501047_0370312 | 3300049581 | Bacteria | 1267 |
| 614 | Ga0501047_0403510 | 3300049581 | Bacteria | 1200 |
| 615 | Ga0501047_0423375 | 3300049581 | Bacteria | 1163 |
| 616 | Ga0501047_0423578 | 3300049581 | Bacteria | 1162 |
| 617 | Ga0501047_0729706 | 3300049581 | Bacteria | 807 |
| 618 | Ga0501048_0047002 | 3300049582 | Bacteria | 3081 |
| 619 | Ga0501048_0588449 | 3300049582 | Bacteria | 799 |
| 620 | Ga0501067_0008586 | 3300049583 | Bacteria | 5662 |
| 621 | Ga0501067_0032197 | 3300049583 | Bacteria | 2910 |
| 622 | Ga0501067_0160031 | 3300049583 | Bacteria | 1254 |
| 623 | Ga0501068_0027961 | 3300049584 | Bacteria | 3332 |
| 624 | Ga0501068_0046942 | 3300049584 | Bacteria | 2604 |
| 625 | Ga0501068_0190510 | 3300049584 | Bacteria | 1299 |
| 626 | Ga0501069_0004797 | 3300049585 | Bacteria | 6998 |
| 627 | Ga0501069_0030658 | 3300049585 | Bacteria | 2954 |
| 628 | Ga0501069_0366144 | 3300049585 | Bacteria | 851 |
| 629 | Ga0501070_0000017 | 3300049586 | Bacteria | 173127 |
| 630 | Ga0501070_0018465 | 3300049586 | Bacteria | 5851 |
| 631 | Ga0501070_0023545 | 3300049586 | Bacteria | 5159 |
| 632 | Ga0501070_0023934 | 3300049586 | Bacteria | 5118 |
| 633 | Ga0501070_0132750 | 3300049586 | Bacteria | 2057 |
| 634 | Ga0501070_0490151 | 3300049586 | Bacteria | 988 |
| 635 | Ga0501071_0133031 | 3300049587 | Bacteria | 1849 |
| 636 | Ga0501071_0707638 | 3300049587 | Bacteria | 776 |
| 637 | Ga0501072_0007532 | 3300049588 | Bacteria | 8261 |
| 638 | Ga0501072_0054427 | 3300049588 | Bacteria | 3152 |
| 639 | Ga0501072_0489676 | 3300049588 | Bacteria | 973 |
| 640 | Ga0501073_0000774 | 3300049589 | Bacteria | 22725 |
| 641 | Ga0501073_0004084 | 3300049589 | Bacteria | 10948 |
| 642 | Ga0501073_0014201 | 3300049589 | Bacteria | 5784 |
| 643 | Ga0501073_0023292 | 3300049589 | Bacteria | 4447 |
| 644 | Ga0501073_0025337 | 3300049589 | Bacteria | 4254 |
| 645 | Ga0501073_0030670 | 3300049589 | Bacteria | 3838 |
| 646 | Ga0501073_0181336 | 3300049589 | Bacteria | 1457 |
| 647 | Ga0501074_0002018 | 3300049590 | Bacteria | 13990 |
| 648 | Ga0501074_0059868 | 3300049590 | Bacteria | 2743 |
| 649 | Ga0501074_0248877 | 3300049590 | Bacteria | 1264 |
| 650 | Ga0501079_0020834 | 3300049741 | Bacteria | 5013 |
| 651 | Ga0501079_0089875 | 3300049741 | Bacteria | 2379 |
| 652 | Ga0501080_0000333 | 3300049742 | Bacteria | 36064 |
| 653 | Ga0501080_0006334 | 3300049742 | Bacteria | 10621 |
| 654 | Ga0501080_0044966 | 3300049742 | Bacteria | 4110 |
| 655 | Ga0501080_0056991 | 3300049742 | Bacteria | 3638 |
| 656 | Ga0501080_0199115 | 3300049742 | Bacteria | 1839 |
| 657 | Ga0501080_0214786 | 3300049742 | Bacteria | 1762 |
| 658 | Ga0501080_0356266 | 3300049742 | Bacteria | 1320 |
| 659 | Ga0501080_0790186 | 3300049742 | Bacteria | 833 |
| 660 | Ga0501083_0072607 | 3300049744 | Bacteria | 2287 |
| 661 | Ga0501083_0200990 | 3300049744 | Bacteria | 1300 |
| 662 | Ga0501083_0333490 | 3300049744 | Bacteria | 986 |
| 663 | Ga0501083_0916891 | 3300049744 | Bacteria | 570 |
| 664 | Ga0501035_0001049 | 3300049822 | Bacteria | 28932 |
| 665 | Ga0501035_0012693 | 3300049822 | Bacteria | 7784 |
| 666 | Ga0501035_0016834 | 3300049822 | Bacteria | 6740 |
| 667 | Ga0501035_0019089 | 3300049822 | Bacteria | 6311 |
| 668 | Ga0501035_0049373 | 3300049822 | Bacteria | 3771 |
| 669 | Ga0501035_0056615 | 3300049822 | Bacteria | 3497 |
| 670 | Ga0501035_0146683 | 3300049822 | Bacteria | 2049 |
| 671 | Ga0501035_0191585 | 3300049822 | Bacteria | 1758 |
| 672 | Ga0501035_0504396 | 3300049822 | Bacteria | 995 |
| 673 | Ga0501044_0001245 | 3300049823 | Bacteria | 30224 |
| 674 | Ga0501044_0001370 | 3300049823 | Bacteria | 28586 |
| 675 | Ga0501044_0052068 | 3300049823 | Bacteria | 4220 |
| 676 | Ga0501044_0097356 | 3300049823 | Bacteria | 2963 |
| 677 | Ga0501044_0110732 | 3300049823 | Bacteria | 2754 |
| 678 | Ga0501044_0111932 | 3300049823 | Bacteria | 2737 |
| 679 | Ga0501044_0128268 | 3300049823 | Bacteria | 2532 |
| 680 | Ga0501044_0292011 | 3300049823 | Bacteria | 1561 |
| 681 | Ga0501044_0414556 | 3300049823 | Bacteria | 1258 |
| 682 | Ga0501044_1057020 | 3300049823 | Bacteria | 682 |
| 683 | nmdc:mga03683_1310_c2 | 3300050489 | Bacteria | 4937 |
| 684 | nmdc:mga03683_138765_c1 | 3300050489 | Bacteria | 1092 |
| 685 | nmdc:mga0yw44_605724_c1 | 3300050492 | Bacteria | 744 |
| 686 | nmdc:mga0k408_35812_c1 | 3300050493 | Bacteria | 2846 |
| 687 | nmdc:mga07m45_88931_c2 | 3300050496 | Bacteria | 1256 |
| 688 | Ga0500643_000017 | 3300053087 | Bacteria | 305781 |
| 689 | Ga0500643_028198 | 3300053087 | Bacteria | 1738 |
| 690 | Ga0500644_0026343 | 3300053088 | Bacteria | 1798 |
| 691 | Ga0500646_0027744 | 3300053090 | Bacteria | 1542 |
| 692 | Ga0500566_0244845 | 3300053094 | Bacteria | 876 |
| 693 | Ga0500562_000194 | 3300053108 | Bacteria | 16526 |
| 694 | Ga0500562_008365 | 3300053108 | Bacteria | 2613 |
| 695 | Ga0500592_018049 | 3300053116 | Bacteria | 1132 |
| 696 | Ga0500595_026534 | 3300053119 | Bacteria | 1995 |
| 697 | Ga0500642_0030073 | 3300053130 | Bacteria | 2257 |
| 698 | Ga0500652_053043 | 3300053131 | Bacteria | 1659 |
| 699 | Ga0500568_0029387 | 3300053139 | Bacteria | 2282 |
| 700 | Ga0500573_0000055 | 3300053140 | Bacteria | 82259 |
| 701 | Ga0500577_0097599 | 3300053142 | Bacteria | 1197 |
| 702 | Ga0500616_0066993 | 3300053153 | Bacteria | 1842 |
| 703 | Ga0500639_103245 | 3300053163 | Bacteria | 1398 |
| 704 | Ga0500576_132277 | 3300053725 | Bacteria | 964 |
| 705 | Ga0500645_001712 | 3300053730 | Bacteria | 10672 |
| 706 | Ga0500645_019975 | 3300053730 | Bacteria | 2079 |
| 707 | Ga0501084_0000288 | 3300054114 | Bacteria | 38135 |
| 708 | Ga0501084_0007244 | 3300054114 | Bacteria | 9144 |
| 709 | Ga0501084_0026675 | 3300054114 | Bacteria | 4823 |
| 710 | Ga0501084_0121710 | 3300054114 | Bacteria | 2194 |
| 711 | Ga0501084_0403800 | 3300054114 | Bacteria | 1155 |
| 712 | Ga0501082_0020561 | 3300060353 | Bacteria | 5689 |
| 713 | Ga0501082_0042317 | 3300060353 | Bacteria | 3927 |
| 714 | Ga0501082_0149628 | 3300060353 | Bacteria | 2027 |
| 715 | Ga0501082_0560580 | 3300060353 | Bacteria | 999 |
| 716 | Ga0501082_0649192 | 3300060353 | Bacteria | 923 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053725 | Ga0500576_132277 | Ga0500576_132277_25_543 | 159 |
| 2 | 3300047444 | Ga0495675_0100779 | Ga0495675_0100779_714_1229 | 161 |
| 3 | 3300049571 | Ga0501034_0347153 | Ga0501034_0347153_870_1403 | 161 |
| 4 | 3300031665 | Ga0316575_10008759 | Ga0316575_100087594 | 165 |
| 5 | 3300049586 | Ga0501070_0132750 | Ga0501070_0132750_1462_2013 | 165 |
| 6 | 3300053087 | Ga0500643_028198 | Ga0500643_028198_57_566 | 165 |
| 7 | 3300053108 | Ga0500562_008365 | Ga0500562_008365_553_1062 | 165 |
| 8 | 3300053153 | Ga0500616_0066993 | Ga0500616_0066993_695_1204 | 165 |
| 9 | 3300053730 | Ga0500645_001712 | Ga0500645_001712_9114_9623 | 165 |
| 10 | 3300005543 | Ga0070672_100429275 | Ga0070672_1004292752 | 166 |
| 11 | 3300005718 | Ga0068866_10050112 | Ga0068866_100501124 | 166 |
| 12 | 3300005840 | Ga0068870_10186449 | Ga0068870_101864492 | 166 |
| 13 | 3300005843 | Ga0068860_100139352 | Ga0068860_1001393522 | 166 |
| 14 | 3300006237 | Ga0097621_100000270 | Ga0097621_10000027026 | 166 |
| 15 | 3300006237 | Ga0097621_100017434 | Ga0097621_1000174344 | 166 |
| 16 | 3300006237 | Ga0097621_100040414 | Ga0097621_1000404144 | 166 |
| 17 | 3300006237 | Ga0097621_100065040 | Ga0097621_1000650402 | 166 |
| 18 | 3300006358 | Ga0068871_100004963 | Ga0068871_1000049638 | 166 |
| 19 | 3300006358 | Ga0068871_100008068 | Ga0068871_1000080688 | 166 |
| 20 | 3300006881 | Ga0068865_100009233 | Ga0068865_1000092336 | 166 |
| 21 | 3300009174 | Ga0105241_10985457 | Ga0105241_109854571 | 166 |
| 22 | 3300009176 | Ga0105242_10080115 | Ga0105242_100801153 | 166 |
| 23 | 3300017792 | Ga0163161_10029520 | Ga0163161_100295203 | 166 |
| 24 | 3300025899 | Ga0207642_10146555 | Ga0207642_101465552 | 166 |
| 25 | 3300025907 | Ga0207645_10162572 | Ga0207645_101625722 | 166 |
| 26 | 3300025924 | Ga0207694_10274019 | Ga0207694_102740192 | 166 |
| 27 | 3300025927 | Ga0207687_10780031 | Ga0207687_107800311 | 166 |
| 28 | 3300025934 | Ga0207686_10011116 | Ga0207686_100111163 | 166 |
| 29 | 3300025938 | Ga0207704_10006263 | Ga0207704_100062633 | 166 |
| 30 | 3300025940 | Ga0207691_10606844 | Ga0207691_106068442 | 166 |
| 31 | 3300025942 | Ga0207689_10293945 | Ga0207689_102939452 | 166 |
| 32 | 3300026023 | Ga0207677_10205256 | Ga0207677_102052561 | 166 |
| 33 | 3300026089 | Ga0207648_10018030 | Ga0207648_100180306 | 166 |
| 34 | 3300026121 | Ga0207683_10011944 | Ga0207683_100119444 | 166 |
| 35 | 3300028381 | Ga0268264_11256986 | Ga0268264_112569861 | 166 |
| 36 | 3300047472 | Ga0495686_0051514 | Ga0495686_0051514_882_1397 | 166 |
| 37 | 3300048929 | Ga0496126_0013404 | Ga0496126_0013404_548_1063 | 166 |
| 38 | 3300049581 | Ga0501047_0367506 | Ga0501047_0367506_98_622 | 166 |
| 39 | 3300049822 | Ga0501035_0016834 | Ga0501035_0016834_1687_2223 | 166 |
| 40 | 3300050496 | nmdc:mga07m45_88931_c2 | nmdc:mga07m45_88931_c2_286_801 | 166 |
| 41 | 3300005434 | Ga0070709_10227564 | Ga0070709_102275642 | 167 |
| 42 | 3300005435 | Ga0070714_100108291 | Ga0070714_1001082912 | 167 |
| 43 | 3300025929 | Ga0207664_10437401 | Ga0207664_104374012 | 167 |
| 44 | 3300031239 | Ga0265328_10000120 | Ga0265328_1000012011 | 167 |
| 45 | 3300031728 | Ga0316578_10008260 | Ga0316578_100082606 | 167 |
| 46 | 3300032168 | Ga0316593_10050086 | Ga0316593_100500863 | 167 |
| 47 | 3300033527 | Ga0316586_1024394 | Ga0316586_10243942 | 167 |
| 48 | 3300033541 | Ga0316596_1009559 | Ga0316596_10095593 | 167 |
| 49 | 3300035083 | Ga0373926_0033443 | Ga0373926_0033443_959_1501 | 167 |
| 50 | 3300035089 | Ga0373944_0250575 | Ga0373944_0250575_91_633 | 167 |
| 51 | 3300035170 | Ga0373943_0011712 | Ga0373943_0011712_607_1149 | 167 |
| 52 | 3300035398 | Ga0316574_0286496 | Ga0316574_0286496_482_997 | 167 |
| 53 | 3300035692 | Ga0373935_0013398 | Ga0373935_0013398_712_1254 | 167 |
| 54 | 3300035725 | Ga0373947_0002762 | Ga0373947_0002762_5563_6105 | 167 |
| 55 | 3300036712 | Ga0316584_0073425 | Ga0316584_0073425_1506_2021 | 167 |
| 56 | 3300037068 | Ga0373925_0002319 | Ga0373925_0002319_5374_5916 | 167 |
| 57 | 3300037068 | Ga0373925_0301831 | Ga0373925_0301831_512_1054 | 167 |
| 58 | 3300039438 | Ga0436360_1107921 | Ga0436360_1107921_79_621 | 167 |
| 59 | 3300046472 | Ga0495580_0006646 | Ga0495580_0006646_6116_6658 | 167 |
| 60 | 3300046473 | Ga0495582_0019757 | Ga0495582_0019757_1353_1895 | 167 |
| 61 | 3300046683 | Ga0495658_0000786 | Ga0495658_0000786_7417_7959 | 167 |
| 62 | 3300047315 | Ga0495581_0220315 | Ga0495581_0220315_386_928 | 167 |
| 63 | 3300047319 | Ga0495674_0818516 | Ga0495674_0818516_125_667 | 167 |
| 64 | 3300053131 | Ga0500652_053043 | Ga0500652_053043_787_1311 | 167 |
| 65 | iso_pu_bacteria | 2643221614 | 2644087584 | 167 |
| 66 | iso_pu_bacteria | 2643221661 | 2644344372 | 167 |
| 67 | iso_pu_bacteria | 2643221666 | 2644366943 | 167 |
| 68 | 3300001979 | JGI24740J21852_10084318 | JGI24740J21852_100843181 | 168 |
| 69 | 3300002067 | JGI24735J21928_10132198 | JGI24735J21928_101321981 | 168 |
| 70 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_100003510 | 168 |
| 71 | 3300003215 | JGI25153J46596_10000362 | JGI25153J46596_1000036211 | 168 |
| 72 | 3300003794 | Ga0055531_10026506 | Ga0055531_100265062 | 168 |
| 73 | 3300004799 | Ga0058863_11751868 | Ga0058863_117518682 | 168 |
| 74 | 3300005262 | Ga0065165_1044999 | Ga0065165_10449992 | 168 |
| 75 | 3300005327 | Ga0070658_10068667 | Ga0070658_100686673 | 168 |
| 76 | 3300005327 | Ga0070658_10073106 | Ga0070658_100731062 | 168 |
| 77 | 3300005327 | Ga0070658_10158451 | Ga0070658_101584513 | 168 |
| 78 | 3300005328 | Ga0070676_10035640 | Ga0070676_100356402 | 168 |
| 79 | 3300005328 | Ga0070676_10285350 | Ga0070676_102853502 | 168 |
| 80 | 3300005329 | Ga0070683_100033947 | Ga0070683_1000339472 | 168 |
| 81 | 3300005329 | Ga0070683_100207763 | Ga0070683_1002077632 | 168 |
| 82 | 3300005329 | Ga0070683_100494320 | Ga0070683_1004943201 | 168 |
| 83 | 3300005330 | Ga0070690_100115009 | Ga0070690_1001150092 | 168 |
| 84 | 3300005333 | Ga0070677_10110348 | Ga0070677_101103482 | 168 |
| 85 | 3300005334 | Ga0068869_100131986 | Ga0068869_1001319862 | 168 |
| 86 | 3300005334 | Ga0068869_100397420 | Ga0068869_1003974202 | 168 |
| 87 | 3300005334 | Ga0068869_100943635 | Ga0068869_1009436351 | 168 |
| 88 | 3300005335 | Ga0070666_10073561 | Ga0070666_100735614 | 168 |
| 89 | 3300005335 | Ga0070666_10168118 | Ga0070666_101681182 | 168 |
| 90 | 3300005336 | Ga0070680_100006785 | Ga0070680_1000067854 | 168 |
| 91 | 3300005336 | Ga0070680_100019163 | Ga0070680_1000191632 | 168 |
| 92 | 3300005336 | Ga0070680_100169100 | Ga0070680_1001691002 | 168 |
| 93 | 3300005336 | Ga0070680_100761467 | Ga0070680_1007614671 | 168 |
| 94 | 3300005337 | Ga0070682_100232679 | Ga0070682_1002326791 | 168 |
| 95 | 3300005337 | Ga0070682_100990295 | Ga0070682_1009902951 | 168 |
| 96 | 3300005338 | Ga0068868_100038243 | Ga0068868_1000382431 | 168 |
| 97 | 3300005338 | Ga0068868_100057362 | Ga0068868_1000573624 | 168 |
| 98 | 3300005338 | Ga0068868_100158380 | Ga0068868_1001583802 | 168 |
| 99 | 3300005339 | Ga0070660_100013047 | Ga0070660_1000130474 | 168 |
| 100 | 3300005339 | Ga0070660_100053117 | Ga0070660_1000531174 | 168 |
| 101 | 3300005341 | Ga0070691_10006515 | Ga0070691_100065154 | 168 |
| 102 | 3300005341 | Ga0070691_10033661 | Ga0070691_100336613 | 168 |
| 103 | 3300005344 | Ga0070661_100053235 | Ga0070661_1000532354 | 168 |
| 104 | 3300005344 | Ga0070661_100279089 | Ga0070661_1002790892 | 168 |
| 105 | 3300005354 | Ga0070675_100117750 | Ga0070675_1001177502 | 168 |
| 106 | 3300005354 | Ga0070675_100158737 | Ga0070675_1001587373 | 168 |
| 107 | 3300005355 | Ga0070671_100135004 | Ga0070671_1001350042 | 168 |
| 108 | 3300005355 | Ga0070671_100343986 | Ga0070671_1003439861 | 168 |
| 109 | 3300005356 | Ga0070674_100606420 | Ga0070674_1006064201 | 168 |
| 110 | 3300005356 | Ga0070674_100771809 | Ga0070674_1007718091 | 168 |
| 111 | 3300005364 | Ga0070673_100158736 | Ga0070673_1001587362 | 168 |
| 112 | 3300005364 | Ga0070673_101207637 | Ga0070673_1012076371 | 168 |
| 113 | 3300005366 | Ga0070659_100033717 | Ga0070659_1000337173 | 168 |
| 114 | 3300005366 | Ga0070659_100650536 | Ga0070659_1006505361 | 168 |
| 115 | 3300005367 | Ga0070667_100034132 | Ga0070667_1000341326 | 168 |
| 116 | 3300005436 | Ga0070713_100159253 | Ga0070713_1001592532 | 168 |
| 117 | 3300005437 | Ga0070710_10474489 | Ga0070710_104744891 | 168 |
| 118 | 3300005441 | Ga0070700_100533575 | Ga0070700_1005335751 | 168 |
| 119 | 3300005445 | Ga0070708_100249640 | Ga0070708_1002496402 | 168 |
| 120 | 3300005456 | Ga0070678_100008608 | Ga0070678_1000086086 | 168 |
| 121 | 3300005456 | Ga0070678_100151089 | Ga0070678_1001510893 | 168 |
| 122 | 3300005456 | Ga0070678_100189794 | Ga0070678_1001897941 | 168 |
| 123 | 3300005456 | Ga0070678_100403021 | Ga0070678_1004030212 | 168 |
| 124 | 3300005456 | Ga0070678_100599862 | Ga0070678_1005998621 | 168 |
| 125 | 3300005457 | Ga0070662_100690571 | Ga0070662_1006905711 | 168 |
| 126 | 3300005457 | Ga0070662_100726784 | Ga0070662_1007267841 | 168 |
| 127 | 3300005458 | Ga0070681_10000002 | Ga0070681_10000002509 | 168 |
| 128 | 3300005458 | Ga0070681_10003070 | Ga0070681_1000307010 | 168 |
| 129 | 3300005458 | Ga0070681_10072889 | Ga0070681_100728893 | 168 |
| 130 | 3300005458 | Ga0070681_10121171 | Ga0070681_101211712 | 168 |
| 131 | 3300005458 | Ga0070681_10410599 | Ga0070681_104105992 | 168 |
| 132 | 3300005458 | Ga0070681_10427701 | Ga0070681_104277012 | 168 |
| 133 | 3300005459 | Ga0068867_100007771 | Ga0068867_1000077718 | 168 |
| 134 | 3300005459 | Ga0068867_100088193 | Ga0068867_1000881934 | 168 |
| 135 | 3300005459 | Ga0068867_100397773 | Ga0068867_1003977731 | 168 |
| 136 | 3300005459 | Ga0068867_100634065 | Ga0068867_1006340651 | 168 |
| 137 | 3300005466 | Ga0070685_11135120 | Ga0070685_111351201 | 168 |
| 138 | 3300005518 | Ga0070699_100385633 | Ga0070699_1003856331 | 168 |
| 139 | 3300005530 | Ga0070679_100000035 | Ga0070679_10000003576 | 168 |
| 140 | 3300005530 | Ga0070679_100004953 | Ga0070679_1000049536 | 168 |
| 141 | 3300005530 | Ga0070679_100014205 | Ga0070679_1000142055 | 168 |
| 142 | 3300005530 | Ga0070679_100039445 | Ga0070679_1000394454 | 168 |
| 143 | 3300005535 | Ga0070684_100119853 | Ga0070684_1001198533 | 168 |
| 144 | 3300005535 | Ga0070684_100412945 | Ga0070684_1004129452 | 168 |
| 145 | 3300005536 | Ga0070697_100020390 | Ga0070697_1000203904 | 168 |
| 146 | 3300005539 | Ga0068853_100036211 | Ga0068853_1000362113 | 168 |
| 147 | 3300005539 | Ga0068853_100267120 | Ga0068853_1002671202 | 168 |
| 148 | 3300005539 | Ga0068853_100291840 | Ga0068853_1002918402 | 168 |
| 149 | 3300005539 | Ga0068853_100793324 | Ga0068853_1007933241 | 168 |
| 150 | 3300005545 | Ga0070695_101421002 | Ga0070695_1014210021 | 168 |
| 151 | 3300005547 | Ga0070693_100096925 | Ga0070693_1000969252 | 168 |
| 152 | 3300005547 | Ga0070693_100149993 | Ga0070693_1001499932 | 168 |
| 153 | 3300005547 | Ga0070693_100320061 | Ga0070693_1003200612 | 168 |
| 154 | 3300005548 | Ga0070665_100000322 | Ga0070665_10000032210 | 168 |
| 155 | 3300005548 | Ga0070665_100043912 | Ga0070665_1000439122 | 168 |
| 156 | 3300005548 | Ga0070665_100057177 | Ga0070665_1000571773 | 168 |
| 157 | 3300005548 | Ga0070665_100136234 | Ga0070665_1001362342 | 168 |
| 158 | 3300005548 | Ga0070665_100213662 | Ga0070665_1002136622 | 168 |
| 159 | 3300005548 | Ga0070665_100356014 | Ga0070665_1003560142 | 168 |
| 160 | 3300005563 | Ga0068855_100000038 | Ga0068855_10000003874 | 168 |
| 161 | 3300005563 | Ga0068855_100016691 | Ga0068855_1000166912 | 168 |
| 162 | 3300005563 | Ga0068855_100022893 | Ga0068855_1000228938 | 168 |
| 163 | 3300005563 | Ga0068855_100176837 | Ga0068855_1001768372 | 168 |
| 164 | 3300005563 | Ga0068855_100241094 | Ga0068855_1002410943 | 168 |
| 165 | 3300005563 | Ga0068855_100431255 | Ga0068855_1004312552 | 168 |
| 166 | 3300005563 | Ga0068855_100624837 | Ga0068855_1006248372 | 168 |
| 167 | 3300005563 | Ga0068855_101073526 | Ga0068855_1010735262 | 168 |
| 168 | 3300005564 | Ga0070664_100039851 | Ga0070664_1000398513 | 168 |
| 169 | 3300005578 | Ga0068854_100463577 | Ga0068854_1004635772 | 168 |
| 170 | 3300005578 | Ga0068854_100692116 | Ga0068854_1006921161 | 168 |
| 171 | 3300005578 | Ga0068854_100965265 | Ga0068854_1009652651 | 168 |
| 172 | 3300005578 | Ga0068854_101091332 | Ga0068854_1010913321 | 168 |
| 173 | 3300005614 | Ga0068856_100173470 | Ga0068856_1001734703 | 168 |
| 174 | 3300005614 | Ga0068856_100217518 | Ga0068856_1002175183 | 168 |
| 175 | 3300005614 | Ga0068856_100256297 | Ga0068856_1002562973 | 168 |
| 176 | 3300005614 | Ga0068856_100400148 | Ga0068856_1004001482 | 168 |
| 177 | 3300005614 | Ga0068856_100548606 | Ga0068856_1005486062 | 168 |
| 178 | 3300005614 | Ga0068856_100721512 | Ga0068856_1007215122 | 168 |
| 179 | 3300005614 | Ga0068856_101291640 | Ga0068856_1012916402 | 168 |
| 180 | 3300005615 | Ga0070702_100173141 | Ga0070702_1001731411 | 168 |
| 181 | 3300005616 | Ga0068852_100230981 | Ga0068852_1002309812 | 168 |
| 182 | 3300005617 | Ga0068859_100380549 | Ga0068859_1003805492 | 168 |
| 183 | 3300005618 | Ga0068864_101788348 | Ga0068864_1017883481 | 168 |
| 184 | 3300005719 | Ga0068861_100220098 | Ga0068861_1002200983 | 168 |
| 185 | 3300005834 | Ga0068851_10188533 | Ga0068851_101885332 | 168 |
| 186 | 3300005841 | Ga0068863_100028187 | Ga0068863_1000281874 | 168 |
| 187 | 3300005841 | Ga0068863_100072686 | Ga0068863_1000726863 | 168 |
| 188 | 3300005842 | Ga0068858_100121471 | Ga0068858_1001214712 | 168 |
| 189 | 3300005844 | Ga0068862_100560421 | Ga0068862_1005604212 | 168 |
| 190 | 3300005937 | Ga0081455_10004726 | Ga0081455_100047264 | 168 |
| 191 | 3300005937 | Ga0081455_10015332 | Ga0081455_100153325 | 168 |
| 192 | 3300006042 | Ga0075368_10130818 | Ga0075368_101308182 | 168 |
| 193 | 3300006051 | Ga0075364_10195880 | Ga0075364_101958802 | 168 |
| 194 | 3300006175 | Ga0070712_100401652 | Ga0070712_1004016521 | 168 |
| 195 | 3300006177 | Ga0075362_10100852 | Ga0075362_101008522 | 168 |
| 196 | 3300006195 | Ga0075366_10025120 | Ga0075366_100251204 | 168 |
| 197 | 3300006195 | Ga0075366_10076019 | Ga0075366_100760192 | 168 |
| 198 | 3300006237 | Ga0097621_100026161 | Ga0097621_1000261615 | 168 |
| 199 | 3300006237 | Ga0097621_100108423 | Ga0097621_1001084235 | 168 |
| 200 | 3300006237 | Ga0097621_100173694 | Ga0097621_1001736943 | 168 |
| 201 | 3300006237 | Ga0097621_100324292 | Ga0097621_1003242922 | 168 |
| 202 | 3300006237 | Ga0097621_100739948 | Ga0097621_1007399481 | 168 |
| 203 | 3300006358 | Ga0068871_100001246 | Ga0068871_10000124612 | 168 |
| 204 | 3300006358 | Ga0068871_100313372 | Ga0068871_1003133722 | 168 |
| 205 | 3300006358 | Ga0068871_100775055 | Ga0068871_1007750551 | 168 |
| 206 | 3300006846 | Ga0075430_100435485 | Ga0075430_1004354851 | 168 |
| 207 | 3300006881 | Ga0068865_100565311 | Ga0068865_1005653111 | 168 |
| 208 | 3300006931 | Ga0097620_100380580 | Ga0097620_1003805802 | 168 |
| 209 | 3300007265 | Ga0099794_10029829 | Ga0099794_100298291 | 168 |
| 210 | 3300007788 | Ga0099795_10089700 | Ga0099795_100897002 | 168 |
| 211 | 3300009093 | Ga0105240_10000811 | Ga0105240_100008111 | 168 |
| 212 | 3300009093 | Ga0105240_10024659 | Ga0105240_100246598 | 168 |
| 213 | 3300009093 | Ga0105240_10098517 | Ga0105240_100985172 | 168 |
| 214 | 3300009093 | Ga0105240_10119729 | Ga0105240_101197292 | 168 |
| 215 | 3300009093 | Ga0105240_10120223 | Ga0105240_101202232 | 168 |
| 216 | 3300009093 | Ga0105240_10331431 | Ga0105240_103314312 | 168 |
| 217 | 3300009093 | Ga0105240_10729961 | Ga0105240_107299612 | 168 |
| 218 | 3300009093 | Ga0105240_10752730 | Ga0105240_107527302 | 168 |
| 219 | 3300009094 | Ga0111539_10549739 | Ga0111539_105497392 | 168 |
| 220 | 3300009101 | Ga0105247_10616997 | Ga0105247_106169971 | 168 |
| 221 | 3300009101 | Ga0105247_10727352 | Ga0105247_107273521 | 168 |
| 222 | 3300009174 | Ga0105241_10058504 | Ga0105241_100585044 | 168 |
| 223 | 3300009174 | Ga0105241_10221743 | Ga0105241_102217432 | 168 |
| 224 | 3300009176 | Ga0105242_10031665 | Ga0105242_100316653 | 168 |
| 225 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011360 | 168 |
| 226 | 3300009177 | Ga0105248_10023048 | Ga0105248_100230484 | 168 |
| 227 | 3300009177 | Ga0105248_10197276 | Ga0105248_101972761 | 168 |
| 228 | 3300009177 | Ga0105248_10338310 | Ga0105248_103383102 | 168 |
| 229 | 3300009177 | Ga0105248_10528402 | Ga0105248_105284022 | 168 |
| 230 | 3300009545 | Ga0105237_10168332 | Ga0105237_101683322 | 168 |
| 231 | 3300009545 | Ga0105237_10202867 | Ga0105237_102028672 | 168 |
| 232 | 3300009545 | Ga0105237_10253338 | Ga0105237_102533382 | 168 |
| 233 | 3300009545 | Ga0105237_10286443 | Ga0105237_102864432 | 168 |
| 234 | 3300009545 | Ga0105237_10520761 | Ga0105237_105207611 | 168 |
| 235 | 3300009551 | Ga0105238_10017545 | Ga0105238_100175452 | 168 |
| 236 | 3300009551 | Ga0105238_10023226 | Ga0105238_100232261 | 168 |
| 237 | 3300009551 | Ga0105238_10023345 | Ga0105238_100233454 | 168 |
| 238 | 3300009551 | Ga0105238_10040277 | Ga0105238_100402775 | 168 |
| 239 | 3300009551 | Ga0105238_10126332 | Ga0105238_101263323 | 168 |
| 240 | 3300009551 | Ga0105238_10225310 | Ga0105238_102253103 | 168 |
| 241 | 3300009551 | Ga0105238_10268138 | Ga0105238_102681383 | 168 |
| 242 | 3300009551 | Ga0105238_10409055 | Ga0105238_104090552 | 168 |
| 243 | 3300009979 | Ga0105032_110166 | Ga0105032_1101661 | 168 |
| 244 | 3300010159 | Ga0099796_10090638 | Ga0099796_100906381 | 168 |
| 245 | 3300010375 | Ga0105239_10013755 | Ga0105239_100137554 | 168 |
| 246 | 3300010375 | Ga0105239_10050719 | Ga0105239_100507192 | 168 |
| 247 | 3300010375 | Ga0105239_10239180 | Ga0105239_102391802 | 168 |
| 248 | 3300010375 | Ga0105239_10249747 | Ga0105239_102497472 | 168 |
| 249 | 3300010375 | Ga0105239_10288313 | Ga0105239_102883131 | 168 |
| 250 | 3300010375 | Ga0105239_10295637 | Ga0105239_102956372 | 168 |
| 251 | 3300010375 | Ga0105239_10329723 | Ga0105239_103297232 | 168 |
| 252 | 3300010375 | Ga0105239_10695239 | Ga0105239_106952392 | 168 |
| 253 | 3300011119 | Ga0105246_10003863 | Ga0105246_100038631 | 168 |
| 254 | 3300011119 | Ga0105246_10008743 | Ga0105246_100087437 | 168 |
| 255 | 3300011119 | Ga0105246_10158827 | Ga0105246_101588272 | 168 |
| 256 | 3300011119 | Ga0105246_10307077 | Ga0105246_103070772 | 168 |
| 257 | 3300013100 | Ga0157373_10054979 | Ga0157373_100549794 | 168 |
| 258 | 3300013100 | Ga0157373_10179545 | Ga0157373_101795452 | 168 |
| 259 | 3300013100 | Ga0157373_10181968 | Ga0157373_101819683 | 168 |
| 260 | 3300013100 | Ga0157373_10189989 | Ga0157373_101899893 | 168 |
| 261 | 3300013100 | Ga0157373_10347984 | Ga0157373_103479841 | 168 |
| 262 | 3300013104 | Ga0157370_10015573 | Ga0157370_100155734 | 168 |
| 263 | 3300013104 | Ga0157370_10021189 | Ga0157370_100211899 | 168 |
| 264 | 3300013104 | Ga0157370_10030406 | Ga0157370_100304064 | 168 |
| 265 | 3300013104 | Ga0157370_10280674 | Ga0157370_102806743 | 168 |
| 266 | 3300013104 | Ga0157370_10295092 | Ga0157370_102950922 | 168 |
| 267 | 3300013104 | Ga0157370_10536870 | Ga0157370_105368702 | 168 |
| 268 | 3300013105 | Ga0157369_10012438 | Ga0157369_100124383 | 168 |
| 269 | 3300013105 | Ga0157369_10018818 | Ga0157369_100188183 | 168 |
| 270 | 3300013105 | Ga0157369_10179243 | Ga0157369_101792433 | 168 |
| 271 | 3300013105 | Ga0157369_10234935 | Ga0157369_102349352 | 168 |
| 272 | 3300013105 | Ga0157369_10367091 | Ga0157369_103670911 | 168 |
| 273 | 3300013105 | Ga0157369_10671519 | Ga0157369_106715192 | 168 |
| 274 | 3300013296 | Ga0157374_10164342 | Ga0157374_101643422 | 168 |
| 275 | 3300013296 | Ga0157374_10502181 | Ga0157374_105021811 | 168 |
| 276 | 3300013296 | Ga0157374_10761745 | Ga0157374_107617452 | 168 |
| 277 | 3300013297 | Ga0157378_10046417 | Ga0157378_100464176 | 168 |
| 278 | 3300013297 | Ga0157378_10172713 | Ga0157378_101727132 | 168 |
| 279 | 3300013297 | Ga0157378_10204427 | Ga0157378_102044272 | 168 |
| 280 | 3300013297 | Ga0157378_10572345 | Ga0157378_105723451 | 168 |
| 281 | 3300013306 | Ga0163162_10076766 | Ga0163162_100767662 | 168 |
| 282 | 3300013306 | Ga0163162_10104104 | Ga0163162_101041043 | 168 |
| 283 | 3300013306 | Ga0163162_10316708 | Ga0163162_103167081 | 168 |
| 284 | 3300013306 | Ga0163162_11201673 | Ga0163162_112016731 | 168 |
| 285 | 3300013306 | Ga0163162_11598777 | Ga0163162_115987772 | 168 |
| 286 | 3300013306 | Ga0163162_12064324 | Ga0163162_120643242 | 168 |
| 287 | 3300013307 | Ga0157372_10003810 | Ga0157372_100038104 | 168 |
| 288 | 3300013307 | Ga0157372_10009068 | Ga0157372_100090682 | 168 |
| 289 | 3300013307 | Ga0157372_10060167 | Ga0157372_100601674 | 168 |
| 290 | 3300013307 | Ga0157372_10453199 | Ga0157372_104531992 | 168 |
| 291 | 3300013307 | Ga0157372_10681606 | Ga0157372_106816062 | 168 |
| 292 | 3300013307 | Ga0157372_11105412 | Ga0157372_111054121 | 168 |
| 293 | 3300013308 | Ga0157375_10349546 | Ga0157375_103495462 | 168 |
| 294 | 3300013308 | Ga0157375_10530579 | Ga0157375_105305792 | 168 |
| 295 | 3300014325 | Ga0163163_10000004 | Ga0163163_1000000413 | 168 |
| 296 | 3300014325 | Ga0163163_10135841 | Ga0163163_101358411 | 168 |
| 297 | 3300014326 | Ga0157380_10636452 | Ga0157380_106364522 | 168 |
| 298 | 3300014968 | Ga0157379_10032277 | Ga0157379_100322773 | 168 |
| 299 | 3300014968 | Ga0157379_10480513 | Ga0157379_104805132 | 168 |
| 300 | 3300014968 | Ga0157379_10532001 | Ga0157379_105320012 | 168 |
| 301 | 3300014969 | Ga0157376_10196304 | Ga0157376_101963042 | 168 |
| 302 | 3300014969 | Ga0157376_10244420 | Ga0157376_102444202 | 168 |
| 303 | 3300017792 | Ga0163161_10626802 | Ga0163161_106268021 | 168 |
| 304 | 3300020070 | Ga0206356_10376855 | Ga0206356_103768552 | 168 |
| 305 | 3300021361 | Ga0213872_10013025 | Ga0213872_100130253 | 168 |
| 306 | 3300021361 | Ga0213872_10016435 | Ga0213872_100164352 | 168 |
| 307 | 3300021384 | Ga0213876_10000131 | Ga0213876_1000013135 | 168 |
| 308 | 3300021384 | Ga0213876_10000223 | Ga0213876_1000022358 | 168 |
| 309 | 3300025231 | Ga0207427_105282 | Ga0207427_1052822 | 168 |
| 310 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006505 | 168 |
| 311 | 3300025261 | Ga0209233_1003621 | Ga0209233_10036213 | 168 |
| 312 | 3300025272 | Ga0209455_1010456 | Ga0209455_10104562 | 168 |
| 313 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008455 | 168 |
| 314 | 3300025297 | Ga0209758_1003752 | Ga0209758_10037524 | 168 |
| 315 | 3300025297 | Ga0209758_1084595 | Ga0209758_10845952 | 168 |
| 316 | 3300025298 | Ga0209050_1000053 | Ga0209050_1000053128 | 168 |
| 317 | 3300025304 | Ga0209257_1000419 | Ga0209257_100041920 | 168 |
| 318 | 3300025898 | Ga0207692_10147698 | Ga0207692_101476981 | 168 |
| 319 | 3300025900 | Ga0207710_10080081 | Ga0207710_100800813 | 168 |
| 320 | 3300025900 | Ga0207710_10197057 | Ga0207710_101970572 | 168 |
| 321 | 3300025903 | Ga0207680_10032102 | Ga0207680_100321022 | 168 |
| 322 | 3300025903 | Ga0207680_10082795 | Ga0207680_100827952 | 168 |
| 323 | 3300025904 | Ga0207647_10105871 | Ga0207647_101058712 | 168 |
| 324 | 3300025908 | Ga0207643_10173027 | Ga0207643_101730272 | 168 |
| 325 | 3300025909 | Ga0207705_10000039 | Ga0207705_10000039177 | 168 |
| 326 | 3300025909 | Ga0207705_10009613 | Ga0207705_100096132 | 168 |
| 327 | 3300025909 | Ga0207705_10312637 | Ga0207705_103126372 | 168 |
| 328 | 3300025911 | Ga0207654_10045253 | Ga0207654_100452532 | 168 |
| 329 | 3300025911 | Ga0207654_10325848 | Ga0207654_103258482 | 168 |
| 330 | 3300025911 | Ga0207654_10610420 | Ga0207654_106104201 | 168 |
| 331 | 3300025911 | Ga0207654_10807849 | Ga0207654_108078491 | 168 |
| 332 | 3300025912 | Ga0207707_10000002 | Ga0207707_10000002449 | 168 |
| 333 | 3300025912 | Ga0207707_10001894 | Ga0207707_1000189419 | 168 |
| 334 | 3300025912 | Ga0207707_10060914 | Ga0207707_100609142 | 168 |
| 335 | 3300025912 | Ga0207707_10103499 | Ga0207707_101034992 | 168 |
| 336 | 3300025912 | Ga0207707_10134172 | Ga0207707_101341722 | 168 |
| 337 | 3300025912 | Ga0207707_11082288 | Ga0207707_110822881 | 168 |
| 338 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012569 | 168 |
| 339 | 3300025913 | Ga0207695_10044089 | Ga0207695_100440891 | 168 |
| 340 | 3300025913 | Ga0207695_10048638 | Ga0207695_100486384 | 168 |
| 341 | 3300025913 | Ga0207695_10079077 | Ga0207695_100790774 | 168 |
| 342 | 3300025913 | Ga0207695_10088395 | Ga0207695_100883952 | 168 |
| 343 | 3300025913 | Ga0207695_10096933 | Ga0207695_100969332 | 168 |
| 344 | 3300025913 | Ga0207695_10166309 | Ga0207695_101663092 | 168 |
| 345 | 3300025913 | Ga0207695_10355867 | Ga0207695_103558672 | 168 |
| 346 | 3300025913 | Ga0207695_10611593 | Ga0207695_106115931 | 168 |
| 347 | 3300025913 | Ga0207695_10615498 | Ga0207695_106154982 | 168 |
| 348 | 3300025913 | Ga0207695_10665892 | Ga0207695_106658922 | 168 |
| 349 | 3300025914 | Ga0207671_10132903 | Ga0207671_101329032 | 168 |
| 350 | 3300025914 | Ga0207671_10155108 | Ga0207671_101551082 | 168 |
| 351 | 3300025914 | Ga0207671_10363464 | Ga0207671_103634642 | 168 |
| 352 | 3300025914 | Ga0207671_10446785 | Ga0207671_104467852 | 168 |
| 353 | 3300025917 | Ga0207660_10000299 | Ga0207660_100002997 | 168 |
| 354 | 3300025917 | Ga0207660_10003148 | Ga0207660_1000314810 | 168 |
| 355 | 3300025919 | Ga0207657_10000182 | Ga0207657_1000018241 | 168 |
| 356 | 3300025919 | Ga0207657_10011088 | Ga0207657_1001108810 | 168 |
| 357 | 3300025919 | Ga0207657_10205154 | Ga0207657_102051541 | 168 |
| 358 | 3300025919 | Ga0207657_10693657 | Ga0207657_106936571 | 168 |
| 359 | 3300025920 | Ga0207649_10000202 | Ga0207649_1000020210 | 168 |
| 360 | 3300025920 | Ga0207649_10021139 | Ga0207649_100211394 | 168 |
| 361 | 3300025920 | Ga0207649_10294347 | Ga0207649_102943472 | 168 |
| 362 | 3300025921 | Ga0207652_10003023 | Ga0207652_1000302315 | 168 |
| 363 | 3300025921 | Ga0207652_10009127 | Ga0207652_100091276 | 168 |
| 364 | 3300025921 | Ga0207652_10062359 | Ga0207652_100623592 | 168 |
| 365 | 3300025924 | Ga0207694_10000006 | Ga0207694_1000000696 | 168 |
| 366 | 3300025924 | Ga0207694_10140414 | Ga0207694_101404142 | 168 |
| 367 | 3300025924 | Ga0207694_10183137 | Ga0207694_101831372 | 168 |
| 368 | 3300025924 | Ga0207694_10373893 | Ga0207694_103738932 | 168 |
| 369 | 3300025927 | Ga0207687_10249059 | Ga0207687_102490592 | 168 |
| 370 | 3300025928 | Ga0207700_10274633 | Ga0207700_102746332 | 168 |
| 371 | 3300025928 | Ga0207700_10339414 | Ga0207700_103394141 | 168 |
| 372 | 3300025928 | Ga0207700_10442737 | Ga0207700_104427371 | 168 |
| 373 | 3300025928 | Ga0207700_10786996 | Ga0207700_107869962 | 168 |
| 374 | 3300025929 | Ga0207664_10796365 | Ga0207664_107963652 | 168 |
| 375 | 3300025931 | Ga0207644_10123603 | Ga0207644_101236032 | 168 |
| 376 | 3300025932 | Ga0207690_10041072 | Ga0207690_100410722 | 168 |
| 377 | 3300025932 | Ga0207690_10184616 | Ga0207690_101846161 | 168 |
| 378 | 3300025933 | Ga0207706_10142314 | Ga0207706_101423142 | 168 |
| 379 | 3300025934 | Ga0207686_10059565 | Ga0207686_100595652 | 168 |
| 380 | 3300025936 | Ga0207670_10776784 | Ga0207670_107767841 | 168 |
| 381 | 3300025936 | Ga0207670_11195642 | Ga0207670_111956422 | 168 |
| 382 | 3300025937 | Ga0207669_10203483 | Ga0207669_102034832 | 168 |
| 383 | 3300025937 | Ga0207669_10407195 | Ga0207669_104071952 | 168 |
| 384 | 3300025937 | Ga0207669_10415730 | Ga0207669_104157301 | 168 |
| 385 | 3300025938 | Ga0207704_10567784 | Ga0207704_105677842 | 168 |
| 386 | 3300025940 | Ga0207691_10171370 | Ga0207691_101713701 | 168 |
| 387 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001512 | 168 |
| 388 | 3300025941 | Ga0207711_10002944 | Ga0207711_100029443 | 168 |
| 389 | 3300025942 | Ga0207689_10400083 | Ga0207689_104000832 | 168 |
| 390 | 3300025944 | Ga0207661_10588777 | Ga0207661_105887772 | 168 |
| 391 | 3300025945 | Ga0207679_10012712 | Ga0207679_100127122 | 168 |
| 392 | 3300025949 | Ga0207667_10000106 | Ga0207667_1000010691 | 168 |
| 393 | 3300025949 | Ga0207667_10043252 | Ga0207667_100432525 | 168 |
| 394 | 3300025949 | Ga0207667_10070622 | Ga0207667_100706222 | 168 |
| 395 | 3300025949 | Ga0207667_10091694 | Ga0207667_100916944 | 168 |
| 396 | 3300025949 | Ga0207667_10128147 | Ga0207667_101281472 | 168 |
| 397 | 3300025949 | Ga0207667_10173042 | Ga0207667_101730422 | 168 |
| 398 | 3300025949 | Ga0207667_10215868 | Ga0207667_102158682 | 168 |
| 399 | 3300025949 | Ga0207667_10221570 | Ga0207667_102215702 | 168 |
| 400 | 3300025949 | Ga0207667_10338456 | Ga0207667_103384562 | 168 |
| 401 | 3300025949 | Ga0207667_10921077 | Ga0207667_109210771 | 168 |
| 402 | 3300025960 | Ga0207651_10324631 | Ga0207651_103246312 | 168 |
| 403 | 3300025960 | Ga0207651_10790529 | Ga0207651_107905291 | 168 |
| 404 | 3300025961 | Ga0207712_10173194 | Ga0207712_101731942 | 168 |
| 405 | 3300025972 | Ga0207668_10249845 | Ga0207668_102498451 | 168 |
| 406 | 3300025981 | Ga0207640_10110715 | Ga0207640_101107151 | 168 |
| 407 | 3300025981 | Ga0207640_10206006 | Ga0207640_102060062 | 168 |
| 408 | 3300025981 | Ga0207640_10712703 | Ga0207640_107127032 | 168 |
| 409 | 3300025986 | Ga0207658_10207346 | Ga0207658_102073462 | 168 |
| 410 | 3300026023 | Ga0207677_10022754 | Ga0207677_100227542 | 168 |
| 411 | 3300026035 | Ga0207703_10039615 | Ga0207703_100396153 | 168 |
| 412 | 3300026041 | Ga0207639_10007079 | Ga0207639_100070796 | 168 |
| 413 | 3300026041 | Ga0207639_10022836 | Ga0207639_100228365 | 168 |
| 414 | 3300026041 | Ga0207639_10051462 | Ga0207639_100514623 | 168 |
| 415 | 3300026041 | Ga0207639_10456328 | Ga0207639_104563282 | 168 |
| 416 | 3300026041 | Ga0207639_10458611 | Ga0207639_104586112 | 168 |
| 417 | 3300026078 | Ga0207702_10045794 | Ga0207702_100457945 | 168 |
| 418 | 3300026078 | Ga0207702_10128865 | Ga0207702_101288653 | 168 |
| 419 | 3300026078 | Ga0207702_10183578 | Ga0207702_101835783 | 168 |
| 420 | 3300026078 | Ga0207702_10244340 | Ga0207702_102443402 | 168 |
| 421 | 3300026078 | Ga0207702_11154633 | Ga0207702_111546332 | 168 |
| 422 | 3300026088 | Ga0207641_10018113 | Ga0207641_100181135 | 168 |
| 423 | 3300026088 | Ga0207641_10051374 | Ga0207641_100513743 | 168 |
| 424 | 3300026089 | Ga0207648_10288660 | Ga0207648_102886602 | 168 |
| 425 | 3300026089 | Ga0207648_10444665 | Ga0207648_104446652 | 168 |
| 426 | 3300026116 | Ga0207674_10074152 | Ga0207674_100741524 | 168 |
| 427 | 3300026116 | Ga0207674_10412185 | Ga0207674_104121852 | 168 |
| 428 | 3300026118 | Ga0207675_100332284 | Ga0207675_1003322842 | 168 |
| 429 | 3300026118 | Ga0207675_100829136 | Ga0207675_1008291362 | 168 |
| 430 | 3300026121 | Ga0207683_10146834 | Ga0207683_101468343 | 168 |
| 431 | 3300026121 | Ga0207683_10192413 | Ga0207683_101924132 | 168 |
| 432 | 3300026121 | Ga0207683_10398651 | Ga0207683_103986512 | 168 |
| 433 | 3300026142 | Ga0207698_10011195 | Ga0207698_100111952 | 168 |
| 434 | 3300026142 | Ga0207698_10138264 | Ga0207698_101382642 | 168 |
| 435 | 3300026142 | Ga0207698_10142313 | Ga0207698_101423133 | 168 |
| 436 | 3300027866 | Ga0209813_10021479 | Ga0209813_100214792 | 168 |
| 437 | 3300028379 | Ga0268266_10009800 | Ga0268266_100098008 | 168 |
| 438 | 3300028379 | Ga0268266_10049299 | Ga0268266_100492994 | 168 |
| 439 | 3300028379 | Ga0268266_10095391 | Ga0268266_100953912 | 168 |
| 440 | 3300028379 | Ga0268266_10247947 | Ga0268266_102479472 | 168 |
| 441 | 3300028379 | Ga0268266_10715328 | Ga0268266_107153282 | 168 |
| 442 | 3300028380 | Ga0268265_10245102 | Ga0268265_102451022 | 168 |
| 443 | 3300028380 | Ga0268265_10456052 | Ga0268265_104560522 | 168 |
| 444 | 3300028573 | Ga0265334_10040829 | Ga0265334_100408293 | 168 |
| 445 | 3300028577 | Ga0265318_10000125 | Ga0265318_1000012556 | 168 |
| 446 | 3300028653 | Ga0265323_10151707 | Ga0265323_101517072 | 168 |
| 447 | 3300028800 | Ga0265338_10000011 | Ga0265338_10000011461 | 168 |
| 448 | 3300028800 | Ga0265338_10011053 | Ga0265338_1001105310 | 168 |
| 449 | 3300031235 | Ga0265330_10009650 | Ga0265330_100096502 | 168 |
| 450 | 3300031235 | Ga0265330_10266738 | Ga0265330_102667381 | 168 |
| 451 | 3300031238 | Ga0265332_10012624 | Ga0265332_100126243 | 168 |
| 452 | 3300031238 | Ga0265332_10015641 | Ga0265332_100156414 | 168 |
| 453 | 3300031238 | Ga0265332_10045584 | Ga0265332_100455842 | 168 |
| 454 | 3300031239 | Ga0265328_10192501 | Ga0265328_101925011 | 168 |
| 455 | 3300031241 | Ga0265325_10000002 | Ga0265325_10000002129 | 168 |
| 456 | 3300031241 | Ga0265325_10117778 | Ga0265325_101177781 | 168 |
| 457 | 3300031242 | Ga0265329_10022488 | Ga0265329_100224882 | 168 |
| 458 | 3300031247 | Ga0265340_10004297 | Ga0265340_100042977 | 168 |
| 459 | 3300031247 | Ga0265340_10034266 | Ga0265340_100342661 | 168 |
| 460 | 3300031249 | Ga0265339_10000210 | Ga0265339_1000021018 | 168 |
| 461 | 3300031249 | Ga0265339_10148637 | Ga0265339_101486372 | 168 |
| 462 | 3300031250 | Ga0265331_10000008 | Ga0265331_1000000869 | 168 |
| 463 | 3300031250 | Ga0265331_10007067 | Ga0265331_100070677 | 168 |
| 464 | 3300031250 | Ga0265331_10027552 | Ga0265331_100275522 | 168 |
| 465 | 3300031251 | Ga0265327_10000007 | Ga0265327_10000007581 | 168 |
| 466 | 3300031251 | Ga0265327_10000378 | Ga0265327_1000037850 | 168 |
| 467 | 3300031251 | Ga0265327_10000448 | Ga0265327_1000044817 | 168 |
| 468 | 3300031344 | Ga0265316_10000166 | Ga0265316_1000016650 | 168 |
| 469 | 3300031344 | Ga0265316_10029385 | Ga0265316_100293852 | 168 |
| 470 | 3300031344 | Ga0265316_10365180 | Ga0265316_103651802 | 168 |
| 471 | 3300031456 | Ga0307513_10382286 | Ga0307513_103822862 | 168 |
| 472 | 3300031595 | Ga0265313_10003445 | Ga0265313_1000344514 | 168 |
| 473 | 3300031595 | Ga0265313_10029414 | Ga0265313_100294142 | 168 |
| 474 | 3300031595 | Ga0265313_10037366 | Ga0265313_100373662 | 168 |
| 475 | 3300031595 | Ga0265313_10226760 | Ga0265313_102267601 | 168 |
| 476 | 3300031691 | Ga0316579_10006719 | Ga0316579_100067194 | 168 |
| 477 | 3300031711 | Ga0265314_10010428 | Ga0265314_100104284 | 168 |
| 478 | 3300031711 | Ga0265314_10017005 | Ga0265314_100170053 | 168 |
| 479 | 3300031711 | Ga0265314_10045723 | Ga0265314_100457234 | 168 |
| 480 | 3300031711 | Ga0265314_10060570 | Ga0265314_100605702 | 168 |
| 481 | 3300031711 | Ga0265314_10083518 | Ga0265314_100835184 | 168 |
| 482 | 3300031711 | Ga0265314_10426199 | Ga0265314_104261991 | 168 |
| 483 | 3300031712 | Ga0265342_10004548 | Ga0265342_100045488 | 168 |
| 484 | 3300031712 | Ga0265342_10021542 | Ga0265342_100215423 | 168 |
| 485 | 3300031712 | Ga0265342_10042949 | Ga0265342_100429492 | 168 |
| 486 | 3300031712 | Ga0265342_10079237 | Ga0265342_100792372 | 168 |
| 487 | 3300031727 | Ga0316576_10137592 | Ga0316576_101375922 | 168 |
| 488 | 3300031730 | Ga0307516_10032110 | Ga0307516_100321104 | 168 |
| 489 | 3300031730 | Ga0307516_10053974 | Ga0307516_100539743 | 168 |
| 490 | 3300031733 | Ga0316577_10007601 | Ga0316577_100076014 | 168 |
| 491 | 3300032005 | Ga0307411_10401480 | Ga0307411_104014802 | 168 |
| 492 | 3300032133 | Ga0316583_10008084 | Ga0316583_100080843 | 168 |
| 493 | 3300032137 | Ga0316585_10097959 | Ga0316585_100979591 | 168 |
| 494 | 3300032168 | Ga0316593_10137636 | Ga0316593_101376362 | 168 |
| 495 | 3300035111 | Ga0373923_0091651 | Ga0373923_0091651_624_1154 | 168 |
| 496 | 3300035207 | Ga0373942_0082712 | Ga0373942_0082712_41_571 | 168 |
| 497 | 3300035398 | Ga0316574_0069703 | Ga0316574_0069703_1546_2097 | 168 |
| 498 | 3300035691 | Ga0373931_0017524 | Ga0373931_0017524_1215_1745 | 168 |
| 499 | 3300035691 | Ga0373931_0208770 | Ga0373931_0208770_367_969 | 168 |
| 500 | 3300035692 | Ga0373935_0758070 | Ga0373935_0758070_18_599 | 168 |
| 501 | 3300035692 | Ga0373935_0760682 | Ga0373935_0760682_98_628 | 168 |
| 502 | 3300035695 | Ga0373927_0073947 | Ga0373927_0073947_1053_1583 | 168 |
| 503 | 3300035695 | Ga0373927_0345719 | Ga0373927_0345719_120_650 | 168 |
| 504 | 3300035724 | Ga0373933_0022090 | Ga0373933_0022090_746_1276 | 168 |
| 505 | 3300036401 | Ga0373937_0022231 | Ga0373937_0022231_4216_4746 | 168 |
| 506 | 3300036401 | Ga0373937_0235702 | Ga0373937_0235702_969_1526 | 168 |
| 507 | 3300036401 | Ga0373937_0455629 | Ga0373937_0455629_186_722 | 168 |
| 508 | 3300036647 | Ga0316582_0007371 | Ga0316582_0007371_277_813 | 168 |
| 509 | 3300036647 | Ga0316582_0018675 | Ga0316582_0018675_1908_2429 | 168 |
| 510 | 3300036712 | Ga0316584_0152083 | Ga0316584_0152083_161_697 | 168 |
| 511 | 3300036712 | Ga0316584_0203146 | Ga0316584_0203146_175_696 | 168 |
| 512 | 3300036712 | Ga0316584_0398402 | Ga0316584_0398402_171_722 | 168 |
| 513 | 3300037068 | Ga0373925_0507374 | Ga0373925_0507374_354_890 | 168 |
| 514 | 3300037312 | Ga0395899_0000003 | Ga0395899_0000003_184483_185013 | 168 |
| 515 | 3300037312 | Ga0395899_0028713 | Ga0395899_0028713_791_1321 | 168 |
| 516 | 3300037312 | Ga0395899_0111167 | Ga0395899_0111167_1309_1869 | 168 |
| 517 | 3300037312 | Ga0395899_0113465 | Ga0395899_0113465_1039_1569 | 168 |
| 518 | 3300037312 | Ga0395899_0170756 | Ga0395899_0170756_547_1080 | 168 |
| 519 | 3300037418 | Ga0395900_0023024 | Ga0395900_0023024_4788_5318 | 168 |
| 520 | 3300037418 | Ga0395900_0106335 | Ga0395900_0106335_1176_1736 | 168 |
| 521 | 3300037418 | Ga0395900_0126165 | Ga0395900_0126165_828_1358 | 168 |
| 522 | 3300037418 | Ga0395900_0914888 | Ga0395900_0914888_222_752 | 168 |
| 523 | 3300037466 | Ga0395898_0027033 | Ga0395898_0027033_2915_3475 | 168 |
| 524 | 3300037466 | Ga0395898_0127038 | Ga0395898_0127038_851_1381 | 168 |
| 525 | 3300038443 | Ga0395901_0025294 | Ga0395901_0025294_929_1459 | 168 |
| 526 | 3300038443 | Ga0395901_0026613 | Ga0395901_0026613_2899_3432 | 168 |
| 527 | 3300038443 | Ga0395901_0035463 | Ga0395901_0035463_4009_4539 | 168 |
| 528 | 3300038443 | Ga0395901_0104585 | Ga0395901_0104585_1063_1623 | 168 |
| 529 | 3300039437 | Ga0436365_0412683 | Ga0436365_0412683_44047_44574 | 168 |
| 530 | 3300039437 | Ga0436365_0583194 | Ga0436365_0583194_78169_78741 | 168 |
| 531 | 3300039437 | Ga0436365_0622716 | Ga0436365_0622716_12_545 | 168 |
| 532 | 3300039438 | Ga0436360_0032462 | Ga0436360_0032462_185_718 | 168 |
| 533 | 3300039438 | Ga0436360_0052066 | Ga0436360_0052066_2722_3258 | 168 |
| 534 | 3300039438 | Ga0436360_0299898 | Ga0436360_0299898_173_730 | 168 |
| 535 | 3300039447 | Ga0436361_0331544 | Ga0436361_0331544_1009_1539 | 168 |
| 536 | 3300039447 | Ga0436361_1016532 | Ga0436361_1016532_3287_3811 | 168 |
| 537 | 3300041413 | Ga0439465_0271522 | Ga0439465_0271522_72_602 | 168 |
| 538 | 3300044656 | Ga0466969_0059802 | Ga0466969_0059802_196_726 | 168 |
| 539 | 3300044658 | Ga0466972_0182774 | Ga0466972_0182774_136_693 | 168 |
| 540 | 3300044683 | Ga0466965_0355330 | Ga0466965_0355330_130_660 | 168 |
| 541 | 3300044694 | Ga0466963_0022801 | Ga0466963_0022801_3245_3778 | 168 |
| 542 | 3300044712 | Ga0453684_0013252 | Ga0453684_0013252_6587_7105 | 168 |
| 543 | 3300044842 | Ga0466957_0137190 | Ga0466957_0137190_900_1433 | 168 |
| 544 | 3300045976 | Ga0466967_0045841 | Ga0466967_0045841_2662_3222 | 168 |
| 545 | 3300045976 | Ga0466967_0199478 | Ga0466967_0199478_739_1272 | 168 |
| 546 | 3300046454 | Ga0495592_0077637 | Ga0495592_0077637_428_964 | 168 |
| 547 | 3300046471 | Ga0495650_0180970 | Ga0495650_0180970_159_716 | 168 |
| 548 | 3300046477 | Ga0495664_0068218 | Ga0495664_0068218_711_1292 | 168 |
| 549 | 3300046477 | Ga0495664_0078945 | Ga0495664_0078945_747_1283 | 168 |
| 550 | 3300046506 | Ga0495583_0144926 | Ga0495583_0144926_115_669 | 168 |
| 551 | 3300046507 | Ga0495606_0152282 | Ga0495606_0152282_285_857 | 168 |
| 552 | 3300046516 | Ga0495628_0240644 | Ga0495628_0240644_651_1187 | 168 |
| 553 | 3300046529 | Ga0495652_0130500 | Ga0495652_0130500_1156_1737 | 168 |
| 554 | 3300046530 | Ga0495654_0177094 | Ga0495654_0177094_356_913 | 168 |
| 555 | 3300046536 | Ga0495587_0089424 | Ga0495587_0089424_741_1322 | 168 |
| 556 | 3300046536 | Ga0495587_0120377 | Ga0495587_0120377_659_1195 | 168 |
| 557 | 3300046543 | Ga0495645_0025828 | Ga0495645_0025828_1168_1704 | 168 |
| 558 | 3300046557 | Ga0495622_0027198 | Ga0495622_0027198_1257_1814 | 168 |
| 559 | 3300046616 | Ga0495668_0027699 | Ga0495668_0027699_2509_3036 | 168 |
| 560 | 3300046660 | Ga0495625_0128771 | Ga0495625_0128771_452_1009 | 168 |
| 561 | 3300046665 | Ga0495661_0128297 | Ga0495661_0128297_129_683 | 168 |
| 562 | 3300046683 | Ga0495658_0304952 | Ga0495658_0304952_102_632 | 168 |
| 563 | 3300046692 | Ga0495671_0247488 | Ga0495671_0247488_119_670 | 168 |
| 564 | 3300046694 | Ga0495649_0096524 | Ga0495649_0096524_896_1453 | 168 |
| 565 | 3300046794 | Ga0495589_0060561 | Ga0495589_0060561_772_1329 | 168 |
| 566 | 3300047320 | Ga0495672_0302653 | Ga0495672_0302653_117_674 | 168 |
| 567 | 3300047445 | Ga0495677_0261284 | Ga0495677_0261284_70_651 | 168 |
| 568 | 3300047470 | Ga0495681_0190725 | Ga0495681_0190725_177_731 | 168 |
| 569 | 3300048903 | Ga0496100_1033004 | Ga0496100_1033004_18_599 | 168 |
| 570 | 3300048916 | Ga0496113_0707092 | Ga0496113_0707092_134_664 | 168 |
| 571 | 3300048918 | Ga0496115_0922846 | Ga0496115_0922846_72_602 | 168 |
| 572 | 3300048924 | Ga0496121_0001329 | Ga0496121_0001329_2625_3176 | 168 |
| 573 | 3300048928 | Ga0496125_0014570 | Ga0496125_0014570_2897_3424 | 168 |
| 574 | 3300048929 | Ga0496126_0023833 | Ga0496126_0023833_1277_1807 | 168 |
| 575 | 3300048929 | Ga0496126_0224789 | Ga0496126_0224789_897_1454 | 168 |
| 576 | 3300049460 | Ga0495682_0007197 | Ga0495682_0007197_500_1081 | 168 |
| 577 | 3300049568 | Ga0501031_0190379 | Ga0501031_0190379_310_816 | 168 |
| 578 | 3300049569 | Ga0501032_0134742 | Ga0501032_0134742_393_932 | 168 |
| 579 | 3300049569 | Ga0501032_0373633 | Ga0501032_0373633_58_618 | 168 |
| 580 | 3300049569 | Ga0501032_0575055 | Ga0501032_0575055_167_697 | 168 |
| 581 | 3300049570 | Ga0501033_0007822 | Ga0501033_0007822_6870_7430 | 168 |
| 582 | 3300049570 | Ga0501033_0026925 | Ga0501033_0026925_2641_3180 | 168 |
| 583 | 3300049570 | Ga0501033_0203755 | Ga0501033_0203755_169_714 | 168 |
| 584 | 3300049570 | Ga0501033_0537907 | Ga0501033_0537907_173_703 | 168 |
| 585 | 3300049570 | Ga0501033_0844885 | Ga0501033_0844885_26_550 | 168 |
| 586 | 3300049571 | Ga0501034_0012128 | Ga0501034_0012128_2088_2627 | 168 |
| 587 | 3300049571 | Ga0501034_0022018 | Ga0501034_0022018_1265_1804 | 168 |
| 588 | 3300049571 | Ga0501034_0148872 | Ga0501034_0148872_591_1154 | 168 |
| 589 | 3300049571 | Ga0501034_0179678 | Ga0501034_0179678_516_1073 | 168 |
| 590 | 3300049571 | Ga0501034_0273951 | Ga0501034_0273951_545_1078 | 168 |
| 591 | 3300049571 | Ga0501034_0587790 | Ga0501034_0587790_405_950 | 168 |
| 592 | 3300049571 | Ga0501034_0848918 | Ga0501034_0848918_18_575 | 168 |
| 593 | 3300049572 | Ga0501036_0032242 | Ga0501036_0032242_2168_2707 | 168 |
| 594 | 3300049572 | Ga0501036_0062239 | Ga0501036_0062239_417_941 | 168 |
| 595 | 3300049572 | Ga0501036_0127765 | Ga0501036_0127765_1189_1746 | 168 |
| 596 | 3300049573 | Ga0501037_0004982 | Ga0501037_0004982_280_804 | 168 |
| 597 | 3300049573 | Ga0501037_0042046 | Ga0501037_0042046_1335_1895 | 168 |
| 598 | 3300049573 | Ga0501037_0163451 | Ga0501037_0163451_82_639 | 168 |
| 599 | 3300049573 | Ga0501037_0195455 | Ga0501037_0195455_841_1386 | 168 |
| 600 | 3300049573 | Ga0501037_0267913 | Ga0501037_0267913_379_918 | 168 |
| 601 | 3300049573 | Ga0501037_0374380 | Ga0501037_0374380_325_855 | 168 |
| 602 | 3300049574 | Ga0501038_0016935 | Ga0501038_0016935_370_915 | 168 |
| 603 | 3300049574 | Ga0501038_0084195 | Ga0501038_0084195_1396_1956 | 168 |
| 604 | 3300049574 | Ga0501038_0095289 | Ga0501038_0095289_1630_2169 | 168 |
| 605 | 3300049575 | Ga0501039_0145112 | Ga0501039_0145112_1191_1730 | 168 |
| 606 | 3300049575 | Ga0501039_0159743 | Ga0501039_0159743_146_670 | 168 |
| 607 | 3300049577 | Ga0501041_0441680 | Ga0501041_0441680_102_608 | 168 |
| 608 | 3300049578 | Ga0501042_0190091 | Ga0501042_0190091_884_1441 | 168 |
| 609 | 3300049579 | Ga0501043_0006812 | Ga0501043_0006812_7848_8372 | 168 |
| 610 | 3300049579 | Ga0501043_0053675 | Ga0501043_0053675_104_664 | 168 |
| 611 | 3300049579 | Ga0501043_0106668 | Ga0501043_0106668_779_1324 | 168 |
| 612 | 3300049579 | Ga0501043_0186019 | Ga0501043_0186019_976_1524 | 168 |
| 613 | 3300049580 | Ga0501046_0041043 | Ga0501046_0041043_119_643 | 168 |
| 614 | 3300049580 | Ga0501046_0052245 | Ga0501046_0052245_1438_1977 | 168 |
| 615 | 3300049580 | Ga0501046_0079038 | Ga0501046_0079038_1208_1744 | 168 |
| 616 | 3300049580 | Ga0501046_0192059 | Ga0501046_0192059_437_967 | 168 |
| 617 | 3300049581 | Ga0501047_0003552 | Ga0501047_0003552_986_1534 | 168 |
| 618 | 3300049581 | Ga0501047_0004810 | Ga0501047_0004810_3018_3581 | 168 |
| 619 | 3300049581 | Ga0501047_0017577 | Ga0501047_0017577_3051_3611 | 168 |
| 620 | 3300049581 | Ga0501047_0023081 | Ga0501047_0023081_4536_5072 | 168 |
| 621 | 3300049581 | Ga0501047_0101831 | Ga0501047_0101831_697_1254 | 168 |
| 622 | 3300049581 | Ga0501047_0188144 | Ga0501047_0188144_844_1383 | 168 |
| 623 | 3300049581 | Ga0501047_0207020 | Ga0501047_0207020_460_1005 | 168 |
| 624 | 3300049581 | Ga0501047_0208303 | Ga0501047_0208303_291_821 | 168 |
| 625 | 3300049581 | Ga0501047_0370312 | Ga0501047_0370312_547_1071 | 168 |
| 626 | 3300049581 | Ga0501047_0403510 | Ga0501047_0403510_130_714 | 168 |
| 627 | 3300049581 | Ga0501047_0423375 | Ga0501047_0423375_441_965 | 168 |
| 628 | 3300049581 | Ga0501047_0423578 | Ga0501047_0423578_414_953 | 168 |
| 629 | 3300049581 | Ga0501047_0729706 | Ga0501047_0729706_37_582 | 168 |
| 630 | 3300049582 | Ga0501048_0047002 | Ga0501048_0047002_1398_1955 | 168 |
| 631 | 3300049582 | Ga0501048_0588449 | Ga0501048_0588449_222_728 | 168 |
| 632 | 3300049583 | Ga0501067_0008586 | Ga0501067_0008586_2854_3417 | 168 |
| 633 | 3300049583 | Ga0501067_0032197 | Ga0501067_0032197_1552_2109 | 168 |
| 634 | 3300049583 | Ga0501067_0160031 | Ga0501067_0160031_16_555 | 168 |
| 635 | 3300049584 | Ga0501068_0027961 | Ga0501068_0027961_1478_2017 | 168 |
| 636 | 3300049584 | Ga0501068_0046942 | Ga0501068_0046942_1046_1585 | 168 |
| 637 | 3300049584 | Ga0501068_0190510 | Ga0501068_0190510_294_818 | 168 |
| 638 | 3300049585 | Ga0501069_0004797 | Ga0501069_0004797_1202_1759 | 168 |
| 639 | 3300049585 | Ga0501069_0030658 | Ga0501069_0030658_1400_1945 | 168 |
| 640 | 3300049585 | Ga0501069_0366144 | Ga0501069_0366144_23_547 | 168 |
| 641 | 3300049586 | Ga0501070_0000017 | Ga0501070_0000017_96747_97292 | 168 |
| 642 | 3300049586 | Ga0501070_0018465 | Ga0501070_0018465_2823_3443 | 168 |
| 643 | 3300049586 | Ga0501070_0023545 | Ga0501070_0023545_2428_2967 | 168 |
| 644 | 3300049586 | Ga0501070_0023934 | Ga0501070_0023934_3499_4056 | 168 |
| 645 | 3300049586 | Ga0501070_0490151 | Ga0501070_0490151_235_798 | 168 |
| 646 | 3300049587 | Ga0501071_0133031 | Ga0501071_0133031_96_602 | 168 |
| 647 | 3300049587 | Ga0501071_0707638 | Ga0501071_0707638_229_735 | 168 |
| 648 | 3300049588 | Ga0501072_0007532 | Ga0501072_0007532_4056_4619 | 168 |
| 649 | 3300049588 | Ga0501072_0054427 | Ga0501072_0054427_1419_1976 | 168 |
| 650 | 3300049588 | Ga0501072_0489676 | Ga0501072_0489676_359_883 | 168 |
| 651 | 3300049589 | Ga0501073_0000774 | Ga0501073_0000774_4135_4659 | 168 |
| 652 | 3300049589 | Ga0501073_0004084 | Ga0501073_0004084_852_1415 | 168 |
| 653 | 3300049589 | Ga0501073_0014201 | Ga0501073_0014201_2497_3054 | 168 |
| 654 | 3300049589 | Ga0501073_0023292 | Ga0501073_0023292_1990_2550 | 168 |
| 655 | 3300049589 | Ga0501073_0025337 | Ga0501073_0025337_1591_2148 | 168 |
| 656 | 3300049589 | Ga0501073_0030670 | Ga0501073_0030670_1093_1632 | 168 |
| 657 | 3300049589 | Ga0501073_0181336 | Ga0501073_0181336_470_1033 | 168 |
| 658 | 3300049590 | Ga0501074_0002018 | Ga0501074_0002018_9786_10343 | 168 |
| 659 | 3300049590 | Ga0501074_0059868 | Ga0501074_0059868_1506_2063 | 168 |
| 660 | 3300049590 | Ga0501074_0248877 | Ga0501074_0248877_378_941 | 168 |
| 661 | 3300049741 | Ga0501079_0020834 | Ga0501079_0020834_3426_3983 | 168 |
| 662 | 3300049741 | Ga0501079_0089875 | Ga0501079_0089875_1172_1735 | 168 |
| 663 | 3300049742 | Ga0501080_0000333 | Ga0501080_0000333_33335_33859 | 168 |
| 664 | 3300049742 | Ga0501080_0006334 | Ga0501080_0006334_4230_4775 | 168 |
| 665 | 3300049742 | Ga0501080_0044966 | Ga0501080_0044966_2717_3274 | 168 |
| 666 | 3300049742 | Ga0501080_0056991 | Ga0501080_0056991_1498_2055 | 168 |
| 667 | 3300049742 | Ga0501080_0199115 | Ga0501080_0199115_1251_1790 | 168 |
| 668 | 3300049742 | Ga0501080_0214786 | Ga0501080_0214786_1116_1676 | 168 |
| 669 | 3300049742 | Ga0501080_0356266 | Ga0501080_0356266_573_1136 | 168 |
| 670 | 3300049742 | Ga0501080_0790186 | Ga0501080_0790186_155_685 | 168 |
| 671 | 3300049744 | Ga0501083_0072607 | Ga0501083_0072607_1153_1710 | 168 |
| 672 | 3300049744 | Ga0501083_0200990 | Ga0501083_0200990_115_678 | 168 |
| 673 | 3300049744 | Ga0501083_0333490 | Ga0501083_0333490_322_861 | 168 |
| 674 | 3300049744 | Ga0501083_0916891 | Ga0501083_0916891_13_552 | 168 |
| 675 | 3300049822 | Ga0501035_0001049 | Ga0501035_0001049_26106_26651 | 168 |
| 676 | 3300049822 | Ga0501035_0012693 | Ga0501035_0012693_1196_1753 | 168 |
| 677 | 3300049822 | Ga0501035_0019089 | Ga0501035_0019089_3522_4046 | 168 |
| 678 | 3300049822 | Ga0501035_0049373 | Ga0501035_0049373_2945_3505 | 168 |
| 679 | 3300049822 | Ga0501035_0056615 | Ga0501035_0056615_2936_3475 | 168 |
| 680 | 3300049822 | Ga0501035_0146683 | Ga0501035_0146683_674_1210 | 168 |
| 681 | 3300049822 | Ga0501035_0191585 | Ga0501035_0191585_625_1176 | 168 |
| 682 | 3300049822 | Ga0501035_0504396 | Ga0501035_0504396_24_569 | 168 |
| 683 | 3300049823 | Ga0501044_0001245 | Ga0501044_0001245_2744_3289 | 168 |
| 684 | 3300049823 | Ga0501044_0001370 | Ga0501044_0001370_27442_27966 | 168 |
| 685 | 3300049823 | Ga0501044_0052068 | Ga0501044_0052068_2362_2901 | 168 |
| 686 | 3300049823 | Ga0501044_0097356 | Ga0501044_0097356_1654_2211 | 168 |
| 687 | 3300049823 | Ga0501044_0110732 | Ga0501044_0110732_1117_1665 | 168 |
| 688 | 3300049823 | Ga0501044_0111932 | Ga0501044_0111932_555_1094 | 168 |
| 689 | 3300049823 | Ga0501044_0128268 | Ga0501044_0128268_863_1423 | 168 |
| 690 | 3300049823 | Ga0501044_0292011 | Ga0501044_0292011_528_1073 | 168 |
| 691 | 3300049823 | Ga0501044_0414556 | Ga0501044_0414556_222_740 | 168 |
| 692 | 3300049823 | Ga0501044_1057020 | Ga0501044_1057020_129_665 | 168 |
| 693 | 3300050489 | nmdc:mga03683_1310_c2 | nmdc:mga03683_1310_c2_856_1389 | 168 |
| 694 | 3300050489 | nmdc:mga03683_138765_c1 | nmdc:mga03683_138765_c1_174_707 | 168 |
| 695 | 3300050492 | nmdc:mga0yw44_605724_c1 | nmdc:mga0yw44_605724_c1_27_554 | 168 |
| 696 | 3300050493 | nmdc:mga0k408_35812_c1 | nmdc:mga0k408_35812_c1_1130_1663 | 168 |
| 697 | 3300053087 | Ga0500643_000017 | Ga0500643_000017_103582_104139 | 168 |
| 698 | 3300053088 | Ga0500644_0026343 | Ga0500644_0026343_320_850 | 168 |
| 699 | 3300053090 | Ga0500646_0027744 | Ga0500646_0027744_569_1126 | 168 |
| 700 | 3300053094 | Ga0500566_0244845 | Ga0500566_0244845_52_582 | 168 |
| 701 | 3300053108 | Ga0500562_000194 | Ga0500562_000194_2719_3246 | 168 |
| 702 | 3300053116 | Ga0500592_018049 | Ga0500592_018049_289_846 | 168 |
| 703 | 3300053119 | Ga0500595_026534 | Ga0500595_026534_1223_1774 | 168 |
| 704 | 3300053130 | Ga0500642_0030073 | Ga0500642_0030073_830_1387 | 168 |
| 705 | 3300053139 | Ga0500568_0029387 | Ga0500568_0029387_1507_2064 | 168 |
| 706 | 3300053140 | Ga0500573_0000055 | Ga0500573_0000055_8942_9526 | 168 |
| 707 | 3300053142 | Ga0500577_0097599 | Ga0500577_0097599_571_1128 | 168 |
| 708 | 3300053163 | Ga0500639_103245 | Ga0500639_103245_368_895 | 168 |
| 709 | 3300053730 | Ga0500645_019975 | Ga0500645_019975_706_1263 | 168 |
| 710 | 3300054114 | Ga0501084_0000288 | Ga0501084_0000288_11344_11907 | 168 |
| 711 | 3300054114 | Ga0501084_0007244 | Ga0501084_0007244_4687_5244 | 168 |
| 712 | 3300054114 | Ga0501084_0026675 | Ga0501084_0026675_3488_4045 | 168 |
| 713 | 3300054114 | Ga0501084_0121710 | Ga0501084_0121710_334_891 | 168 |
| 714 | 3300054114 | Ga0501084_0403800 | Ga0501084_0403800_173_697 | 168 |
| 715 | 3300060353 | Ga0501082_0020561 | Ga0501082_0020561_3035_3592 | 168 |
| 716 | 3300060353 | Ga0501082_0042317 | Ga0501082_0042317_1545_2102 | 168 |
| 717 | 3300060353 | Ga0501082_0149628 | Ga0501082_0149628_590_1114 | 168 |
| 718 | 3300060353 | Ga0501082_0560580 | Ga0501082_0560580_185_724 | 168 |
| 719 | 3300060353 | Ga0501082_0649192 | Ga0501082_0649192_118_675 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b0i-assembly2.cif.gz_A | crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) mutant (h70n) from pseudomonas aeruginosa in complex with 3-hydroxydecanoyl-n-acetyl cysteamine | 0.9748 | 4 | 168 |
| 8b72-assembly2.cif.gz_D | crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with z30857828 | 0.9731 | 4 | 168 |
| 7bka-assembly1.cif.gz_A-2 | crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with ddd01870824 | 0.9727 | 4 | 168 |
| 7bhj-assembly2.cif.gz_B | crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with ddd00084774 | 0.972 | 4 | 167 |
| 4b0j-assembly1.cif.gz_S | crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with 5-(2- thienyl)-3-isoxazolyl methanol | 0.9719 | 4 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q62A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9578 | 1 | 166 | 3.10.129.10 |
| 3q62A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9301 | 1 | 166 | 3.10.129.10 |
| 1zhgA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8571 | 29 | 166 | 3.10.129.10 |
| 5buyF00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8514 | 7 | 164 | 3.10.129.10 |
| 4h4gA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8461 | 8 | 167 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7H4LVZ6-F1-model_v4 | 3-hydroxydecanoyl-(Acyl carrier protein) dehydratase (EC 4.2.1.59) | 1 | 88 | 158 |
GO:0006633
GO:0019171 GO:0034017 |
| AF-A0A378F7C7-F1-model_v4 | 3-hydroxydecanoyl-(Acyl carrier protein) dehydratase (EC 4.2.1.59) | 1 | 113 | 168 |
GO:0006633
GO:0019171 GO:0034017 |
| AF-A0A832ALW7-F1-model_v4 | Beta-hydroxydecanoyl-ACP dehydratase | 0.9992 | 93 | 167 |
GO:0006633
|
| AF-A0A7G2LRR4-F1-model_v4 | Beta-hydroxydecanoyl-ACP dehydratase | 0.9974 | 87 | 168 |
GO:0006633
GO:0019171 GO:0034017 |
| AF-A0A2J5Q3Z5-F1-model_v4 | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA (EC 4.2.1.59) | 0.9974 | 116 | 168 |
GO:0006633
GO:0019171 GO:0034017 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar