F477214

General Info

Members Datasets Scaffolds Average Seq Length
719 307 716 181

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100494320|Ga0070683_1004943201
Length 208
Sequence MLLTSGDWPKARSCQGADGRKRKLDTPNPARKTSFDLQGLLACARGELFGPGNPQLPLPPMLMFDRIVKISDTGGSANKGEIEAELDVNPNLWFFKCHFLGDPVMPGCLGVDAMWQMLGFFLGWLGGLGRGRALGVGEVKFTGMVLPTAKKVSYYIDLKRVVMRRLVLGIADGIVKVDGKTIFEAKDLRVGLFTDAAAALARTAAQPA

Samples

Sample ID Description Type Environment
1 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
2 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
3 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
182 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
185 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
191 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
192 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
295 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
301 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
304 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 0.83
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.98
Nodule 0
Rhizoplane 0.42
Rhizosphere 91.38
Stem 0
Stem Tuber 0
Unclassified 2.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10084318 3300001979 Bacteria 828
2 JGI24735J21928_10132198 3300002067 Bacteria 719
3 JGI25165J46597_1000035 3300003214 Bacteria 290723
4 JGI25153J46596_10000362 3300003215 Bacteria 31305
5 Ga0055531_10026506 3300003794 Bacteria 2065
6 Ga0058863_11751868 3300004799 Bacteria 1012
7 Ga0065165_1044999 3300005262 Bacteria 1288
8 Ga0070658_10068667 3300005327 Bacteria 2898
9 Ga0070658_10073106 3300005327 Bacteria 2811
10 Ga0070658_10158451 3300005327 Bacteria 1898
11 Ga0070676_10035640 3300005328 Bacteria 2862
12 Ga0070676_10285350 3300005328 Bacteria 1114
13 Ga0070683_100033947 3300005329 Bacteria 4656
14 Ga0070683_100207763 3300005329 Bacteria 1860
15 Ga0070683_100494320 3300005329 Bacteria 1168
16 Ga0070690_100115009 3300005330 Bacteria 1800
17 Ga0070677_10110348 3300005333 Bacteria 1227
18 Ga0068869_100131986 3300005334 Bacteria 1921
19 Ga0068869_100397420 3300005334 Bacteria 1133
20 Ga0068869_100943635 3300005334 Bacteria 749
21 Ga0070666_10073561 3300005335 Bacteria 2328
22 Ga0070666_10168118 3300005335 Bacteria 1535
23 Ga0070680_100006785 3300005336 Bacteria 8721
24 Ga0070680_100019163 3300005336 Bacteria 5420
25 Ga0070680_100169100 3300005336 Bacteria 1839
26 Ga0070680_100761467 3300005336 Bacteria 834
27 Ga0070682_100232679 3300005337 Bacteria 1318
28 Ga0070682_100990295 3300005337 Bacteria 697
29 Ga0068868_100038243 3300005338 Bacteria 3724
30 Ga0068868_100057362 3300005338 Bacteria 3076
31 Ga0068868_100158380 3300005338 Bacteria 1868
32 Ga0070660_100013047 3300005339 Bacteria 5948
33 Ga0070660_100053117 3300005339 Bacteria 3125
34 Ga0070691_10006515 3300005341 Bacteria 5339
35 Ga0070691_10033661 3300005341 Bacteria 2412
36 Ga0070661_100053235 3300005344 Bacteria 2962
37 Ga0070661_100279089 3300005344 Bacteria 1296
38 Ga0070675_100117750 3300005354 Bacteria 2255
39 Ga0070675_100158737 3300005354 Bacteria 1944
40 Ga0070671_100135004 3300005355 Bacteria 2080
41 Ga0070671_100343986 3300005355 Bacteria 1272
42 Ga0070674_100606420 3300005356 Bacteria 926
43 Ga0070674_100771809 3300005356 Bacteria 828
44 Ga0070673_100158736 3300005364 Bacteria 1921
45 Ga0070673_101207637 3300005364 Bacteria 709
46 Ga0070659_100033717 3300005366 Bacteria 3979
47 Ga0070659_100650536 3300005366 Bacteria 909
48 Ga0070667_100034132 3300005367 Bacteria 4254
49 Ga0070709_10227564 3300005434 Bacteria 1333
50 Ga0070714_100108291 3300005435 Bacteria 2457
51 Ga0070713_100159253 3300005436 Bacteria 2014
52 Ga0070710_10474489 3300005437 Bacteria 852
53 Ga0070700_100533575 3300005441 Bacteria 909
54 Ga0070708_100249640 3300005445 Bacteria 1667
55 Ga0070678_100008608 3300005456 Bacteria 6117
56 Ga0070678_100151089 3300005456 Bacteria 1871
57 Ga0070678_100189794 3300005456 Bacteria 1689
58 Ga0070678_100403021 3300005456 Bacteria 1189
59 Ga0070678_100599862 3300005456 Bacteria 983
60 Ga0070662_100690571 3300005457 Bacteria 863
61 Ga0070662_100726784 3300005457 Bacteria 841
62 Ga0070681_10000002 3300005458 Bacteria 821814
63 Ga0070681_10003070 3300005458 Bacteria 15491
64 Ga0070681_10072889 3300005458 Bacteria 3396
65 Ga0070681_10121171 3300005458 Bacteria 2550
66 Ga0070681_10410599 3300005458 Bacteria 1266
67 Ga0070681_10427701 3300005458 Bacteria 1236
68 Ga0068867_100007771 3300005459 Bacteria 7580
69 Ga0068867_100088193 3300005459 Bacteria 2351
70 Ga0068867_100397773 3300005459 Bacteria 1161
71 Ga0068867_100634065 3300005459 Bacteria 936
72 Ga0070685_11135120 3300005466 Bacteria 592
73 Ga0070699_100385633 3300005518 Bacteria 1265
74 Ga0070679_100000035 3300005530 Bacteria 103095
75 Ga0070679_100004953 3300005530 Bacteria 12291
76 Ga0070679_100014205 3300005530 Bacteria 7642
77 Ga0070679_100039445 3300005530 Bacteria 4693
78 Ga0070684_100119853 3300005535 Bacteria 2367
79 Ga0070684_100412945 3300005535 Bacteria 1245
80 Ga0070697_100020390 3300005536 Bacteria 5244
81 Ga0068853_100036211 3300005539 Bacteria 4195
82 Ga0068853_100267120 3300005539 Bacteria 1574
83 Ga0068853_100291840 3300005539 Bacteria 1505
84 Ga0068853_100793324 3300005539 Bacteria 907
85 Ga0070672_100429275 3300005543 Bacteria 1136
86 Ga0070695_101421002 3300005545 Bacteria 576
87 Ga0070693_100096925 3300005547 Bacteria 1789
88 Ga0070693_100149993 3300005547 Bacteria 1476
89 Ga0070693_100320061 3300005547 Bacteria 1052
90 Ga0070665_100000322 3300005548 Bacteria 73995
91 Ga0070665_100043912 3300005548 Bacteria 4489
92 Ga0070665_100057177 3300005548 Bacteria 3911
93 Ga0070665_100136234 3300005548 Bacteria 2458
94 Ga0070665_100213662 3300005548 Bacteria 1930
95 Ga0070665_100356014 3300005548 Bacteria 1469
96 Ga0068855_100000038 3300005563 Bacteria 157738
97 Ga0068855_100016691 3300005563 Bacteria 8830
98 Ga0068855_100022893 3300005563 Bacteria 7487
99 Ga0068855_100176837 3300005563 Bacteria 2414
100 Ga0068855_100241094 3300005563 Bacteria 2020
101 Ga0068855_100431255 3300005563 Bacteria 1441
102 Ga0068855_100624837 3300005563 Bacteria 1159
103 Ga0068855_101073526 3300005563 Bacteria 843
104 Ga0070664_100039851 3300005564 Bacteria 3960
105 Ga0068854_100463577 3300005578 Bacteria 1061
106 Ga0068854_100692116 3300005578 Bacteria 879
107 Ga0068854_100965265 3300005578 Bacteria 753
108 Ga0068854_101091332 3300005578 Bacteria 711
109 Ga0068856_100173470 3300005614 Bacteria 2169
110 Ga0068856_100217518 3300005614 Bacteria 1925
111 Ga0068856_100256297 3300005614 Bacteria 1764
112 Ga0068856_100400148 3300005614 Bacteria 1393
113 Ga0068856_100548606 3300005614 Bacteria 1177
114 Ga0068856_100721512 3300005614 Bacteria 1017
115 Ga0068856_101291640 3300005614 Bacteria 745
116 Ga0070702_100173141 3300005615 Bacteria 1406
117 Ga0068852_100230981 3300005616 Bacteria 1763
118 Ga0068859_100380549 3300005617 Bacteria 1507
119 Ga0068864_101788348 3300005618 Bacteria 620
120 Ga0068866_10050112 3300005718 Bacteria 2119
121 Ga0068861_100220098 3300005719 Bacteria 1604
122 Ga0068851_10188533 3300005834 Bacteria 1145
123 Ga0068870_10186449 3300005840 Bacteria 1249
124 Ga0068863_100028187 3300005841 Bacteria 5361
125 Ga0068863_100072686 3300005841 Bacteria 3254
126 Ga0068858_100121471 3300005842 Bacteria 2443
127 Ga0068860_100139352 3300005843 Bacteria 2330
128 Ga0068862_100560421 3300005844 Bacteria 1092
129 Ga0081455_10004726 3300005937 Bacteria 15138
130 Ga0081455_10015332 3300005937 Bacteria 7452
131 Ga0075368_10130818 3300006042 Bacteria 1043
132 Ga0075364_10195880 3300006051 Bacteria 1369
133 Ga0070712_100401652 3300006175 Bacteria 1132
134 Ga0075362_10100852 3300006177 Bacteria 1350
135 Ga0075366_10025120 3300006195 Bacteria 3477
136 Ga0075366_10076019 3300006195 Bacteria 2004
137 Ga0097621_100000270 3300006237 Bacteria 35158
138 Ga0097621_100017434 3300006237 Bacteria 5453
139 Ga0097621_100026161 3300006237 Bacteria 4574
140 Ga0097621_100040414 3300006237 Bacteria 3750
141 Ga0097621_100065040 3300006237 Bacteria 3000
142 Ga0097621_100108423 3300006237 Bacteria 2344
143 Ga0097621_100173694 3300006237 Bacteria 1859
144 Ga0097621_100324292 3300006237 Bacteria 1365
145 Ga0097621_100739948 3300006237 Bacteria 908
146 Ga0068871_100001246 3300006358 Bacteria 17001
147 Ga0068871_100004963 3300006358 Bacteria 9293
148 Ga0068871_100008068 3300006358 Bacteria 7558
149 Ga0068871_100313372 3300006358 Bacteria 1380
150 Ga0068871_100775055 3300006358 Bacteria 883
151 Ga0075430_100435485 3300006846 Bacteria 1082
152 Ga0068865_100009233 3300006881 Bacteria 6107
153 Ga0068865_100565311 3300006881 Bacteria 957
154 Ga0097620_100380580 3300006931 Bacteria 1507
155 Ga0099794_10029829 3300007265 Bacteria 2543
156 Ga0099795_10089700 3300007788 Bacteria 1190
157 Ga0105240_10000811 3300009093 Bacteria 56752
158 Ga0105240_10024659 3300009093 Bacteria 7923
159 Ga0105240_10098517 3300009093 Bacteria 3560
160 Ga0105240_10119729 3300009093 Bacteria 3171
161 Ga0105240_10120223 3300009093 Bacteria 3163
162 Ga0105240_10331431 3300009093 Bacteria 1732
163 Ga0105240_10729961 3300009093 Bacteria 1079
164 Ga0105240_10752730 3300009093 Bacteria 1059
165 Ga0111539_10549739 3300009094 Bacteria 1345
166 Ga0105247_10616997 3300009101 Bacteria 806
167 Ga0105247_10727352 3300009101 Bacteria 750
168 Ga0105241_10058504 3300009174 Bacteria 2960
169 Ga0105241_10221743 3300009174 Bacteria 1590
170 Ga0105241_10985457 3300009174 Bacteria 788
171 Ga0105242_10031665 3300009176 Bacteria 4227
172 Ga0105242_10080115 3300009176 Bacteria 2729
173 Ga0105248_10000001 3300009177 Bacteria 1881304
174 Ga0105248_10023048 3300009177 Bacteria 6914
175 Ga0105248_10197276 3300009177 Bacteria 2268
176 Ga0105248_10338310 3300009177 Bacteria 1695
177 Ga0105248_10528402 3300009177 Bacteria 1330
178 Ga0105237_10168332 3300009545 Bacteria 2191
179 Ga0105237_10202867 3300009545 Bacteria 1983
180 Ga0105237_10253338 3300009545 Bacteria 1762
181 Ga0105237_10286443 3300009545 Bacteria 1650
182 Ga0105237_10520761 3300009545 Bacteria 1196
183 Ga0105238_10017545 3300009551 Bacteria 7279
184 Ga0105238_10023226 3300009551 Bacteria 6321
185 Ga0105238_10023345 3300009551 Bacteria 6305
186 Ga0105238_10040277 3300009551 Bacteria 4735
187 Ga0105238_10126332 3300009551 Bacteria 2536
188 Ga0105238_10225310 3300009551 Bacteria 1851
189 Ga0105238_10268138 3300009551 Bacteria 1688
190 Ga0105238_10409055 3300009551 Bacteria 1351
191 Ga0105032_110166 3300009979 Bacteria 763
192 Ga0099796_10090638 3300010159 Bacteria 1136
193 Ga0105239_10013755 3300010375 Bacteria 8981
194 Ga0105239_10050719 3300010375 Bacteria 4550
195 Ga0105239_10239180 3300010375 Bacteria 2038
196 Ga0105239_10249747 3300010375 Bacteria 1992
197 Ga0105239_10288313 3300010375 Bacteria 1849
198 Ga0105239_10295637 3300010375 Bacteria 1823
199 Ga0105239_10329723 3300010375 Bacteria 1722
200 Ga0105239_10695239 3300010375 Bacteria 1163
201 Ga0105246_10003863 3300011119 Bacteria 9080
202 Ga0105246_10008743 3300011119 Bacteria 6230
203 Ga0105246_10158827 3300011119 Bacteria 1720
204 Ga0105246_10307077 3300011119 Bacteria 1283
205 Ga0157373_10054979 3300013100 Bacteria 2828
206 Ga0157373_10179545 3300013100 Bacteria 1490
207 Ga0157373_10181968 3300013100 Bacteria 1480
208 Ga0157373_10189989 3300013100 Bacteria 1447
209 Ga0157373_10347984 3300013100 Bacteria 1057
210 Ga0157370_10015573 3300013104 Bacteria 7730
211 Ga0157370_10021189 3300013104 Bacteria 6480
212 Ga0157370_10030406 3300013104 Bacteria 5291
213 Ga0157370_10280674 3300013104 Bacteria 1539
214 Ga0157370_10295092 3300013104 Bacteria 1497
215 Ga0157370_10536870 3300013104 Bacteria 1073
216 Ga0157369_10012438 3300013105 Bacteria 9660
217 Ga0157369_10018818 3300013105 Bacteria 7741
218 Ga0157369_10179243 3300013105 Bacteria 2230
219 Ga0157369_10234935 3300013105 Bacteria 1916
220 Ga0157369_10367091 3300013105 Bacteria 1494
221 Ga0157369_10671519 3300013105 Bacteria 1068
222 Ga0157374_10164342 3300013296 Bacteria 2163
223 Ga0157374_10502181 3300013296 Bacteria 1217
224 Ga0157374_10761745 3300013296 Bacteria 983
225 Ga0157378_10046417 3300013297 Bacteria 3862
226 Ga0157378_10172713 3300013297 Bacteria 2028
227 Ga0157378_10204427 3300013297 Bacteria 1870
228 Ga0157378_10572345 3300013297 Bacteria 1138
229 Ga0163162_10076766 3300013306 Bacteria 3403
230 Ga0163162_10104104 3300013306 Bacteria 2932
231 Ga0163162_10316708 3300013306 Bacteria 1693
232 Ga0163162_11201673 3300013306 Bacteria 860
233 Ga0163162_11598777 3300013306 Bacteria 743
234 Ga0163162_12064324 3300013306 Bacteria 654
235 Ga0157372_10003810 3300013307 Bacteria 16195
236 Ga0157372_10009068 3300013307 Bacteria 10570
237 Ga0157372_10060167 3300013307 Bacteria 4250
238 Ga0157372_10453199 3300013307 Bacteria 1495
239 Ga0157372_10681606 3300013307 Bacteria 1196
240 Ga0157372_11105412 3300013307 Bacteria 917
241 Ga0157375_10349546 3300013308 Bacteria 1644
242 Ga0157375_10530579 3300013308 Bacteria 1340
243 Ga0163163_10000004 3300014325 Bacteria 416569
244 Ga0163163_10135841 3300014325 Bacteria 2501
245 Ga0157380_10636452 3300014326 Bacteria 1061
246 Ga0157379_10032277 3300014968 Bacteria 4668
247 Ga0157379_10480513 3300014968 Bacteria 1150
248 Ga0157379_10532001 3300014968 Bacteria 1092
249 Ga0157376_10196304 3300014969 Bacteria 1854
250 Ga0157376_10244420 3300014969 Bacteria 1673
251 Ga0163161_10029520 3300017792 Bacteria 3899
252 Ga0163161_10626802 3300017792 Bacteria 889
253 Ga0206356_10376855 3300020070 Bacteria 1332
254 Ga0213872_10013025 3300021361 Bacteria 3899
255 Ga0213872_10016435 3300021361 Bacteria 3435
256 Ga0213876_10000131 3300021384 Bacteria 81694
257 Ga0213876_10000223 3300021384 Bacteria 56685
258 Ga0207427_105282 3300025231 Bacteria 1858
259 Ga0209233_1000006 3300025261 Bacteria 1473685
260 Ga0209233_1003621 3300025261 Bacteria 5415
261 Ga0209455_1010456 3300025272 Bacteria 2357
262 Ga0209758_1000008 3300025297 Bacteria 1215263
263 Ga0209758_1003752 3300025297 Bacteria 13449
264 Ga0209758_1084595 3300025297 Bacteria 948
265 Ga0209050_1000053 3300025298 Bacteria 349521
266 Ga0209257_1000419 3300025304 Bacteria 81956
267 Ga0207692_10147698 3300025898 Bacteria 1343
268 Ga0207642_10146555 3300025899 Bacteria 1251
269 Ga0207710_10080081 3300025900 Bacteria 1514
270 Ga0207710_10197057 3300025900 Bacteria 994
271 Ga0207680_10032102 3300025903 Bacteria 2981
272 Ga0207680_10082795 3300025903 Bacteria 2020
273 Ga0207647_10105871 3300025904 Bacteria 1666
274 Ga0207645_10162572 3300025907 Bacteria 1461
275 Ga0207643_10173027 3300025908 Bacteria 1304
276 Ga0207705_10000039 3300025909 Bacteria 193592
277 Ga0207705_10009613 3300025909 Bacteria 7031
278 Ga0207705_10312637 3300025909 Bacteria 1206
279 Ga0207654_10045253 3300025911 Bacteria 2504
280 Ga0207654_10325848 3300025911 Bacteria 1051
281 Ga0207654_10610420 3300025911 Bacteria 779
282 Ga0207654_10807849 3300025911 Bacteria 677
283 Ga0207707_10000002 3300025912 Bacteria 1142054
284 Ga0207707_10001894 3300025912 Bacteria 19063
285 Ga0207707_10060914 3300025912 Bacteria 3283
286 Ga0207707_10103499 3300025912 Bacteria 2489
287 Ga0207707_10134172 3300025912 Bacteria 2165
288 Ga0207707_11082288 3300025912 Bacteria 654
289 Ga0207695_10000012 3300025913 Bacteria 840961
290 Ga0207695_10044089 3300025913 Bacteria 4747
291 Ga0207695_10048638 3300025913 Bacteria 4477
292 Ga0207695_10079077 3300025913 Bacteria 3334
293 Ga0207695_10088395 3300025913 Bacteria 3119
294 Ga0207695_10096933 3300025913 Bacteria 2950
295 Ga0207695_10166309 3300025913 Bacteria 2134
296 Ga0207695_10355867 3300025913 Bacteria 1351
297 Ga0207695_10611593 3300025913 Bacteria 971
298 Ga0207695_10615498 3300025913 Bacteria 967
299 Ga0207695_10665892 3300025913 Bacteria 922
300 Ga0207671_10132903 3300025914 Bacteria 1911
301 Ga0207671_10155108 3300025914 Bacteria 1771
302 Ga0207671_10363464 3300025914 Bacteria 1149
303 Ga0207671_10446785 3300025914 Bacteria 1030
304 Ga0207660_10000299 3300025917 Bacteria 32732
305 Ga0207660_10003148 3300025917 Bacteria 10803
306 Ga0207657_10000182 3300025919 Bacteria 65095
307 Ga0207657_10011088 3300025919 Bacteria 8957
308 Ga0207657_10205154 3300025919 Bacteria 1584
309 Ga0207657_10693657 3300025919 Bacteria 791
310 Ga0207649_10000202 3300025920 Bacteria 49803
311 Ga0207649_10021139 3300025920 Bacteria 3741
312 Ga0207649_10294347 3300025920 Bacteria 1185
313 Ga0207652_10003023 3300025921 Bacteria 14035
314 Ga0207652_10009127 3300025921 Bacteria 7987
315 Ga0207652_10062359 3300025921 Bacteria 3221
316 Ga0207694_10000006 3300025924 Bacteria 631109
317 Ga0207694_10140414 3300025924 Bacteria 1942
318 Ga0207694_10183137 3300025924 Bacteria 1699
319 Ga0207694_10274019 3300025924 Bacteria 1385
320 Ga0207694_10373893 3300025924 Bacteria 1182
321 Ga0207687_10249059 3300025927 Bacteria 1411
322 Ga0207687_10780031 3300025927 Bacteria 814
323 Ga0207700_10274633 3300025928 Bacteria 1447
324 Ga0207700_10339414 3300025928 Bacteria 1306
325 Ga0207700_10442737 3300025928 Bacteria 1144
326 Ga0207700_10786996 3300025928 Bacteria 850
327 Ga0207664_10437401 3300025929 Bacteria 1166
328 Ga0207664_10796365 3300025929 Bacteria 850
329 Ga0207644_10123603 3300025931 Bacteria 1973
330 Ga0207690_10041072 3300025932 Bacteria 3029
331 Ga0207690_10184616 3300025932 Bacteria 1573
332 Ga0207706_10142314 3300025933 Bacteria 2110
333 Ga0207686_10011116 3300025934 Bacteria 4920
334 Ga0207686_10059565 3300025934 Bacteria 2413
335 Ga0207670_10776784 3300025936 Bacteria 797
336 Ga0207670_11195642 3300025936 Bacteria 643
337 Ga0207669_10203483 3300025937 Bacteria 1439
338 Ga0207669_10407195 3300025937 Bacteria 1067
339 Ga0207669_10415730 3300025937 Bacteria 1057
340 Ga0207704_10006263 3300025938 Bacteria 5534
341 Ga0207704_10567784 3300025938 Bacteria 924
342 Ga0207691_10171370 3300025940 Bacteria 1900
343 Ga0207691_10606844 3300025940 Bacteria 926
344 Ga0207711_10000001 3300025941 Bacteria 1325674
345 Ga0207711_10002944 3300025941 Bacteria 14891
346 Ga0207689_10293945 3300025942 Bacteria 1346
347 Ga0207689_10400083 3300025942 Bacteria 1145
348 Ga0207661_10588777 3300025944 Bacteria 1021
349 Ga0207679_10012712 3300025945 Bacteria 5497
350 Ga0207667_10000106 3300025949 Bacteria 133162
351 Ga0207667_10043252 3300025949 Bacteria 4781
352 Ga0207667_10070622 3300025949 Bacteria 3634
353 Ga0207667_10091694 3300025949 Bacteria 3138
354 Ga0207667_10128147 3300025949 Bacteria 2614
355 Ga0207667_10173042 3300025949 Bacteria 2219
356 Ga0207667_10215868 3300025949 Bacteria 1966
357 Ga0207667_10221570 3300025949 Bacteria 1938
358 Ga0207667_10338456 3300025949 Bacteria 1536
359 Ga0207667_10921077 3300025949 Bacteria 865
360 Ga0207651_10324631 3300025960 Bacteria 1288
361 Ga0207651_10790529 3300025960 Bacteria 841
362 Ga0207712_10173194 3300025961 Bacteria 1689
363 Ga0207668_10249845 3300025972 Bacteria 1440
364 Ga0207640_10110715 3300025981 Bacteria 1946
365 Ga0207640_10206006 3300025981 Bacteria 1494
366 Ga0207640_10712703 3300025981 Bacteria 861
367 Ga0207658_10207346 3300025986 Bacteria 1640
368 Ga0207677_10022754 3300026023 Bacteria 3858
369 Ga0207677_10205256 3300026023 Bacteria 1569
370 Ga0207703_10039615 3300026035 Bacteria 3766
371 Ga0207639_10007079 3300026041 Bacteria 7650
372 Ga0207639_10022836 3300026041 Bacteria 4510
373 Ga0207639_10051462 3300026041 Bacteria 3133
374 Ga0207639_10456328 3300026041 Bacteria 1161
375 Ga0207639_10458611 3300026041 Bacteria 1158
376 Ga0207702_10045794 3300026078 Bacteria 3680
377 Ga0207702_10128865 3300026078 Bacteria 2275
378 Ga0207702_10183578 3300026078 Bacteria 1928
379 Ga0207702_10244340 3300026078 Bacteria 1683
380 Ga0207702_11154633 3300026078 Bacteria 769
381 Ga0207641_10018113 3300026088 Bacteria 5771
382 Ga0207641_10051374 3300026088 Bacteria 3491
383 Ga0207648_10018030 3300026089 Bacteria 6397
384 Ga0207648_10288660 3300026089 Bacteria 1468
385 Ga0207648_10444665 3300026089 Bacteria 1179
386 Ga0207674_10074152 3300026116 Bacteria 3415
387 Ga0207674_10412185 3300026116 Bacteria 1306
388 Ga0207675_100332284 3300026118 Bacteria 1486
389 Ga0207675_100829136 3300026118 Bacteria 939
390 Ga0207683_10011944 3300026121 Bacteria 7413
391 Ga0207683_10146834 3300026121 Bacteria 2127
392 Ga0207683_10192413 3300026121 Bacteria 1852
393 Ga0207683_10398651 3300026121 Bacteria 1266
394 Ga0207698_10011195 3300026142 Bacteria 5805
395 Ga0207698_10138264 3300026142 Bacteria 2094
396 Ga0207698_10142313 3300026142 Bacteria 2068
397 Ga0209813_10021479 3300027866 Bacteria 1816
398 Ga0268266_10009800 3300028379 Bacteria 8426
399 Ga0268266_10049299 3300028379 Bacteria 3611
400 Ga0268266_10095391 3300028379 Bacteria 2612
401 Ga0268266_10247947 3300028379 Bacteria 1646
402 Ga0268266_10715328 3300028379 Bacteria 965
403 Ga0268265_10245102 3300028380 Bacteria 1584
404 Ga0268265_10456052 3300028380 Bacteria 1195
405 Ga0268264_11256986 3300028381 Bacteria 750
406 Ga0265334_10040829 3300028573 Bacteria 1815
407 Ga0265318_10000125 3300028577 Bacteria 70978
408 Ga0265323_10151707 3300028653 Bacteria 742
409 Ga0265338_10000011 3300028800 Bacteria 433370
410 Ga0265338_10011053 3300028800 Bacteria 10473
411 Ga0265330_10009650 3300031235 Bacteria 4577
412 Ga0265330_10266738 3300031235 Bacteria 721
413 Ga0265332_10012624 3300031238 Bacteria 3746
414 Ga0265332_10015641 3300031238 Bacteria 3349
415 Ga0265332_10045584 3300031238 Bacteria 1890
416 Ga0265328_10000120 3300031239 Bacteria 37260
417 Ga0265328_10192501 3300031239 Bacteria 773
418 Ga0265325_10000002 3300031241 Bacteria 396758
419 Ga0265325_10117778 3300031241 Bacteria 1284
420 Ga0265329_10022488 3300031242 Bacteria 2108
421 Ga0265340_10004297 3300031247 Bacteria 7988
422 Ga0265340_10034266 3300031247 Bacteria 2526
423 Ga0265339_10000210 3300031249 Bacteria 48022
424 Ga0265339_10148637 3300031249 Bacteria 1187
425 Ga0265331_10000008 3300031250 Bacteria 324311
426 Ga0265331_10007067 3300031250 Bacteria 6546
427 Ga0265331_10027552 3300031250 Bacteria 2848
428 Ga0265327_10000007 3300031251 Bacteria 678515
429 Ga0265327_10000378 3300031251 Bacteria 83787
430 Ga0265327_10000448 3300031251 Bacteria 74589
431 Ga0265316_10000166 3300031344 Bacteria 74574
432 Ga0265316_10029385 3300031344 Bacteria 4521
433 Ga0265316_10365180 3300031344 Bacteria 1043
434 Ga0307513_10382286 3300031456 Bacteria 1147
435 Ga0265313_10003445 3300031595 Bacteria 12798
436 Ga0265313_10029414 3300031595 Bacteria 2842
437 Ga0265313_10037366 3300031595 Bacteria 2429
438 Ga0265313_10226760 3300031595 Bacteria 769
439 Ga0316575_10008759 3300031665 Bacteria 3693
440 Ga0316579_10006719 3300031691 Bacteria 4711
441 Ga0265314_10010428 3300031711 Bacteria 7751
442 Ga0265314_10017005 3300031711 Bacteria 5720
443 Ga0265314_10045723 3300031711 Bacteria 3093
444 Ga0265314_10060570 3300031711 Bacteria 2583
445 Ga0265314_10083518 3300031711 Bacteria 2099
446 Ga0265314_10426199 3300031711 Bacteria 712
447 Ga0265342_10004548 3300031712 Bacteria 10857
448 Ga0265342_10021542 3300031712 Bacteria 4113
449 Ga0265342_10042949 3300031712 Bacteria 2729
450 Ga0265342_10079237 3300031712 Bacteria 1900
451 Ga0316576_10137592 3300031727 Bacteria 1838
452 Ga0316578_10008260 3300031728 Bacteria 5286
453 Ga0307516_10032110 3300031730 Bacteria 5288
454 Ga0307516_10053974 3300031730 Bacteria 3928
455 Ga0316577_10007601 3300031733 Bacteria 5784
456 Ga0307411_10401480 3300032005 Bacteria 1133
457 Ga0316583_10008084 3300032133 Bacteria 3791
458 Ga0316585_10097959 3300032137 Bacteria 961
459 Ga0316593_10050086 3300032168 Bacteria 1408
460 Ga0316593_10137636 3300032168 Bacteria 884
461 Ga0316586_1024394 3300033527 Bacteria 1014
462 Ga0316596_1009559 3300033541 Bacteria 2328
463 Ga0373926_0033443 3300035083 Bacteria 1817
464 Ga0373944_0250575 3300035089 Bacteria 653
465 Ga0373923_0091651 3300035111 Bacteria 1330
466 Ga0373943_0011712 3300035170 Bacteria 3948
467 Ga0373942_0082712 3300035207 Bacteria 956
468 Ga0316574_0069703 3300035398 Bacteria 2220
469 Ga0316574_0286496 3300035398 Bacteria 1049
470 Ga0373931_0017524 3300035691 Bacteria 3546
471 Ga0373931_0208770 3300035691 Bacteria 1170
472 Ga0373935_0013398 3300035692 Bacteria 4947
473 Ga0373935_0758070 3300035692 Bacteria 715
474 Ga0373935_0760682 3300035692 Bacteria 714
475 Ga0373927_0073947 3300035695 Bacteria 2207
476 Ga0373927_0345719 3300035695 Bacteria 980
477 Ga0373933_0022090 3300035724 Bacteria 3622
478 Ga0373947_0002762 3300035725 Bacteria 10503
479 Ga0373937_0022231 3300036401 Bacteria 5700
480 Ga0373937_0235702 3300036401 Bacteria 1724
481 Ga0373937_0455629 3300036401 Bacteria 1215
482 Ga0316582_0007371 3300036647 Bacteria 5851
483 Ga0316582_0018675 3300036647 Bacteria 4041
484 Ga0316584_0073425 3300036712 Bacteria 2564
485 Ga0316584_0152083 3300036712 Bacteria 1722
486 Ga0316584_0203146 3300036712 Bacteria 1461
487 Ga0316584_0398402 3300036712 Bacteria 981
488 Ga0373925_0002319 3300037068 Bacteria 15305
489 Ga0373925_0301831 3300037068 Bacteria 1293
490 Ga0373925_0507374 3300037068 Bacteria 990
491 Ga0395899_0000003 3300037312 Bacteria 1232684
492 Ga0395899_0028713 3300037312 Bacteria 4186
493 Ga0395899_0111167 3300037312 Bacteria 1970
494 Ga0395899_0113465 3300037312 Bacteria 1946
495 Ga0395899_0170756 3300037312 Bacteria 1531
496 Ga0395900_0023024 3300037418 Bacteria 6375
497 Ga0395900_0106335 3300037418 Bacteria 2882
498 Ga0395900_0126165 3300037418 Bacteria 2625
499 Ga0395900_0914888 3300037418 Bacteria 800
500 Ga0395898_0027033 3300037466 Bacteria 5764
501 Ga0395898_0127038 3300037466 Bacteria 2443
502 Ga0395901_0025294 3300038443 Bacteria 6094
503 Ga0395901_0026613 3300038443 Bacteria 5939
504 Ga0395901_0035463 3300038443 Bacteria 5153
505 Ga0395901_0104585 3300038443 Bacteria 2971
506 Ga0436365_0412683 3300039437 Bacteria 137628
507 Ga0436365_0583194 3300039437 Bacteria 93933
508 Ga0436365_0622716 3300039437 Bacteria 758
509 Ga0436360_0032462 3300039438 Bacteria 1027
510 Ga0436360_0052066 3300039438 Bacteria 6744
511 Ga0436360_0299898 3300039438 Bacteria 1563
512 Ga0436360_1107921 3300039438 Bacteria 705
513 Ga0436361_0331544 3300039447 Bacteria 5779
514 Ga0436361_1016532 3300039447 Bacteria 20016
515 Ga0439465_0271522 3300041413 Bacteria 630
516 Ga0466969_0059802 3300044656 Bacteria 1853
517 Ga0466972_0182774 3300044658 Bacteria 983
518 Ga0466965_0355330 3300044683 Bacteria 803
519 Ga0466963_0022801 3300044694 Bacteria 3969
520 Ga0453684_0013252 3300044712 Bacteria 13428
521 Ga0466957_0137190 3300044842 Bacteria 1573
522 Ga0466967_0045841 3300045976 Bacteria 3802
523 Ga0466967_0199478 3300045976 Bacteria 1894
524 Ga0495592_0077637 3300046454 Bacteria 2407
525 Ga0495650_0180970 3300046471 Bacteria 741
526 Ga0495580_0006646 3300046472 Bacteria 9395
527 Ga0495582_0019757 3300046473 Bacteria 3683
528 Ga0495664_0068218 3300046477 Bacteria 2122
529 Ga0495664_0078945 3300046477 Bacteria 1972
530 Ga0495583_0144926 3300046506 Bacteria 987
531 Ga0495606_0152282 3300046507 Bacteria 1356
532 Ga0495628_0240644 3300046516 Bacteria 1354
533 Ga0495652_0130500 3300046529 Bacteria 1990
534 Ga0495654_0177094 3300046530 Bacteria 926
535 Ga0495587_0089424 3300046536 Bacteria 1780
536 Ga0495587_0120377 3300046536 Bacteria 1504
537 Ga0495645_0025828 3300046543 Bacteria 4264
538 Ga0495622_0027198 3300046557 Bacteria 2669
539 Ga0495668_0027699 3300046616 Bacteria 3211
540 Ga0495625_0128771 3300046660 Bacteria 1716
541 Ga0495661_0128297 3300046665 Bacteria 1393
542 Ga0495658_0000786 3300046683 Bacteria 17094
543 Ga0495658_0304952 3300046683 Bacteria 1008
544 Ga0495671_0247488 3300046692 Bacteria 861
545 Ga0495649_0096524 3300046694 Bacteria 1573
546 Ga0495589_0060561 3300046794 Bacteria 1859
547 Ga0495581_0220315 3300047315 Bacteria 1109
548 Ga0495674_0818516 3300047319 Bacteria 723
549 Ga0495672_0302653 3300047320 Bacteria 757
550 Ga0495675_0100779 3300047444 Bacteria 1808
551 Ga0495677_0261284 3300047445 Bacteria 678
552 Ga0495681_0190725 3300047470 Bacteria 837
553 Ga0495686_0051514 3300047472 Bacteria 2583
554 Ga0496100_1033004 3300048903 Bacteria 647
555 Ga0496113_0707092 3300048916 Bacteria 804
556 Ga0496115_0922846 3300048918 Bacteria 672
557 Ga0496121_0001329 3300048924 Bacteria 42366
558 Ga0496125_0014570 3300048928 Bacteria 7651
559 Ga0496126_0013404 3300048929 Bacteria 8340
560 Ga0496126_0023833 3300048929 Bacteria 5925
561 Ga0496126_0224789 3300048929 Bacteria 1575
562 Ga0495682_0007197 3300049460 Bacteria 4443
563 Ga0501031_0190379 3300049568 Bacteria 1340
564 Ga0501032_0134742 3300049569 Bacteria 1628
565 Ga0501032_0373633 3300049569 Bacteria 917
566 Ga0501032_0575055 3300049569 Bacteria 718
567 Ga0501033_0007822 3300049570 Bacteria 8284
568 Ga0501033_0026925 3300049570 Bacteria 4325
569 Ga0501033_0203755 3300049570 Bacteria 1412
570 Ga0501033_0537907 3300049570 Bacteria 806
571 Ga0501033_0844885 3300049570 Bacteria 617
572 Ga0501034_0012128 3300049571 Bacteria 8909
573 Ga0501034_0022018 3300049571 Bacteria 6493
574 Ga0501034_0148872 3300049571 Bacteria 2317
575 Ga0501034_0179678 3300049571 Bacteria 2081
576 Ga0501034_0273951 3300049571 Bacteria 1628
577 Ga0501034_0347153 3300049571 Bacteria 1413
578 Ga0501034_0587790 3300049571 Bacteria 1020
579 Ga0501034_0848918 3300049571 Bacteria 803
580 Ga0501036_0032242 3300049572 Bacteria 4427
581 Ga0501036_0062239 3300049572 Bacteria 3161
582 Ga0501036_0127765 3300049572 Bacteria 2146
583 Ga0501037_0004982 3300049573 Bacteria 9654
584 Ga0501037_0042046 3300049573 Bacteria 3360
585 Ga0501037_0163451 3300049573 Bacteria 1586
586 Ga0501037_0195455 3300049573 Bacteria 1431
587 Ga0501037_0267913 3300049573 Bacteria 1192
588 Ga0501037_0374380 3300049573 Bacteria 980
589 Ga0501038_0016935 3300049574 Bacteria 6596
590 Ga0501038_0084195 3300049574 Bacteria 2676
591 Ga0501038_0095289 3300049574 Bacteria 2486
592 Ga0501039_0145112 3300049575 Bacteria 1865
593 Ga0501039_0159743 3300049575 Bacteria 1771
594 Ga0501041_0441680 3300049577 Bacteria 826
595 Ga0501042_0190091 3300049578 Bacteria 1481
596 Ga0501043_0006812 3300049579 Bacteria 9120
597 Ga0501043_0053675 3300049579 Bacteria 3165
598 Ga0501043_0106668 3300049579 Bacteria 2200
599 Ga0501043_0186019 3300049579 Bacteria 1617
600 Ga0501046_0041043 3300049580 Bacteria 3694
601 Ga0501046_0052245 3300049580 Bacteria 3221
602 Ga0501046_0079038 3300049580 Bacteria 2544
603 Ga0501046_0192059 3300049580 Bacteria 1523
604 Ga0501047_0003552 3300049581 Bacteria 14724
605 Ga0501047_0004810 3300049581 Bacteria 12698
606 Ga0501047_0017577 3300049581 Bacteria 6852
607 Ga0501047_0023081 3300049581 Bacteria 5972
608 Ga0501047_0101831 3300049581 Bacteria 2751
609 Ga0501047_0188144 3300049581 Bacteria 1929
610 Ga0501047_0207020 3300049581 Bacteria 1821
611 Ga0501047_0208303 3300049581 Bacteria 1814
612 Ga0501047_0367506 3300049581 Bacteria 1274
613 Ga0501047_0370312 3300049581 Bacteria 1267
614 Ga0501047_0403510 3300049581 Bacteria 1200
615 Ga0501047_0423375 3300049581 Bacteria 1163
616 Ga0501047_0423578 3300049581 Bacteria 1162
617 Ga0501047_0729706 3300049581 Bacteria 807
618 Ga0501048_0047002 3300049582 Bacteria 3081
619 Ga0501048_0588449 3300049582 Bacteria 799
620 Ga0501067_0008586 3300049583 Bacteria 5662
621 Ga0501067_0032197 3300049583 Bacteria 2910
622 Ga0501067_0160031 3300049583 Bacteria 1254
623 Ga0501068_0027961 3300049584 Bacteria 3332
624 Ga0501068_0046942 3300049584 Bacteria 2604
625 Ga0501068_0190510 3300049584 Bacteria 1299
626 Ga0501069_0004797 3300049585 Bacteria 6998
627 Ga0501069_0030658 3300049585 Bacteria 2954
628 Ga0501069_0366144 3300049585 Bacteria 851
629 Ga0501070_0000017 3300049586 Bacteria 173127
630 Ga0501070_0018465 3300049586 Bacteria 5851
631 Ga0501070_0023545 3300049586 Bacteria 5159
632 Ga0501070_0023934 3300049586 Bacteria 5118
633 Ga0501070_0132750 3300049586 Bacteria 2057
634 Ga0501070_0490151 3300049586 Bacteria 988
635 Ga0501071_0133031 3300049587 Bacteria 1849
636 Ga0501071_0707638 3300049587 Bacteria 776
637 Ga0501072_0007532 3300049588 Bacteria 8261
638 Ga0501072_0054427 3300049588 Bacteria 3152
639 Ga0501072_0489676 3300049588 Bacteria 973
640 Ga0501073_0000774 3300049589 Bacteria 22725
641 Ga0501073_0004084 3300049589 Bacteria 10948
642 Ga0501073_0014201 3300049589 Bacteria 5784
643 Ga0501073_0023292 3300049589 Bacteria 4447
644 Ga0501073_0025337 3300049589 Bacteria 4254
645 Ga0501073_0030670 3300049589 Bacteria 3838
646 Ga0501073_0181336 3300049589 Bacteria 1457
647 Ga0501074_0002018 3300049590 Bacteria 13990
648 Ga0501074_0059868 3300049590 Bacteria 2743
649 Ga0501074_0248877 3300049590 Bacteria 1264
650 Ga0501079_0020834 3300049741 Bacteria 5013
651 Ga0501079_0089875 3300049741 Bacteria 2379
652 Ga0501080_0000333 3300049742 Bacteria 36064
653 Ga0501080_0006334 3300049742 Bacteria 10621
654 Ga0501080_0044966 3300049742 Bacteria 4110
655 Ga0501080_0056991 3300049742 Bacteria 3638
656 Ga0501080_0199115 3300049742 Bacteria 1839
657 Ga0501080_0214786 3300049742 Bacteria 1762
658 Ga0501080_0356266 3300049742 Bacteria 1320
659 Ga0501080_0790186 3300049742 Bacteria 833
660 Ga0501083_0072607 3300049744 Bacteria 2287
661 Ga0501083_0200990 3300049744 Bacteria 1300
662 Ga0501083_0333490 3300049744 Bacteria 986
663 Ga0501083_0916891 3300049744 Bacteria 570
664 Ga0501035_0001049 3300049822 Bacteria 28932
665 Ga0501035_0012693 3300049822 Bacteria 7784
666 Ga0501035_0016834 3300049822 Bacteria 6740
667 Ga0501035_0019089 3300049822 Bacteria 6311
668 Ga0501035_0049373 3300049822 Bacteria 3771
669 Ga0501035_0056615 3300049822 Bacteria 3497
670 Ga0501035_0146683 3300049822 Bacteria 2049
671 Ga0501035_0191585 3300049822 Bacteria 1758
672 Ga0501035_0504396 3300049822 Bacteria 995
673 Ga0501044_0001245 3300049823 Bacteria 30224
674 Ga0501044_0001370 3300049823 Bacteria 28586
675 Ga0501044_0052068 3300049823 Bacteria 4220
676 Ga0501044_0097356 3300049823 Bacteria 2963
677 Ga0501044_0110732 3300049823 Bacteria 2754
678 Ga0501044_0111932 3300049823 Bacteria 2737
679 Ga0501044_0128268 3300049823 Bacteria 2532
680 Ga0501044_0292011 3300049823 Bacteria 1561
681 Ga0501044_0414556 3300049823 Bacteria 1258
682 Ga0501044_1057020 3300049823 Bacteria 682
683 nmdc:mga03683_1310_c2 3300050489 Bacteria 4937
684 nmdc:mga03683_138765_c1 3300050489 Bacteria 1092
685 nmdc:mga0yw44_605724_c1 3300050492 Bacteria 744
686 nmdc:mga0k408_35812_c1 3300050493 Bacteria 2846
687 nmdc:mga07m45_88931_c2 3300050496 Bacteria 1256
688 Ga0500643_000017 3300053087 Bacteria 305781
689 Ga0500643_028198 3300053087 Bacteria 1738
690 Ga0500644_0026343 3300053088 Bacteria 1798
691 Ga0500646_0027744 3300053090 Bacteria 1542
692 Ga0500566_0244845 3300053094 Bacteria 876
693 Ga0500562_000194 3300053108 Bacteria 16526
694 Ga0500562_008365 3300053108 Bacteria 2613
695 Ga0500592_018049 3300053116 Bacteria 1132
696 Ga0500595_026534 3300053119 Bacteria 1995
697 Ga0500642_0030073 3300053130 Bacteria 2257
698 Ga0500652_053043 3300053131 Bacteria 1659
699 Ga0500568_0029387 3300053139 Bacteria 2282
700 Ga0500573_0000055 3300053140 Bacteria 82259
701 Ga0500577_0097599 3300053142 Bacteria 1197
702 Ga0500616_0066993 3300053153 Bacteria 1842
703 Ga0500639_103245 3300053163 Bacteria 1398
704 Ga0500576_132277 3300053725 Bacteria 964
705 Ga0500645_001712 3300053730 Bacteria 10672
706 Ga0500645_019975 3300053730 Bacteria 2079
707 Ga0501084_0000288 3300054114 Bacteria 38135
708 Ga0501084_0007244 3300054114 Bacteria 9144
709 Ga0501084_0026675 3300054114 Bacteria 4823
710 Ga0501084_0121710 3300054114 Bacteria 2194
711 Ga0501084_0403800 3300054114 Bacteria 1155
712 Ga0501082_0020561 3300060353 Bacteria 5689
713 Ga0501082_0042317 3300060353 Bacteria 3927
714 Ga0501082_0149628 3300060353 Bacteria 2027
715 Ga0501082_0560580 3300060353 Bacteria 999
716 Ga0501082_0649192 3300060353 Bacteria 923

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053725 Ga0500576_132277 Ga0500576_132277_25_543 159
2 3300047444 Ga0495675_0100779 Ga0495675_0100779_714_1229 161
3 3300049571 Ga0501034_0347153 Ga0501034_0347153_870_1403 161
4 3300031665 Ga0316575_10008759 Ga0316575_100087594 165
5 3300049586 Ga0501070_0132750 Ga0501070_0132750_1462_2013 165
6 3300053087 Ga0500643_028198 Ga0500643_028198_57_566 165
7 3300053108 Ga0500562_008365 Ga0500562_008365_553_1062 165
8 3300053153 Ga0500616_0066993 Ga0500616_0066993_695_1204 165
9 3300053730 Ga0500645_001712 Ga0500645_001712_9114_9623 165
10 3300005543 Ga0070672_100429275 Ga0070672_1004292752 166
11 3300005718 Ga0068866_10050112 Ga0068866_100501124 166
12 3300005840 Ga0068870_10186449 Ga0068870_101864492 166
13 3300005843 Ga0068860_100139352 Ga0068860_1001393522 166
14 3300006237 Ga0097621_100000270 Ga0097621_10000027026 166
15 3300006237 Ga0097621_100017434 Ga0097621_1000174344 166
16 3300006237 Ga0097621_100040414 Ga0097621_1000404144 166
17 3300006237 Ga0097621_100065040 Ga0097621_1000650402 166
18 3300006358 Ga0068871_100004963 Ga0068871_1000049638 166
19 3300006358 Ga0068871_100008068 Ga0068871_1000080688 166
20 3300006881 Ga0068865_100009233 Ga0068865_1000092336 166
21 3300009174 Ga0105241_10985457 Ga0105241_109854571 166
22 3300009176 Ga0105242_10080115 Ga0105242_100801153 166
23 3300017792 Ga0163161_10029520 Ga0163161_100295203 166
24 3300025899 Ga0207642_10146555 Ga0207642_101465552 166
25 3300025907 Ga0207645_10162572 Ga0207645_101625722 166
26 3300025924 Ga0207694_10274019 Ga0207694_102740192 166
27 3300025927 Ga0207687_10780031 Ga0207687_107800311 166
28 3300025934 Ga0207686_10011116 Ga0207686_100111163 166
29 3300025938 Ga0207704_10006263 Ga0207704_100062633 166
30 3300025940 Ga0207691_10606844 Ga0207691_106068442 166
31 3300025942 Ga0207689_10293945 Ga0207689_102939452 166
32 3300026023 Ga0207677_10205256 Ga0207677_102052561 166
33 3300026089 Ga0207648_10018030 Ga0207648_100180306 166
34 3300026121 Ga0207683_10011944 Ga0207683_100119444 166
35 3300028381 Ga0268264_11256986 Ga0268264_112569861 166
36 3300047472 Ga0495686_0051514 Ga0495686_0051514_882_1397 166
37 3300048929 Ga0496126_0013404 Ga0496126_0013404_548_1063 166
38 3300049581 Ga0501047_0367506 Ga0501047_0367506_98_622 166
39 3300049822 Ga0501035_0016834 Ga0501035_0016834_1687_2223 166
40 3300050496 nmdc:mga07m45_88931_c2 nmdc:mga07m45_88931_c2_286_801 166
41 3300005434 Ga0070709_10227564 Ga0070709_102275642 167
42 3300005435 Ga0070714_100108291 Ga0070714_1001082912 167
43 3300025929 Ga0207664_10437401 Ga0207664_104374012 167
44 3300031239 Ga0265328_10000120 Ga0265328_1000012011 167
45 3300031728 Ga0316578_10008260 Ga0316578_100082606 167
46 3300032168 Ga0316593_10050086 Ga0316593_100500863 167
47 3300033527 Ga0316586_1024394 Ga0316586_10243942 167
48 3300033541 Ga0316596_1009559 Ga0316596_10095593 167
49 3300035083 Ga0373926_0033443 Ga0373926_0033443_959_1501 167
50 3300035089 Ga0373944_0250575 Ga0373944_0250575_91_633 167
51 3300035170 Ga0373943_0011712 Ga0373943_0011712_607_1149 167
52 3300035398 Ga0316574_0286496 Ga0316574_0286496_482_997 167
53 3300035692 Ga0373935_0013398 Ga0373935_0013398_712_1254 167
54 3300035725 Ga0373947_0002762 Ga0373947_0002762_5563_6105 167
55 3300036712 Ga0316584_0073425 Ga0316584_0073425_1506_2021 167
56 3300037068 Ga0373925_0002319 Ga0373925_0002319_5374_5916 167
57 3300037068 Ga0373925_0301831 Ga0373925_0301831_512_1054 167
58 3300039438 Ga0436360_1107921 Ga0436360_1107921_79_621 167
59 3300046472 Ga0495580_0006646 Ga0495580_0006646_6116_6658 167
60 3300046473 Ga0495582_0019757 Ga0495582_0019757_1353_1895 167
61 3300046683 Ga0495658_0000786 Ga0495658_0000786_7417_7959 167
62 3300047315 Ga0495581_0220315 Ga0495581_0220315_386_928 167
63 3300047319 Ga0495674_0818516 Ga0495674_0818516_125_667 167
64 3300053131 Ga0500652_053043 Ga0500652_053043_787_1311 167
65 iso_pu_bacteria 2643221614 2644087584 167
66 iso_pu_bacteria 2643221661 2644344372 167
67 iso_pu_bacteria 2643221666 2644366943 167
68 3300001979 JGI24740J21852_10084318 JGI24740J21852_100843181 168
69 3300002067 JGI24735J21928_10132198 JGI24735J21928_101321981 168
70 3300003214 JGI25165J46597_1000035 JGI25165J46597_100003510 168
71 3300003215 JGI25153J46596_10000362 JGI25153J46596_1000036211 168
72 3300003794 Ga0055531_10026506 Ga0055531_100265062 168
73 3300004799 Ga0058863_11751868 Ga0058863_117518682 168
74 3300005262 Ga0065165_1044999 Ga0065165_10449992 168
75 3300005327 Ga0070658_10068667 Ga0070658_100686673 168
76 3300005327 Ga0070658_10073106 Ga0070658_100731062 168
77 3300005327 Ga0070658_10158451 Ga0070658_101584513 168
78 3300005328 Ga0070676_10035640 Ga0070676_100356402 168
79 3300005328 Ga0070676_10285350 Ga0070676_102853502 168
80 3300005329 Ga0070683_100033947 Ga0070683_1000339472 168
81 3300005329 Ga0070683_100207763 Ga0070683_1002077632 168
82 3300005329 Ga0070683_100494320 Ga0070683_1004943201 168
83 3300005330 Ga0070690_100115009 Ga0070690_1001150092 168
84 3300005333 Ga0070677_10110348 Ga0070677_101103482 168
85 3300005334 Ga0068869_100131986 Ga0068869_1001319862 168
86 3300005334 Ga0068869_100397420 Ga0068869_1003974202 168
87 3300005334 Ga0068869_100943635 Ga0068869_1009436351 168
88 3300005335 Ga0070666_10073561 Ga0070666_100735614 168
89 3300005335 Ga0070666_10168118 Ga0070666_101681182 168
90 3300005336 Ga0070680_100006785 Ga0070680_1000067854 168
91 3300005336 Ga0070680_100019163 Ga0070680_1000191632 168
92 3300005336 Ga0070680_100169100 Ga0070680_1001691002 168
93 3300005336 Ga0070680_100761467 Ga0070680_1007614671 168
94 3300005337 Ga0070682_100232679 Ga0070682_1002326791 168
95 3300005337 Ga0070682_100990295 Ga0070682_1009902951 168
96 3300005338 Ga0068868_100038243 Ga0068868_1000382431 168
97 3300005338 Ga0068868_100057362 Ga0068868_1000573624 168
98 3300005338 Ga0068868_100158380 Ga0068868_1001583802 168
99 3300005339 Ga0070660_100013047 Ga0070660_1000130474 168
100 3300005339 Ga0070660_100053117 Ga0070660_1000531174 168
101 3300005341 Ga0070691_10006515 Ga0070691_100065154 168
102 3300005341 Ga0070691_10033661 Ga0070691_100336613 168
103 3300005344 Ga0070661_100053235 Ga0070661_1000532354 168
104 3300005344 Ga0070661_100279089 Ga0070661_1002790892 168
105 3300005354 Ga0070675_100117750 Ga0070675_1001177502 168
106 3300005354 Ga0070675_100158737 Ga0070675_1001587373 168
107 3300005355 Ga0070671_100135004 Ga0070671_1001350042 168
108 3300005355 Ga0070671_100343986 Ga0070671_1003439861 168
109 3300005356 Ga0070674_100606420 Ga0070674_1006064201 168
110 3300005356 Ga0070674_100771809 Ga0070674_1007718091 168
111 3300005364 Ga0070673_100158736 Ga0070673_1001587362 168
112 3300005364 Ga0070673_101207637 Ga0070673_1012076371 168
113 3300005366 Ga0070659_100033717 Ga0070659_1000337173 168
114 3300005366 Ga0070659_100650536 Ga0070659_1006505361 168
115 3300005367 Ga0070667_100034132 Ga0070667_1000341326 168
116 3300005436 Ga0070713_100159253 Ga0070713_1001592532 168
117 3300005437 Ga0070710_10474489 Ga0070710_104744891 168
118 3300005441 Ga0070700_100533575 Ga0070700_1005335751 168
119 3300005445 Ga0070708_100249640 Ga0070708_1002496402 168
120 3300005456 Ga0070678_100008608 Ga0070678_1000086086 168
121 3300005456 Ga0070678_100151089 Ga0070678_1001510893 168
122 3300005456 Ga0070678_100189794 Ga0070678_1001897941 168
123 3300005456 Ga0070678_100403021 Ga0070678_1004030212 168
124 3300005456 Ga0070678_100599862 Ga0070678_1005998621 168
125 3300005457 Ga0070662_100690571 Ga0070662_1006905711 168
126 3300005457 Ga0070662_100726784 Ga0070662_1007267841 168
127 3300005458 Ga0070681_10000002 Ga0070681_10000002509 168
128 3300005458 Ga0070681_10003070 Ga0070681_1000307010 168
129 3300005458 Ga0070681_10072889 Ga0070681_100728893 168
130 3300005458 Ga0070681_10121171 Ga0070681_101211712 168
131 3300005458 Ga0070681_10410599 Ga0070681_104105992 168
132 3300005458 Ga0070681_10427701 Ga0070681_104277012 168
133 3300005459 Ga0068867_100007771 Ga0068867_1000077718 168
134 3300005459 Ga0068867_100088193 Ga0068867_1000881934 168
135 3300005459 Ga0068867_100397773 Ga0068867_1003977731 168
136 3300005459 Ga0068867_100634065 Ga0068867_1006340651 168
137 3300005466 Ga0070685_11135120 Ga0070685_111351201 168
138 3300005518 Ga0070699_100385633 Ga0070699_1003856331 168
139 3300005530 Ga0070679_100000035 Ga0070679_10000003576 168
140 3300005530 Ga0070679_100004953 Ga0070679_1000049536 168
141 3300005530 Ga0070679_100014205 Ga0070679_1000142055 168
142 3300005530 Ga0070679_100039445 Ga0070679_1000394454 168
143 3300005535 Ga0070684_100119853 Ga0070684_1001198533 168
144 3300005535 Ga0070684_100412945 Ga0070684_1004129452 168
145 3300005536 Ga0070697_100020390 Ga0070697_1000203904 168
146 3300005539 Ga0068853_100036211 Ga0068853_1000362113 168
147 3300005539 Ga0068853_100267120 Ga0068853_1002671202 168
148 3300005539 Ga0068853_100291840 Ga0068853_1002918402 168
149 3300005539 Ga0068853_100793324 Ga0068853_1007933241 168
150 3300005545 Ga0070695_101421002 Ga0070695_1014210021 168
151 3300005547 Ga0070693_100096925 Ga0070693_1000969252 168
152 3300005547 Ga0070693_100149993 Ga0070693_1001499932 168
153 3300005547 Ga0070693_100320061 Ga0070693_1003200612 168
154 3300005548 Ga0070665_100000322 Ga0070665_10000032210 168
155 3300005548 Ga0070665_100043912 Ga0070665_1000439122 168
156 3300005548 Ga0070665_100057177 Ga0070665_1000571773 168
157 3300005548 Ga0070665_100136234 Ga0070665_1001362342 168
158 3300005548 Ga0070665_100213662 Ga0070665_1002136622 168
159 3300005548 Ga0070665_100356014 Ga0070665_1003560142 168
160 3300005563 Ga0068855_100000038 Ga0068855_10000003874 168
161 3300005563 Ga0068855_100016691 Ga0068855_1000166912 168
162 3300005563 Ga0068855_100022893 Ga0068855_1000228938 168
163 3300005563 Ga0068855_100176837 Ga0068855_1001768372 168
164 3300005563 Ga0068855_100241094 Ga0068855_1002410943 168
165 3300005563 Ga0068855_100431255 Ga0068855_1004312552 168
166 3300005563 Ga0068855_100624837 Ga0068855_1006248372 168
167 3300005563 Ga0068855_101073526 Ga0068855_1010735262 168
168 3300005564 Ga0070664_100039851 Ga0070664_1000398513 168
169 3300005578 Ga0068854_100463577 Ga0068854_1004635772 168
170 3300005578 Ga0068854_100692116 Ga0068854_1006921161 168
171 3300005578 Ga0068854_100965265 Ga0068854_1009652651 168
172 3300005578 Ga0068854_101091332 Ga0068854_1010913321 168
173 3300005614 Ga0068856_100173470 Ga0068856_1001734703 168
174 3300005614 Ga0068856_100217518 Ga0068856_1002175183 168
175 3300005614 Ga0068856_100256297 Ga0068856_1002562973 168
176 3300005614 Ga0068856_100400148 Ga0068856_1004001482 168
177 3300005614 Ga0068856_100548606 Ga0068856_1005486062 168
178 3300005614 Ga0068856_100721512 Ga0068856_1007215122 168
179 3300005614 Ga0068856_101291640 Ga0068856_1012916402 168
180 3300005615 Ga0070702_100173141 Ga0070702_1001731411 168
181 3300005616 Ga0068852_100230981 Ga0068852_1002309812 168
182 3300005617 Ga0068859_100380549 Ga0068859_1003805492 168
183 3300005618 Ga0068864_101788348 Ga0068864_1017883481 168
184 3300005719 Ga0068861_100220098 Ga0068861_1002200983 168
185 3300005834 Ga0068851_10188533 Ga0068851_101885332 168
186 3300005841 Ga0068863_100028187 Ga0068863_1000281874 168
187 3300005841 Ga0068863_100072686 Ga0068863_1000726863 168
188 3300005842 Ga0068858_100121471 Ga0068858_1001214712 168
189 3300005844 Ga0068862_100560421 Ga0068862_1005604212 168
190 3300005937 Ga0081455_10004726 Ga0081455_100047264 168
191 3300005937 Ga0081455_10015332 Ga0081455_100153325 168
192 3300006042 Ga0075368_10130818 Ga0075368_101308182 168
193 3300006051 Ga0075364_10195880 Ga0075364_101958802 168
194 3300006175 Ga0070712_100401652 Ga0070712_1004016521 168
195 3300006177 Ga0075362_10100852 Ga0075362_101008522 168
196 3300006195 Ga0075366_10025120 Ga0075366_100251204 168
197 3300006195 Ga0075366_10076019 Ga0075366_100760192 168
198 3300006237 Ga0097621_100026161 Ga0097621_1000261615 168
199 3300006237 Ga0097621_100108423 Ga0097621_1001084235 168
200 3300006237 Ga0097621_100173694 Ga0097621_1001736943 168
201 3300006237 Ga0097621_100324292 Ga0097621_1003242922 168
202 3300006237 Ga0097621_100739948 Ga0097621_1007399481 168
203 3300006358 Ga0068871_100001246 Ga0068871_10000124612 168
204 3300006358 Ga0068871_100313372 Ga0068871_1003133722 168
205 3300006358 Ga0068871_100775055 Ga0068871_1007750551 168
206 3300006846 Ga0075430_100435485 Ga0075430_1004354851 168
207 3300006881 Ga0068865_100565311 Ga0068865_1005653111 168
208 3300006931 Ga0097620_100380580 Ga0097620_1003805802 168
209 3300007265 Ga0099794_10029829 Ga0099794_100298291 168
210 3300007788 Ga0099795_10089700 Ga0099795_100897002 168
211 3300009093 Ga0105240_10000811 Ga0105240_100008111 168
212 3300009093 Ga0105240_10024659 Ga0105240_100246598 168
213 3300009093 Ga0105240_10098517 Ga0105240_100985172 168
214 3300009093 Ga0105240_10119729 Ga0105240_101197292 168
215 3300009093 Ga0105240_10120223 Ga0105240_101202232 168
216 3300009093 Ga0105240_10331431 Ga0105240_103314312 168
217 3300009093 Ga0105240_10729961 Ga0105240_107299612 168
218 3300009093 Ga0105240_10752730 Ga0105240_107527302 168
219 3300009094 Ga0111539_10549739 Ga0111539_105497392 168
220 3300009101 Ga0105247_10616997 Ga0105247_106169971 168
221 3300009101 Ga0105247_10727352 Ga0105247_107273521 168
222 3300009174 Ga0105241_10058504 Ga0105241_100585044 168
223 3300009174 Ga0105241_10221743 Ga0105241_102217432 168
224 3300009176 Ga0105242_10031665 Ga0105242_100316653 168
225 3300009177 Ga0105248_10000001 Ga0105248_100000011360 168
226 3300009177 Ga0105248_10023048 Ga0105248_100230484 168
227 3300009177 Ga0105248_10197276 Ga0105248_101972761 168
228 3300009177 Ga0105248_10338310 Ga0105248_103383102 168
229 3300009177 Ga0105248_10528402 Ga0105248_105284022 168
230 3300009545 Ga0105237_10168332 Ga0105237_101683322 168
231 3300009545 Ga0105237_10202867 Ga0105237_102028672 168
232 3300009545 Ga0105237_10253338 Ga0105237_102533382 168
233 3300009545 Ga0105237_10286443 Ga0105237_102864432 168
234 3300009545 Ga0105237_10520761 Ga0105237_105207611 168
235 3300009551 Ga0105238_10017545 Ga0105238_100175452 168
236 3300009551 Ga0105238_10023226 Ga0105238_100232261 168
237 3300009551 Ga0105238_10023345 Ga0105238_100233454 168
238 3300009551 Ga0105238_10040277 Ga0105238_100402775 168
239 3300009551 Ga0105238_10126332 Ga0105238_101263323 168
240 3300009551 Ga0105238_10225310 Ga0105238_102253103 168
241 3300009551 Ga0105238_10268138 Ga0105238_102681383 168
242 3300009551 Ga0105238_10409055 Ga0105238_104090552 168
243 3300009979 Ga0105032_110166 Ga0105032_1101661 168
244 3300010159 Ga0099796_10090638 Ga0099796_100906381 168
245 3300010375 Ga0105239_10013755 Ga0105239_100137554 168
246 3300010375 Ga0105239_10050719 Ga0105239_100507192 168
247 3300010375 Ga0105239_10239180 Ga0105239_102391802 168
248 3300010375 Ga0105239_10249747 Ga0105239_102497472 168
249 3300010375 Ga0105239_10288313 Ga0105239_102883131 168
250 3300010375 Ga0105239_10295637 Ga0105239_102956372 168
251 3300010375 Ga0105239_10329723 Ga0105239_103297232 168
252 3300010375 Ga0105239_10695239 Ga0105239_106952392 168
253 3300011119 Ga0105246_10003863 Ga0105246_100038631 168
254 3300011119 Ga0105246_10008743 Ga0105246_100087437 168
255 3300011119 Ga0105246_10158827 Ga0105246_101588272 168
256 3300011119 Ga0105246_10307077 Ga0105246_103070772 168
257 3300013100 Ga0157373_10054979 Ga0157373_100549794 168
258 3300013100 Ga0157373_10179545 Ga0157373_101795452 168
259 3300013100 Ga0157373_10181968 Ga0157373_101819683 168
260 3300013100 Ga0157373_10189989 Ga0157373_101899893 168
261 3300013100 Ga0157373_10347984 Ga0157373_103479841 168
262 3300013104 Ga0157370_10015573 Ga0157370_100155734 168
263 3300013104 Ga0157370_10021189 Ga0157370_100211899 168
264 3300013104 Ga0157370_10030406 Ga0157370_100304064 168
265 3300013104 Ga0157370_10280674 Ga0157370_102806743 168
266 3300013104 Ga0157370_10295092 Ga0157370_102950922 168
267 3300013104 Ga0157370_10536870 Ga0157370_105368702 168
268 3300013105 Ga0157369_10012438 Ga0157369_100124383 168
269 3300013105 Ga0157369_10018818 Ga0157369_100188183 168
270 3300013105 Ga0157369_10179243 Ga0157369_101792433 168
271 3300013105 Ga0157369_10234935 Ga0157369_102349352 168
272 3300013105 Ga0157369_10367091 Ga0157369_103670911 168
273 3300013105 Ga0157369_10671519 Ga0157369_106715192 168
274 3300013296 Ga0157374_10164342 Ga0157374_101643422 168
275 3300013296 Ga0157374_10502181 Ga0157374_105021811 168
276 3300013296 Ga0157374_10761745 Ga0157374_107617452 168
277 3300013297 Ga0157378_10046417 Ga0157378_100464176 168
278 3300013297 Ga0157378_10172713 Ga0157378_101727132 168
279 3300013297 Ga0157378_10204427 Ga0157378_102044272 168
280 3300013297 Ga0157378_10572345 Ga0157378_105723451 168
281 3300013306 Ga0163162_10076766 Ga0163162_100767662 168
282 3300013306 Ga0163162_10104104 Ga0163162_101041043 168
283 3300013306 Ga0163162_10316708 Ga0163162_103167081 168
284 3300013306 Ga0163162_11201673 Ga0163162_112016731 168
285 3300013306 Ga0163162_11598777 Ga0163162_115987772 168
286 3300013306 Ga0163162_12064324 Ga0163162_120643242 168
287 3300013307 Ga0157372_10003810 Ga0157372_100038104 168
288 3300013307 Ga0157372_10009068 Ga0157372_100090682 168
289 3300013307 Ga0157372_10060167 Ga0157372_100601674 168
290 3300013307 Ga0157372_10453199 Ga0157372_104531992 168
291 3300013307 Ga0157372_10681606 Ga0157372_106816062 168
292 3300013307 Ga0157372_11105412 Ga0157372_111054121 168
293 3300013308 Ga0157375_10349546 Ga0157375_103495462 168
294 3300013308 Ga0157375_10530579 Ga0157375_105305792 168
295 3300014325 Ga0163163_10000004 Ga0163163_1000000413 168
296 3300014325 Ga0163163_10135841 Ga0163163_101358411 168
297 3300014326 Ga0157380_10636452 Ga0157380_106364522 168
298 3300014968 Ga0157379_10032277 Ga0157379_100322773 168
299 3300014968 Ga0157379_10480513 Ga0157379_104805132 168
300 3300014968 Ga0157379_10532001 Ga0157379_105320012 168
301 3300014969 Ga0157376_10196304 Ga0157376_101963042 168
302 3300014969 Ga0157376_10244420 Ga0157376_102444202 168
303 3300017792 Ga0163161_10626802 Ga0163161_106268021 168
304 3300020070 Ga0206356_10376855 Ga0206356_103768552 168
305 3300021361 Ga0213872_10013025 Ga0213872_100130253 168
306 3300021361 Ga0213872_10016435 Ga0213872_100164352 168
307 3300021384 Ga0213876_10000131 Ga0213876_1000013135 168
308 3300021384 Ga0213876_10000223 Ga0213876_1000022358 168
309 3300025231 Ga0207427_105282 Ga0207427_1052822 168
310 3300025261 Ga0209233_1000006 Ga0209233_1000006505 168
311 3300025261 Ga0209233_1003621 Ga0209233_10036213 168
312 3300025272 Ga0209455_1010456 Ga0209455_10104562 168
313 3300025297 Ga0209758_1000008 Ga0209758_1000008455 168
314 3300025297 Ga0209758_1003752 Ga0209758_10037524 168
315 3300025297 Ga0209758_1084595 Ga0209758_10845952 168
316 3300025298 Ga0209050_1000053 Ga0209050_1000053128 168
317 3300025304 Ga0209257_1000419 Ga0209257_100041920 168
318 3300025898 Ga0207692_10147698 Ga0207692_101476981 168
319 3300025900 Ga0207710_10080081 Ga0207710_100800813 168
320 3300025900 Ga0207710_10197057 Ga0207710_101970572 168
321 3300025903 Ga0207680_10032102 Ga0207680_100321022 168
322 3300025903 Ga0207680_10082795 Ga0207680_100827952 168
323 3300025904 Ga0207647_10105871 Ga0207647_101058712 168
324 3300025908 Ga0207643_10173027 Ga0207643_101730272 168
325 3300025909 Ga0207705_10000039 Ga0207705_10000039177 168
326 3300025909 Ga0207705_10009613 Ga0207705_100096132 168
327 3300025909 Ga0207705_10312637 Ga0207705_103126372 168
328 3300025911 Ga0207654_10045253 Ga0207654_100452532 168
329 3300025911 Ga0207654_10325848 Ga0207654_103258482 168
330 3300025911 Ga0207654_10610420 Ga0207654_106104201 168
331 3300025911 Ga0207654_10807849 Ga0207654_108078491 168
332 3300025912 Ga0207707_10000002 Ga0207707_10000002449 168
333 3300025912 Ga0207707_10001894 Ga0207707_1000189419 168
334 3300025912 Ga0207707_10060914 Ga0207707_100609142 168
335 3300025912 Ga0207707_10103499 Ga0207707_101034992 168
336 3300025912 Ga0207707_10134172 Ga0207707_101341722 168
337 3300025912 Ga0207707_11082288 Ga0207707_110822881 168
338 3300025913 Ga0207695_10000012 Ga0207695_10000012569 168
339 3300025913 Ga0207695_10044089 Ga0207695_100440891 168
340 3300025913 Ga0207695_10048638 Ga0207695_100486384 168
341 3300025913 Ga0207695_10079077 Ga0207695_100790774 168
342 3300025913 Ga0207695_10088395 Ga0207695_100883952 168
343 3300025913 Ga0207695_10096933 Ga0207695_100969332 168
344 3300025913 Ga0207695_10166309 Ga0207695_101663092 168
345 3300025913 Ga0207695_10355867 Ga0207695_103558672 168
346 3300025913 Ga0207695_10611593 Ga0207695_106115931 168
347 3300025913 Ga0207695_10615498 Ga0207695_106154982 168
348 3300025913 Ga0207695_10665892 Ga0207695_106658922 168
349 3300025914 Ga0207671_10132903 Ga0207671_101329032 168
350 3300025914 Ga0207671_10155108 Ga0207671_101551082 168
351 3300025914 Ga0207671_10363464 Ga0207671_103634642 168
352 3300025914 Ga0207671_10446785 Ga0207671_104467852 168
353 3300025917 Ga0207660_10000299 Ga0207660_100002997 168
354 3300025917 Ga0207660_10003148 Ga0207660_1000314810 168
355 3300025919 Ga0207657_10000182 Ga0207657_1000018241 168
356 3300025919 Ga0207657_10011088 Ga0207657_1001108810 168
357 3300025919 Ga0207657_10205154 Ga0207657_102051541 168
358 3300025919 Ga0207657_10693657 Ga0207657_106936571 168
359 3300025920 Ga0207649_10000202 Ga0207649_1000020210 168
360 3300025920 Ga0207649_10021139 Ga0207649_100211394 168
361 3300025920 Ga0207649_10294347 Ga0207649_102943472 168
362 3300025921 Ga0207652_10003023 Ga0207652_1000302315 168
363 3300025921 Ga0207652_10009127 Ga0207652_100091276 168
364 3300025921 Ga0207652_10062359 Ga0207652_100623592 168
365 3300025924 Ga0207694_10000006 Ga0207694_1000000696 168
366 3300025924 Ga0207694_10140414 Ga0207694_101404142 168
367 3300025924 Ga0207694_10183137 Ga0207694_101831372 168
368 3300025924 Ga0207694_10373893 Ga0207694_103738932 168
369 3300025927 Ga0207687_10249059 Ga0207687_102490592 168
370 3300025928 Ga0207700_10274633 Ga0207700_102746332 168
371 3300025928 Ga0207700_10339414 Ga0207700_103394141 168
372 3300025928 Ga0207700_10442737 Ga0207700_104427371 168
373 3300025928 Ga0207700_10786996 Ga0207700_107869962 168
374 3300025929 Ga0207664_10796365 Ga0207664_107963652 168
375 3300025931 Ga0207644_10123603 Ga0207644_101236032 168
376 3300025932 Ga0207690_10041072 Ga0207690_100410722 168
377 3300025932 Ga0207690_10184616 Ga0207690_101846161 168
378 3300025933 Ga0207706_10142314 Ga0207706_101423142 168
379 3300025934 Ga0207686_10059565 Ga0207686_100595652 168
380 3300025936 Ga0207670_10776784 Ga0207670_107767841 168
381 3300025936 Ga0207670_11195642 Ga0207670_111956422 168
382 3300025937 Ga0207669_10203483 Ga0207669_102034832 168
383 3300025937 Ga0207669_10407195 Ga0207669_104071952 168
384 3300025937 Ga0207669_10415730 Ga0207669_104157301 168
385 3300025938 Ga0207704_10567784 Ga0207704_105677842 168
386 3300025940 Ga0207691_10171370 Ga0207691_101713701 168
387 3300025941 Ga0207711_10000001 Ga0207711_10000001512 168
388 3300025941 Ga0207711_10002944 Ga0207711_100029443 168
389 3300025942 Ga0207689_10400083 Ga0207689_104000832 168
390 3300025944 Ga0207661_10588777 Ga0207661_105887772 168
391 3300025945 Ga0207679_10012712 Ga0207679_100127122 168
392 3300025949 Ga0207667_10000106 Ga0207667_1000010691 168
393 3300025949 Ga0207667_10043252 Ga0207667_100432525 168
394 3300025949 Ga0207667_10070622 Ga0207667_100706222 168
395 3300025949 Ga0207667_10091694 Ga0207667_100916944 168
396 3300025949 Ga0207667_10128147 Ga0207667_101281472 168
397 3300025949 Ga0207667_10173042 Ga0207667_101730422 168
398 3300025949 Ga0207667_10215868 Ga0207667_102158682 168
399 3300025949 Ga0207667_10221570 Ga0207667_102215702 168
400 3300025949 Ga0207667_10338456 Ga0207667_103384562 168
401 3300025949 Ga0207667_10921077 Ga0207667_109210771 168
402 3300025960 Ga0207651_10324631 Ga0207651_103246312 168
403 3300025960 Ga0207651_10790529 Ga0207651_107905291 168
404 3300025961 Ga0207712_10173194 Ga0207712_101731942 168
405 3300025972 Ga0207668_10249845 Ga0207668_102498451 168
406 3300025981 Ga0207640_10110715 Ga0207640_101107151 168
407 3300025981 Ga0207640_10206006 Ga0207640_102060062 168
408 3300025981 Ga0207640_10712703 Ga0207640_107127032 168
409 3300025986 Ga0207658_10207346 Ga0207658_102073462 168
410 3300026023 Ga0207677_10022754 Ga0207677_100227542 168
411 3300026035 Ga0207703_10039615 Ga0207703_100396153 168
412 3300026041 Ga0207639_10007079 Ga0207639_100070796 168
413 3300026041 Ga0207639_10022836 Ga0207639_100228365 168
414 3300026041 Ga0207639_10051462 Ga0207639_100514623 168
415 3300026041 Ga0207639_10456328 Ga0207639_104563282 168
416 3300026041 Ga0207639_10458611 Ga0207639_104586112 168
417 3300026078 Ga0207702_10045794 Ga0207702_100457945 168
418 3300026078 Ga0207702_10128865 Ga0207702_101288653 168
419 3300026078 Ga0207702_10183578 Ga0207702_101835783 168
420 3300026078 Ga0207702_10244340 Ga0207702_102443402 168
421 3300026078 Ga0207702_11154633 Ga0207702_111546332 168
422 3300026088 Ga0207641_10018113 Ga0207641_100181135 168
423 3300026088 Ga0207641_10051374 Ga0207641_100513743 168
424 3300026089 Ga0207648_10288660 Ga0207648_102886602 168
425 3300026089 Ga0207648_10444665 Ga0207648_104446652 168
426 3300026116 Ga0207674_10074152 Ga0207674_100741524 168
427 3300026116 Ga0207674_10412185 Ga0207674_104121852 168
428 3300026118 Ga0207675_100332284 Ga0207675_1003322842 168
429 3300026118 Ga0207675_100829136 Ga0207675_1008291362 168
430 3300026121 Ga0207683_10146834 Ga0207683_101468343 168
431 3300026121 Ga0207683_10192413 Ga0207683_101924132 168
432 3300026121 Ga0207683_10398651 Ga0207683_103986512 168
433 3300026142 Ga0207698_10011195 Ga0207698_100111952 168
434 3300026142 Ga0207698_10138264 Ga0207698_101382642 168
435 3300026142 Ga0207698_10142313 Ga0207698_101423133 168
436 3300027866 Ga0209813_10021479 Ga0209813_100214792 168
437 3300028379 Ga0268266_10009800 Ga0268266_100098008 168
438 3300028379 Ga0268266_10049299 Ga0268266_100492994 168
439 3300028379 Ga0268266_10095391 Ga0268266_100953912 168
440 3300028379 Ga0268266_10247947 Ga0268266_102479472 168
441 3300028379 Ga0268266_10715328 Ga0268266_107153282 168
442 3300028380 Ga0268265_10245102 Ga0268265_102451022 168
443 3300028380 Ga0268265_10456052 Ga0268265_104560522 168
444 3300028573 Ga0265334_10040829 Ga0265334_100408293 168
445 3300028577 Ga0265318_10000125 Ga0265318_1000012556 168
446 3300028653 Ga0265323_10151707 Ga0265323_101517072 168
447 3300028800 Ga0265338_10000011 Ga0265338_10000011461 168
448 3300028800 Ga0265338_10011053 Ga0265338_1001105310 168
449 3300031235 Ga0265330_10009650 Ga0265330_100096502 168
450 3300031235 Ga0265330_10266738 Ga0265330_102667381 168
451 3300031238 Ga0265332_10012624 Ga0265332_100126243 168
452 3300031238 Ga0265332_10015641 Ga0265332_100156414 168
453 3300031238 Ga0265332_10045584 Ga0265332_100455842 168
454 3300031239 Ga0265328_10192501 Ga0265328_101925011 168
455 3300031241 Ga0265325_10000002 Ga0265325_10000002129 168
456 3300031241 Ga0265325_10117778 Ga0265325_101177781 168
457 3300031242 Ga0265329_10022488 Ga0265329_100224882 168
458 3300031247 Ga0265340_10004297 Ga0265340_100042977 168
459 3300031247 Ga0265340_10034266 Ga0265340_100342661 168
460 3300031249 Ga0265339_10000210 Ga0265339_1000021018 168
461 3300031249 Ga0265339_10148637 Ga0265339_101486372 168
462 3300031250 Ga0265331_10000008 Ga0265331_1000000869 168
463 3300031250 Ga0265331_10007067 Ga0265331_100070677 168
464 3300031250 Ga0265331_10027552 Ga0265331_100275522 168
465 3300031251 Ga0265327_10000007 Ga0265327_10000007581 168
466 3300031251 Ga0265327_10000378 Ga0265327_1000037850 168
467 3300031251 Ga0265327_10000448 Ga0265327_1000044817 168
468 3300031344 Ga0265316_10000166 Ga0265316_1000016650 168
469 3300031344 Ga0265316_10029385 Ga0265316_100293852 168
470 3300031344 Ga0265316_10365180 Ga0265316_103651802 168
471 3300031456 Ga0307513_10382286 Ga0307513_103822862 168
472 3300031595 Ga0265313_10003445 Ga0265313_1000344514 168
473 3300031595 Ga0265313_10029414 Ga0265313_100294142 168
474 3300031595 Ga0265313_10037366 Ga0265313_100373662 168
475 3300031595 Ga0265313_10226760 Ga0265313_102267601 168
476 3300031691 Ga0316579_10006719 Ga0316579_100067194 168
477 3300031711 Ga0265314_10010428 Ga0265314_100104284 168
478 3300031711 Ga0265314_10017005 Ga0265314_100170053 168
479 3300031711 Ga0265314_10045723 Ga0265314_100457234 168
480 3300031711 Ga0265314_10060570 Ga0265314_100605702 168
481 3300031711 Ga0265314_10083518 Ga0265314_100835184 168
482 3300031711 Ga0265314_10426199 Ga0265314_104261991 168
483 3300031712 Ga0265342_10004548 Ga0265342_100045488 168
484 3300031712 Ga0265342_10021542 Ga0265342_100215423 168
485 3300031712 Ga0265342_10042949 Ga0265342_100429492 168
486 3300031712 Ga0265342_10079237 Ga0265342_100792372 168
487 3300031727 Ga0316576_10137592 Ga0316576_101375922 168
488 3300031730 Ga0307516_10032110 Ga0307516_100321104 168
489 3300031730 Ga0307516_10053974 Ga0307516_100539743 168
490 3300031733 Ga0316577_10007601 Ga0316577_100076014 168
491 3300032005 Ga0307411_10401480 Ga0307411_104014802 168
492 3300032133 Ga0316583_10008084 Ga0316583_100080843 168
493 3300032137 Ga0316585_10097959 Ga0316585_100979591 168
494 3300032168 Ga0316593_10137636 Ga0316593_101376362 168
495 3300035111 Ga0373923_0091651 Ga0373923_0091651_624_1154 168
496 3300035207 Ga0373942_0082712 Ga0373942_0082712_41_571 168
497 3300035398 Ga0316574_0069703 Ga0316574_0069703_1546_2097 168
498 3300035691 Ga0373931_0017524 Ga0373931_0017524_1215_1745 168
499 3300035691 Ga0373931_0208770 Ga0373931_0208770_367_969 168
500 3300035692 Ga0373935_0758070 Ga0373935_0758070_18_599 168
501 3300035692 Ga0373935_0760682 Ga0373935_0760682_98_628 168
502 3300035695 Ga0373927_0073947 Ga0373927_0073947_1053_1583 168
503 3300035695 Ga0373927_0345719 Ga0373927_0345719_120_650 168
504 3300035724 Ga0373933_0022090 Ga0373933_0022090_746_1276 168
505 3300036401 Ga0373937_0022231 Ga0373937_0022231_4216_4746 168
506 3300036401 Ga0373937_0235702 Ga0373937_0235702_969_1526 168
507 3300036401 Ga0373937_0455629 Ga0373937_0455629_186_722 168
508 3300036647 Ga0316582_0007371 Ga0316582_0007371_277_813 168
509 3300036647 Ga0316582_0018675 Ga0316582_0018675_1908_2429 168
510 3300036712 Ga0316584_0152083 Ga0316584_0152083_161_697 168
511 3300036712 Ga0316584_0203146 Ga0316584_0203146_175_696 168
512 3300036712 Ga0316584_0398402 Ga0316584_0398402_171_722 168
513 3300037068 Ga0373925_0507374 Ga0373925_0507374_354_890 168
514 3300037312 Ga0395899_0000003 Ga0395899_0000003_184483_185013 168
515 3300037312 Ga0395899_0028713 Ga0395899_0028713_791_1321 168
516 3300037312 Ga0395899_0111167 Ga0395899_0111167_1309_1869 168
517 3300037312 Ga0395899_0113465 Ga0395899_0113465_1039_1569 168
518 3300037312 Ga0395899_0170756 Ga0395899_0170756_547_1080 168
519 3300037418 Ga0395900_0023024 Ga0395900_0023024_4788_5318 168
520 3300037418 Ga0395900_0106335 Ga0395900_0106335_1176_1736 168
521 3300037418 Ga0395900_0126165 Ga0395900_0126165_828_1358 168
522 3300037418 Ga0395900_0914888 Ga0395900_0914888_222_752 168
523 3300037466 Ga0395898_0027033 Ga0395898_0027033_2915_3475 168
524 3300037466 Ga0395898_0127038 Ga0395898_0127038_851_1381 168
525 3300038443 Ga0395901_0025294 Ga0395901_0025294_929_1459 168
526 3300038443 Ga0395901_0026613 Ga0395901_0026613_2899_3432 168
527 3300038443 Ga0395901_0035463 Ga0395901_0035463_4009_4539 168
528 3300038443 Ga0395901_0104585 Ga0395901_0104585_1063_1623 168
529 3300039437 Ga0436365_0412683 Ga0436365_0412683_44047_44574 168
530 3300039437 Ga0436365_0583194 Ga0436365_0583194_78169_78741 168
531 3300039437 Ga0436365_0622716 Ga0436365_0622716_12_545 168
532 3300039438 Ga0436360_0032462 Ga0436360_0032462_185_718 168
533 3300039438 Ga0436360_0052066 Ga0436360_0052066_2722_3258 168
534 3300039438 Ga0436360_0299898 Ga0436360_0299898_173_730 168
535 3300039447 Ga0436361_0331544 Ga0436361_0331544_1009_1539 168
536 3300039447 Ga0436361_1016532 Ga0436361_1016532_3287_3811 168
537 3300041413 Ga0439465_0271522 Ga0439465_0271522_72_602 168
538 3300044656 Ga0466969_0059802 Ga0466969_0059802_196_726 168
539 3300044658 Ga0466972_0182774 Ga0466972_0182774_136_693 168
540 3300044683 Ga0466965_0355330 Ga0466965_0355330_130_660 168
541 3300044694 Ga0466963_0022801 Ga0466963_0022801_3245_3778 168
542 3300044712 Ga0453684_0013252 Ga0453684_0013252_6587_7105 168
543 3300044842 Ga0466957_0137190 Ga0466957_0137190_900_1433 168
544 3300045976 Ga0466967_0045841 Ga0466967_0045841_2662_3222 168
545 3300045976 Ga0466967_0199478 Ga0466967_0199478_739_1272 168
546 3300046454 Ga0495592_0077637 Ga0495592_0077637_428_964 168
547 3300046471 Ga0495650_0180970 Ga0495650_0180970_159_716 168
548 3300046477 Ga0495664_0068218 Ga0495664_0068218_711_1292 168
549 3300046477 Ga0495664_0078945 Ga0495664_0078945_747_1283 168
550 3300046506 Ga0495583_0144926 Ga0495583_0144926_115_669 168
551 3300046507 Ga0495606_0152282 Ga0495606_0152282_285_857 168
552 3300046516 Ga0495628_0240644 Ga0495628_0240644_651_1187 168
553 3300046529 Ga0495652_0130500 Ga0495652_0130500_1156_1737 168
554 3300046530 Ga0495654_0177094 Ga0495654_0177094_356_913 168
555 3300046536 Ga0495587_0089424 Ga0495587_0089424_741_1322 168
556 3300046536 Ga0495587_0120377 Ga0495587_0120377_659_1195 168
557 3300046543 Ga0495645_0025828 Ga0495645_0025828_1168_1704 168
558 3300046557 Ga0495622_0027198 Ga0495622_0027198_1257_1814 168
559 3300046616 Ga0495668_0027699 Ga0495668_0027699_2509_3036 168
560 3300046660 Ga0495625_0128771 Ga0495625_0128771_452_1009 168
561 3300046665 Ga0495661_0128297 Ga0495661_0128297_129_683 168
562 3300046683 Ga0495658_0304952 Ga0495658_0304952_102_632 168
563 3300046692 Ga0495671_0247488 Ga0495671_0247488_119_670 168
564 3300046694 Ga0495649_0096524 Ga0495649_0096524_896_1453 168
565 3300046794 Ga0495589_0060561 Ga0495589_0060561_772_1329 168
566 3300047320 Ga0495672_0302653 Ga0495672_0302653_117_674 168
567 3300047445 Ga0495677_0261284 Ga0495677_0261284_70_651 168
568 3300047470 Ga0495681_0190725 Ga0495681_0190725_177_731 168
569 3300048903 Ga0496100_1033004 Ga0496100_1033004_18_599 168
570 3300048916 Ga0496113_0707092 Ga0496113_0707092_134_664 168
571 3300048918 Ga0496115_0922846 Ga0496115_0922846_72_602 168
572 3300048924 Ga0496121_0001329 Ga0496121_0001329_2625_3176 168
573 3300048928 Ga0496125_0014570 Ga0496125_0014570_2897_3424 168
574 3300048929 Ga0496126_0023833 Ga0496126_0023833_1277_1807 168
575 3300048929 Ga0496126_0224789 Ga0496126_0224789_897_1454 168
576 3300049460 Ga0495682_0007197 Ga0495682_0007197_500_1081 168
577 3300049568 Ga0501031_0190379 Ga0501031_0190379_310_816 168
578 3300049569 Ga0501032_0134742 Ga0501032_0134742_393_932 168
579 3300049569 Ga0501032_0373633 Ga0501032_0373633_58_618 168
580 3300049569 Ga0501032_0575055 Ga0501032_0575055_167_697 168
581 3300049570 Ga0501033_0007822 Ga0501033_0007822_6870_7430 168
582 3300049570 Ga0501033_0026925 Ga0501033_0026925_2641_3180 168
583 3300049570 Ga0501033_0203755 Ga0501033_0203755_169_714 168
584 3300049570 Ga0501033_0537907 Ga0501033_0537907_173_703 168
585 3300049570 Ga0501033_0844885 Ga0501033_0844885_26_550 168
586 3300049571 Ga0501034_0012128 Ga0501034_0012128_2088_2627 168
587 3300049571 Ga0501034_0022018 Ga0501034_0022018_1265_1804 168
588 3300049571 Ga0501034_0148872 Ga0501034_0148872_591_1154 168
589 3300049571 Ga0501034_0179678 Ga0501034_0179678_516_1073 168
590 3300049571 Ga0501034_0273951 Ga0501034_0273951_545_1078 168
591 3300049571 Ga0501034_0587790 Ga0501034_0587790_405_950 168
592 3300049571 Ga0501034_0848918 Ga0501034_0848918_18_575 168
593 3300049572 Ga0501036_0032242 Ga0501036_0032242_2168_2707 168
594 3300049572 Ga0501036_0062239 Ga0501036_0062239_417_941 168
595 3300049572 Ga0501036_0127765 Ga0501036_0127765_1189_1746 168
596 3300049573 Ga0501037_0004982 Ga0501037_0004982_280_804 168
597 3300049573 Ga0501037_0042046 Ga0501037_0042046_1335_1895 168
598 3300049573 Ga0501037_0163451 Ga0501037_0163451_82_639 168
599 3300049573 Ga0501037_0195455 Ga0501037_0195455_841_1386 168
600 3300049573 Ga0501037_0267913 Ga0501037_0267913_379_918 168
601 3300049573 Ga0501037_0374380 Ga0501037_0374380_325_855 168
602 3300049574 Ga0501038_0016935 Ga0501038_0016935_370_915 168
603 3300049574 Ga0501038_0084195 Ga0501038_0084195_1396_1956 168
604 3300049574 Ga0501038_0095289 Ga0501038_0095289_1630_2169 168
605 3300049575 Ga0501039_0145112 Ga0501039_0145112_1191_1730 168
606 3300049575 Ga0501039_0159743 Ga0501039_0159743_146_670 168
607 3300049577 Ga0501041_0441680 Ga0501041_0441680_102_608 168
608 3300049578 Ga0501042_0190091 Ga0501042_0190091_884_1441 168
609 3300049579 Ga0501043_0006812 Ga0501043_0006812_7848_8372 168
610 3300049579 Ga0501043_0053675 Ga0501043_0053675_104_664 168
611 3300049579 Ga0501043_0106668 Ga0501043_0106668_779_1324 168
612 3300049579 Ga0501043_0186019 Ga0501043_0186019_976_1524 168
613 3300049580 Ga0501046_0041043 Ga0501046_0041043_119_643 168
614 3300049580 Ga0501046_0052245 Ga0501046_0052245_1438_1977 168
615 3300049580 Ga0501046_0079038 Ga0501046_0079038_1208_1744 168
616 3300049580 Ga0501046_0192059 Ga0501046_0192059_437_967 168
617 3300049581 Ga0501047_0003552 Ga0501047_0003552_986_1534 168
618 3300049581 Ga0501047_0004810 Ga0501047_0004810_3018_3581 168
619 3300049581 Ga0501047_0017577 Ga0501047_0017577_3051_3611 168
620 3300049581 Ga0501047_0023081 Ga0501047_0023081_4536_5072 168
621 3300049581 Ga0501047_0101831 Ga0501047_0101831_697_1254 168
622 3300049581 Ga0501047_0188144 Ga0501047_0188144_844_1383 168
623 3300049581 Ga0501047_0207020 Ga0501047_0207020_460_1005 168
624 3300049581 Ga0501047_0208303 Ga0501047_0208303_291_821 168
625 3300049581 Ga0501047_0370312 Ga0501047_0370312_547_1071 168
626 3300049581 Ga0501047_0403510 Ga0501047_0403510_130_714 168
627 3300049581 Ga0501047_0423375 Ga0501047_0423375_441_965 168
628 3300049581 Ga0501047_0423578 Ga0501047_0423578_414_953 168
629 3300049581 Ga0501047_0729706 Ga0501047_0729706_37_582 168
630 3300049582 Ga0501048_0047002 Ga0501048_0047002_1398_1955 168
631 3300049582 Ga0501048_0588449 Ga0501048_0588449_222_728 168
632 3300049583 Ga0501067_0008586 Ga0501067_0008586_2854_3417 168
633 3300049583 Ga0501067_0032197 Ga0501067_0032197_1552_2109 168
634 3300049583 Ga0501067_0160031 Ga0501067_0160031_16_555 168
635 3300049584 Ga0501068_0027961 Ga0501068_0027961_1478_2017 168
636 3300049584 Ga0501068_0046942 Ga0501068_0046942_1046_1585 168
637 3300049584 Ga0501068_0190510 Ga0501068_0190510_294_818 168
638 3300049585 Ga0501069_0004797 Ga0501069_0004797_1202_1759 168
639 3300049585 Ga0501069_0030658 Ga0501069_0030658_1400_1945 168
640 3300049585 Ga0501069_0366144 Ga0501069_0366144_23_547 168
641 3300049586 Ga0501070_0000017 Ga0501070_0000017_96747_97292 168
642 3300049586 Ga0501070_0018465 Ga0501070_0018465_2823_3443 168
643 3300049586 Ga0501070_0023545 Ga0501070_0023545_2428_2967 168
644 3300049586 Ga0501070_0023934 Ga0501070_0023934_3499_4056 168
645 3300049586 Ga0501070_0490151 Ga0501070_0490151_235_798 168
646 3300049587 Ga0501071_0133031 Ga0501071_0133031_96_602 168
647 3300049587 Ga0501071_0707638 Ga0501071_0707638_229_735 168
648 3300049588 Ga0501072_0007532 Ga0501072_0007532_4056_4619 168
649 3300049588 Ga0501072_0054427 Ga0501072_0054427_1419_1976 168
650 3300049588 Ga0501072_0489676 Ga0501072_0489676_359_883 168
651 3300049589 Ga0501073_0000774 Ga0501073_0000774_4135_4659 168
652 3300049589 Ga0501073_0004084 Ga0501073_0004084_852_1415 168
653 3300049589 Ga0501073_0014201 Ga0501073_0014201_2497_3054 168
654 3300049589 Ga0501073_0023292 Ga0501073_0023292_1990_2550 168
655 3300049589 Ga0501073_0025337 Ga0501073_0025337_1591_2148 168
656 3300049589 Ga0501073_0030670 Ga0501073_0030670_1093_1632 168
657 3300049589 Ga0501073_0181336 Ga0501073_0181336_470_1033 168
658 3300049590 Ga0501074_0002018 Ga0501074_0002018_9786_10343 168
659 3300049590 Ga0501074_0059868 Ga0501074_0059868_1506_2063 168
660 3300049590 Ga0501074_0248877 Ga0501074_0248877_378_941 168
661 3300049741 Ga0501079_0020834 Ga0501079_0020834_3426_3983 168
662 3300049741 Ga0501079_0089875 Ga0501079_0089875_1172_1735 168
663 3300049742 Ga0501080_0000333 Ga0501080_0000333_33335_33859 168
664 3300049742 Ga0501080_0006334 Ga0501080_0006334_4230_4775 168
665 3300049742 Ga0501080_0044966 Ga0501080_0044966_2717_3274 168
666 3300049742 Ga0501080_0056991 Ga0501080_0056991_1498_2055 168
667 3300049742 Ga0501080_0199115 Ga0501080_0199115_1251_1790 168
668 3300049742 Ga0501080_0214786 Ga0501080_0214786_1116_1676 168
669 3300049742 Ga0501080_0356266 Ga0501080_0356266_573_1136 168
670 3300049742 Ga0501080_0790186 Ga0501080_0790186_155_685 168
671 3300049744 Ga0501083_0072607 Ga0501083_0072607_1153_1710 168
672 3300049744 Ga0501083_0200990 Ga0501083_0200990_115_678 168
673 3300049744 Ga0501083_0333490 Ga0501083_0333490_322_861 168
674 3300049744 Ga0501083_0916891 Ga0501083_0916891_13_552 168
675 3300049822 Ga0501035_0001049 Ga0501035_0001049_26106_26651 168
676 3300049822 Ga0501035_0012693 Ga0501035_0012693_1196_1753 168
677 3300049822 Ga0501035_0019089 Ga0501035_0019089_3522_4046 168
678 3300049822 Ga0501035_0049373 Ga0501035_0049373_2945_3505 168
679 3300049822 Ga0501035_0056615 Ga0501035_0056615_2936_3475 168
680 3300049822 Ga0501035_0146683 Ga0501035_0146683_674_1210 168
681 3300049822 Ga0501035_0191585 Ga0501035_0191585_625_1176 168
682 3300049822 Ga0501035_0504396 Ga0501035_0504396_24_569 168
683 3300049823 Ga0501044_0001245 Ga0501044_0001245_2744_3289 168
684 3300049823 Ga0501044_0001370 Ga0501044_0001370_27442_27966 168
685 3300049823 Ga0501044_0052068 Ga0501044_0052068_2362_2901 168
686 3300049823 Ga0501044_0097356 Ga0501044_0097356_1654_2211 168
687 3300049823 Ga0501044_0110732 Ga0501044_0110732_1117_1665 168
688 3300049823 Ga0501044_0111932 Ga0501044_0111932_555_1094 168
689 3300049823 Ga0501044_0128268 Ga0501044_0128268_863_1423 168
690 3300049823 Ga0501044_0292011 Ga0501044_0292011_528_1073 168
691 3300049823 Ga0501044_0414556 Ga0501044_0414556_222_740 168
692 3300049823 Ga0501044_1057020 Ga0501044_1057020_129_665 168
693 3300050489 nmdc:mga03683_1310_c2 nmdc:mga03683_1310_c2_856_1389 168
694 3300050489 nmdc:mga03683_138765_c1 nmdc:mga03683_138765_c1_174_707 168
695 3300050492 nmdc:mga0yw44_605724_c1 nmdc:mga0yw44_605724_c1_27_554 168
696 3300050493 nmdc:mga0k408_35812_c1 nmdc:mga0k408_35812_c1_1130_1663 168
697 3300053087 Ga0500643_000017 Ga0500643_000017_103582_104139 168
698 3300053088 Ga0500644_0026343 Ga0500644_0026343_320_850 168
699 3300053090 Ga0500646_0027744 Ga0500646_0027744_569_1126 168
700 3300053094 Ga0500566_0244845 Ga0500566_0244845_52_582 168
701 3300053108 Ga0500562_000194 Ga0500562_000194_2719_3246 168
702 3300053116 Ga0500592_018049 Ga0500592_018049_289_846 168
703 3300053119 Ga0500595_026534 Ga0500595_026534_1223_1774 168
704 3300053130 Ga0500642_0030073 Ga0500642_0030073_830_1387 168
705 3300053139 Ga0500568_0029387 Ga0500568_0029387_1507_2064 168
706 3300053140 Ga0500573_0000055 Ga0500573_0000055_8942_9526 168
707 3300053142 Ga0500577_0097599 Ga0500577_0097599_571_1128 168
708 3300053163 Ga0500639_103245 Ga0500639_103245_368_895 168
709 3300053730 Ga0500645_019975 Ga0500645_019975_706_1263 168
710 3300054114 Ga0501084_0000288 Ga0501084_0000288_11344_11907 168
711 3300054114 Ga0501084_0007244 Ga0501084_0007244_4687_5244 168
712 3300054114 Ga0501084_0026675 Ga0501084_0026675_3488_4045 168
713 3300054114 Ga0501084_0121710 Ga0501084_0121710_334_891 168
714 3300054114 Ga0501084_0403800 Ga0501084_0403800_173_697 168
715 3300060353 Ga0501082_0020561 Ga0501082_0020561_3035_3592 168
716 3300060353 Ga0501082_0042317 Ga0501082_0042317_1545_2102 168
717 3300060353 Ga0501082_0149628 Ga0501082_0149628_590_1114 168
718 3300060353 Ga0501082_0560580 Ga0501082_0560580_185_724 168
719 3300060353 Ga0501082_0649192 Ga0501082_0649192_118_675 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

56

186

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b0i-assembly2.cif.gz_A crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) mutant (h70n) from pseudomonas aeruginosa in complex with 3-hydroxydecanoyl-n-acetyl cysteamine 0.9748 4 168
8b72-assembly2.cif.gz_D crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with z30857828 0.9731 4 168
7bka-assembly1.cif.gz_A-2 crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with ddd01870824 0.9727 4 168
7bhj-assembly2.cif.gz_B crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with ddd00084774 0.972 4 167
4b0j-assembly1.cif.gz_S crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with 5-(2- thienyl)-3-isoxazolyl methanol 0.9719 4 168
ID Description Score Start End Superfamily
3q62A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9578 1 166 3.10.129.10
3q62A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9301 1 166 3.10.129.10
1zhgA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8571 29 166 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8514 7 164 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8461 8 167 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7H4LVZ6-F1-model_v4 3-hydroxydecanoyl-(Acyl carrier protein) dehydratase (EC 4.2.1.59) 1 88 158 GO:0006633
GO:0019171
GO:0034017
AF-A0A378F7C7-F1-model_v4 3-hydroxydecanoyl-(Acyl carrier protein) dehydratase (EC 4.2.1.59) 1 113 168 GO:0006633
GO:0019171
GO:0034017
AF-A0A832ALW7-F1-model_v4 Beta-hydroxydecanoyl-ACP dehydratase 0.9992 93 167 GO:0006633
AF-A0A7G2LRR4-F1-model_v4 Beta-hydroxydecanoyl-ACP dehydratase 0.9974 87 168 GO:0006633
GO:0019171
GO:0034017
AF-A0A2J5Q3Z5-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA (EC 4.2.1.59) 0.9974 116 168 GO:0006633
GO:0019171
GO:0034017

Feature Viewer

pLDDT pTM Quality
88.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map