F477112
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 717 | 305 | 1434 | 78 |
Family's Representative Sequence
| Representative Sequence | 3300026121|Ga0207683_10989719|Ga0207683_109897191 |
| Length | 86 |
| Sequence | VVKDISWTMPVVEITQTVDARGLSCPMPIVKTAQAAKGLPSGAVIELLATDAGSIKDVAAWCRSTGNELIDQTSDGAVYHFVIRRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 138 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 147 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 171 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 172 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 189 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 192 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 194 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 197 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 198 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 199 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 200 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 201 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 202 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 205 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 206 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 207 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 210 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.96 |
| Metatranscriptomes | 4.04 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 6.97 |
| Rhizosphere | 92.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 32.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207683_10989719 | 3300026121 | Bacteria | 781 |
| 2 | JGI24747J21853_1025621 | 3300001978 | Bacteria | 658 |
| 3 | JGI24751J29686_10000350 | 3300002459 | Bacteria | 16255 |
| 4 | Ga0065715_10192854 | 3300005293 | Unclassified | 1405 |
| 5 | Ga0065707_10814445 | 3300005295 | Unclassified | 594 |
| 6 | Ga0070683_100469364 | 3300005329 | Unclassified | 1201 |
| 7 | Ga0070683_101667168 | 3300005329 | Unclassified | 613 |
| 8 | Ga0070690_100186865 | 3300005330 | Unclassified | 1434 |
| 9 | Ga0070670_100003123 | 3300005331 | Bacteria | 13711 |
| 10 | Ga0070670_101524270 | 3300005331 | Unclassified | 614 |
| 11 | Ga0070670_101876495 | 3300005331 | Unclassified | 552 |
| 12 | Ga0068869_100375491 | 3300005334 | Bacteria | 1164 |
| 13 | Ga0068869_100552825 | 3300005334 | Bacteria | 967 |
| 14 | Ga0070666_10181643 | 3300005335 | Archaea | 1476 |
| 15 | Ga0070666_10197160 | 3300005335 | Bacteria | 1416 |
| 16 | Ga0070682_100647678 | 3300005337 | Unclassified | 841 |
| 17 | Ga0068868_100421540 | 3300005338 | Archaea | 1156 |
| 18 | Ga0070692_10134084 | 3300005345 | Unclassified | 1395 |
| 19 | Ga0070692_10191381 | 3300005345 | Bacteria | 1192 |
| 20 | Ga0070674_100040870 | 3300005356 | Bacteria | 3139 |
| 21 | Ga0070674_100102902 | 3300005356 | Bacteria | 2084 |
| 22 | Ga0070674_100110206 | 3300005356 | Archaea | 2020 |
| 23 | Ga0070673_100669731 | 3300005364 | Bacteria | 951 |
| 24 | Ga0070688_100438699 | 3300005365 | Bacteria | 974 |
| 25 | Ga0070688_100449897 | 3300005365 | Unclassified | 963 |
| 26 | Ga0070688_100797411 | 3300005365 | Unclassified | 738 |
| 27 | Ga0070659_101096353 | 3300005366 | Unclassified | 702 |
| 28 | Ga0070667_102333133 | 3300005367 | Unclassified | 504 |
| 29 | Ga0070714_100287512 | 3300005435 | Bacteria | 1529 |
| 30 | Ga0070711_101246389 | 3300005439 | Unclassified | 644 |
| 31 | Ga0070705_100278846 | 3300005440 | Unclassified | 1187 |
| 32 | Ga0070700_100191082 | 3300005441 | Bacteria | 1432 |
| 33 | Ga0070694_101302694 | 3300005444 | Unclassified | 611 |
| 34 | Ga0070708_100400820 | 3300005445 | Bacteria | 1294 |
| 35 | Ga0070708_101379779 | 3300005445 | Unclassified | 658 |
| 36 | Ga0070678_100107743 | 3300005456 | Unclassified | 2174 |
| 37 | Ga0070678_100428206 | 3300005456 | Unclassified | 1155 |
| 38 | Ga0070678_100552980 | 3300005456 | Bacteria | 1022 |
| 39 | Ga0070681_10091928 | 3300005458 | Bacteria | 2984 |
| 40 | Ga0068867_100087308 | 3300005459 | Archaea | 2361 |
| 41 | Ga0068867_100672155 | 3300005459 | Bacteria | 911 |
| 42 | Ga0070685_10123209 | 3300005466 | Unclassified | 1612 |
| 43 | Ga0070706_100000215 | 3300005467 | Bacteria | 71421 |
| 44 | Ga0070706_100474005 | 3300005467 | Bacteria | 1164 |
| 45 | Ga0070706_101803360 | 3300005467 | Bacteria | 556 |
| 46 | Ga0070698_100212429 | 3300005471 | Unclassified | 1869 |
| 47 | Ga0070699_100452815 | 3300005518 | Unclassified | 1164 |
| 48 | Ga0070699_101034931 | 3300005518 | Unclassified | 753 |
| 49 | Ga0070679_101208054 | 3300005530 | Unclassified | 701 |
| 50 | Ga0070684_100303282 | 3300005535 | Bacteria | 1466 |
| 51 | Ga0070697_100343617 | 3300005536 | Bacteria | 1288 |
| 52 | Ga0070672_100386463 | 3300005543 | Unclassified | 1198 |
| 53 | Ga0070686_100010945 | 3300005544 | Bacteria | 5135 |
| 54 | Ga0070686_100108291 | 3300005544 | Bacteria | 1888 |
| 55 | Ga0070686_101404075 | 3300005544 | Bacteria | 586 |
| 56 | Ga0070695_100132537 | 3300005545 | Bacteria | 1719 |
| 57 | Ga0070696_100483718 | 3300005546 | Unclassified | 982 |
| 58 | Ga0070693_100229336 | 3300005547 | Archaea | 1221 |
| 59 | Ga0070693_101192908 | 3300005547 | Bacteria | 584 |
| 60 | Ga0070665_101811676 | 3300005548 | Unclassified | 617 |
| 61 | Ga0070704_100003389 | 3300005549 | Bacteria | 9134 |
| 62 | Ga0070664_100353324 | 3300005564 | Unclassified | 1337 |
| 63 | Ga0070664_101014800 | 3300005564 | Bacteria | 780 |
| 64 | Ga0068857_100038556 | 3300005577 | Bacteria | 4231 |
| 65 | Ga0068857_100559076 | 3300005577 | Unclassified | 1078 |
| 66 | Ga0068856_100241135 | 3300005614 | Bacteria | 1823 |
| 67 | Ga0070702_100033848 | 3300005615 | Archaea | 2812 |
| 68 | Ga0070702_101498663 | 3300005615 | Bacteria | 555 |
| 69 | Ga0068859_100564913 | 3300005617 | Bacteria | 1232 |
| 70 | Ga0068864_100035416 | 3300005618 | Bacteria | 4249 |
| 71 | Ga0068864_100200705 | 3300005618 | Unclassified | 1832 |
| 72 | Ga0068864_100367286 | 3300005618 | Bacteria | 1361 |
| 73 | Ga0068864_101023864 | 3300005618 | Bacteria | 820 |
| 74 | Ga0068864_101603265 | 3300005618 | Unclassified | 655 |
| 75 | Ga0068864_101629541 | 3300005618 | Bacteria | 649 |
| 76 | Ga0068864_101642889 | 3300005618 | Bacteria | 647 |
| 77 | Ga0068866_10495546 | 3300005718 | Unclassified | 807 |
| 78 | Ga0068861_101823545 | 3300005719 | Bacteria | 604 |
| 79 | Ga0068870_10001954 | 3300005840 | Bacteria | 8521 |
| 80 | Ga0068870_10189070 | 3300005840 | Unclassified | 1241 |
| 81 | Ga0068863_100156394 | 3300005841 | Bacteria | 2183 |
| 82 | Ga0068863_101736765 | 3300005841 | Bacteria | 634 |
| 83 | Ga0068863_102092625 | 3300005841 | Unclassified | 576 |
| 84 | Ga0068858_100262471 | 3300005842 | Unclassified | 1642 |
| 85 | Ga0068860_100527866 | 3300005843 | Bacteria | 1181 |
| 86 | Ga0068862_101291456 | 3300005844 | Unclassified | 731 |
| 87 | Ga0081455_10001266 | 3300005937 | Bacteria | 31572 |
| 88 | Ga0081455_10194303 | 3300005937 | Bacteria | 1525 |
| 89 | Ga0081455_10659939 | 3300005937 | Unclassified | 672 |
| 90 | Ga0070712_100557422 | 3300006175 | Bacteria | 966 |
| 91 | Ga0070712_101486076 | 3300006175 | Unclassified | 592 |
| 92 | Ga0097621_100893756 | 3300006237 | Bacteria | 827 |
| 93 | Ga0068871_100964436 | 3300006358 | Unclassified | 793 |
| 94 | Ga0068871_101184083 | 3300006358 | Bacteria | 716 |
| 95 | Ga0068871_102256335 | 3300006358 | Bacteria | 519 |
| 96 | Ga0075428_100001182 | 3300006844 | Bacteria | 27941 |
| 97 | Ga0075433_10037944 | 3300006852 | Bacteria | 4159 |
| 98 | Ga0075433_10084021 | 3300006852 | Bacteria | 2810 |
| 99 | Ga0075433_10107013 | 3300006852 | Bacteria | 2479 |
| 100 | Ga0075429_100168680 | 3300006880 | Bacteria | 1917 |
| 101 | Ga0068865_100570263 | 3300006881 | Bacteria | 953 |
| 102 | Ga0068865_101614208 | 3300006881 | Bacteria | 583 |
| 103 | Ga0097620_100564869 | 3300006931 | Bacteria | 1232 |
| 104 | Ga0075435_100263803 | 3300007076 | Archaea | 1468 |
| 105 | Ga0111539_10015824 | 3300009094 | Bacteria | 9369 |
| 106 | Ga0105247_10073191 | 3300009101 | Bacteria | 2147 |
| 107 | Ga0114129_10000286 | 3300009147 | Bacteria | 58249 |
| 108 | Ga0105243_10016596 | 3300009148 | Bacteria | 5568 |
| 109 | Ga0105243_10022853 | 3300009148 | Archaea | 4754 |
| 110 | Ga0105243_12771164 | 3300009148 | Unclassified | 531 |
| 111 | Ga0105242_10953670 | 3300009176 | Unclassified | 862 |
| 112 | Ga0105248_10683947 | 3300009177 | Bacteria | 1157 |
| 113 | Ga0105248_10959913 | 3300009177 | Bacteria | 965 |
| 114 | Ga0105248_10960026 | 3300009177 | Bacteria | 965 |
| 115 | Ga0105248_12105800 | 3300009177 | Bacteria | 641 |
| 116 | Ga0105237_12510795 | 3300009545 | Unclassified | 526 |
| 117 | Ga0105249_10445468 | 3300009553 | Unclassified | 1333 |
| 118 | Ga0105249_12572774 | 3300009553 | Unclassified | 581 |
| 119 | Ga0105239_10994616 | 3300010375 | Bacteria | 964 |
| 120 | Ga0105239_13251455 | 3300010375 | Unclassified | 529 |
| 121 | Ga0105239_13535239 | 3300010375 | Bacteria | 508 |
| 122 | Ga0105246_10027632 | 3300011119 | Unclassified | 3720 |
| 123 | Ga0105246_10384491 | 3300011119 | Bacteria | 1161 |
| 124 | Ga0105246_11282308 | 3300011119 | Unclassified | 678 |
| 125 | Ga0105246_12259880 | 3300011119 | Unclassified | 530 |
| 126 | Ga0157373_10416866 | 3300013100 | Bacteria | 964 |
| 127 | Ga0157378_10199257 | 3300013297 | Bacteria | 1893 |
| 128 | Ga0157378_11810253 | 3300013297 | Unclassified | 659 |
| 129 | Ga0163162_10361457 | 3300013306 | Bacteria | 1585 |
| 130 | Ga0163162_12084751 | 3300013306 | Unclassified | 650 |
| 131 | Ga0163162_12939103 | 3300013306 | Unclassified | 548 |
| 132 | Ga0157375_10015545 | 3300013308 | Bacteria | 6816 |
| 133 | Ga0157375_10161444 | 3300013308 | Bacteria | 2383 |
| 134 | Ga0157375_11610049 | 3300013308 | Bacteria | 768 |
| 135 | Ga0163163_10001255 | 3300014325 | Bacteria | 21393 |
| 136 | Ga0163163_10017578 | 3300014325 | Bacteria | 6673 |
| 137 | Ga0163163_10063661 | 3300014325 | Bacteria | 3658 |
| 138 | Ga0163163_10391920 | 3300014325 | Bacteria | 1447 |
| 139 | Ga0163163_10447307 | 3300014325 | Bacteria | 1352 |
| 140 | Ga0163163_12327206 | 3300014325 | Unclassified | 594 |
| 141 | Ga0157380_10190708 | 3300014326 | Unclassified | 1809 |
| 142 | Ga0157380_10467636 | 3300014326 | Bacteria | 1216 |
| 143 | Ga0157380_10526006 | 3300014326 | Bacteria | 1155 |
| 144 | Ga0157380_13034648 | 3300014326 | Unclassified | 535 |
| 145 | Ga0182008_10823366 | 3300014497 | Bacteria | 540 |
| 146 | Ga0157379_10113749 | 3300014968 | Bacteria | 2432 |
| 147 | Ga0157379_10241986 | 3300014968 | Unclassified | 1637 |
| 148 | Ga0157379_10494831 | 3300014968 | Bacteria | 1133 |
| 149 | Ga0157379_10639014 | 3300014968 | Bacteria | 996 |
| 150 | Ga0157376_10252941 | 3300014969 | Bacteria | 1646 |
| 151 | Ga0157376_12109889 | 3300014969 | Bacteria | 602 |
| 152 | Ga0163161_11279645 | 3300017792 | Unclassified | 637 |
| 153 | Ga0207642_10751173 | 3300025899 | Unclassified | 617 |
| 154 | Ga0207710_10037066 | 3300025900 | Bacteria | 2152 |
| 155 | Ga0207680_10137043 | 3300025903 | Bacteria | 1619 |
| 156 | Ga0207680_10837304 | 3300025903 | Unclassified | 659 |
| 157 | Ga0207645_10682629 | 3300025907 | Unclassified | 698 |
| 158 | Ga0207643_10002955 | 3300025908 | Bacteria | 9172 |
| 159 | Ga0207643_10176499 | 3300025908 | Unclassified | 1291 |
| 160 | Ga0207684_10000013 | 3300025910 | Bacteria | 443468 |
| 161 | Ga0207684_10478407 | 3300025910 | Bacteria | 1068 |
| 162 | Ga0207654_11360148 | 3300025911 | Unclassified | 518 |
| 163 | Ga0207693_11226767 | 3300025915 | Bacteria | 564 |
| 164 | Ga0207662_10504678 | 3300025918 | Unclassified | 833 |
| 165 | Ga0207649_10841468 | 3300025920 | Unclassified | 718 |
| 166 | Ga0207652_11007646 | 3300025921 | Unclassified | 732 |
| 167 | Ga0207646_11299056 | 3300025922 | Unclassified | 635 |
| 168 | Ga0207650_10000664 | 3300025925 | Bacteria | 27105 |
| 169 | Ga0207650_11139622 | 3300025925 | Unclassified | 664 |
| 170 | Ga0207659_10172156 | 3300025926 | Unclassified | 1709 |
| 171 | Ga0207687_10136072 | 3300025927 | Bacteria | 1858 |
| 172 | Ga0207644_11462866 | 3300025931 | Bacteria | 574 |
| 173 | Ga0207686_10096360 | 3300025934 | Bacteria | 1966 |
| 174 | Ga0207709_10762929 | 3300025935 | Bacteria | 778 |
| 175 | Ga0207669_10063804 | 3300025937 | Archaea | 2276 |
| 176 | Ga0207669_10068893 | 3300025937 | Bacteria | 2212 |
| 177 | Ga0207691_10270243 | 3300025940 | Archaea | 1464 |
| 178 | Ga0207711_10806226 | 3300025941 | Bacteria | 874 |
| 179 | Ga0207661_10287517 | 3300025944 | Unclassified | 1471 |
| 180 | Ga0207661_11385767 | 3300025944 | Unclassified | 645 |
| 181 | Ga0207679_10042742 | 3300025945 | Bacteria | 3259 |
| 182 | Ga0207679_12144874 | 3300025945 | Unclassified | 507 |
| 183 | Ga0207651_10600073 | 3300025960 | Bacteria | 962 |
| 184 | Ga0207668_10380030 | 3300025972 | Bacteria | 1189 |
| 185 | Ga0207677_11935105 | 3300026023 | Unclassified | 548 |
| 186 | Ga0207703_10739124 | 3300026035 | Bacteria | 937 |
| 187 | Ga0207703_10920049 | 3300026035 | Bacteria | 838 |
| 188 | Ga0207708_10105314 | 3300026075 | Unclassified | 2186 |
| 189 | Ga0207708_11050980 | 3300026075 | Bacteria | 709 |
| 190 | Ga0207702_10494125 | 3300026078 | Unclassified | 1192 |
| 191 | Ga0207702_12178153 | 3300026078 | Unclassified | 543 |
| 192 | Ga0207641_10106456 | 3300026088 | Bacteria | 2479 |
| 193 | Ga0207641_10474697 | 3300026088 | Unclassified | 1212 |
| 194 | Ga0207641_11748162 | 3300026088 | Bacteria | 624 |
| 195 | Ga0207648_10016610 | 3300026089 | Bacteria | 6719 |
| 196 | Ga0207648_10398406 | 3300026089 | Bacteria | 1247 |
| 197 | Ga0207676_10003790 | 3300026095 | Bacteria | 10691 |
| 198 | Ga0207676_10148981 | 3300026095 | Bacteria | 2013 |
| 199 | Ga0207676_10568828 | 3300026095 | Bacteria | 1085 |
| 200 | Ga0207676_10577523 | 3300026095 | Bacteria | 1077 |
| 201 | Ga0207676_10857546 | 3300026095 | Unclassified | 889 |
| 202 | Ga0207674_10620044 | 3300026116 | Unclassified | 1045 |
| 203 | Ga0207674_10862862 | 3300026116 | Bacteria | 873 |
| 204 | Ga0207675_101905550 | 3300026118 | Unclassified | 613 |
| 205 | Ga0207675_102668108 | 3300026118 | Unclassified | 508 |
| 206 | Ga0207683_10466927 | 3300026121 | Bacteria | 1164 |
| 207 | Ga0207683_10495217 | 3300026121 | Unclassified | 1128 |
| 208 | Ga0207683_10682072 | 3300026121 | Bacteria | 952 |
| 209 | Ga0207698_10213543 | 3300026142 | Unclassified | 1738 |
| 210 | Ga0209969_1025896 | 3300027360 | Bacteria | 885 |
| 211 | Ga0209996_1012640 | 3300027395 | Bacteria | 1135 |
| 212 | Ga0209984_1020234 | 3300027424 | Unclassified | 909 |
| 213 | Ga0209968_1003052 | 3300027526 | Unclassified | 2513 |
| 214 | Ga0209999_1020279 | 3300027543 | Bacteria | 1221 |
| 215 | Ga0209999_1069601 | 3300027543 | Bacteria | 674 |
| 216 | Ga0209982_1004579 | 3300027552 | Bacteria | 1983 |
| 217 | Ga0210002_1018874 | 3300027617 | Bacteria | 1104 |
| 218 | Ga0209983_1014764 | 3300027665 | Bacteria | 1610 |
| 219 | Ga0209983_1111489 | 3300027665 | Unclassified | 622 |
| 220 | Ga0209971_1002642 | 3300027682 | Bacteria | 4291 |
| 221 | Ga0209966_1006311 | 3300027695 | Bacteria | 2056 |
| 222 | Ga0209998_10007931 | 3300027717 | Bacteria | 2203 |
| 223 | Ga0209974_10001443 | 3300027876 | Bacteria | 8618 |
| 224 | Ga0207428_10070341 | 3300027907 | Bacteria | 2750 |
| 225 | Ga0265326_10024283 | 3300028558 | Unclassified | 1730 |
| 226 | Ga0265326_10120116 | 3300028558 | Bacteria | 747 |
| 227 | Ga0265326_10168321 | 3300028558 | Unclassified | 627 |
| 228 | Ga0265319_1019322 | 3300028563 | Bacteria | 2545 |
| 229 | Ga0265334_10031261 | 3300028573 | Unclassified | 2128 |
| 230 | Ga0265334_10031842 | 3300028573 | Bacteria | 2106 |
| 231 | Ga0265334_10035279 | 3300028573 | Unclassified | 1981 |
| 232 | Ga0265334_10063716 | 3300028573 | Unclassified | 1385 |
| 233 | Ga0265318_10003654 | 3300028577 | Bacteria | 7680 |
| 234 | Ga0265318_10011724 | 3300028577 | Bacteria | 3759 |
| 235 | Ga0265318_10019556 | 3300028577 | Bacteria | 2745 |
| 236 | Ga0265318_10272643 | 3300028577 | Unclassified | 617 |
| 237 | Ga0265323_10024956 | 3300028653 | Bacteria | 2269 |
| 238 | Ga0265322_10009410 | 3300028654 | Bacteria | 2837 |
| 239 | Ga0265322_10022289 | 3300028654 | Bacteria | 1812 |
| 240 | Ga0265336_10066296 | 3300028666 | Unclassified | 1080 |
| 241 | Ga0265338_10106050 | 3300028800 | Bacteria | 2276 |
| 242 | Ga0265338_10221827 | 3300028800 | Unclassified | 1412 |
| 243 | Ga0265324_10026902 | 3300029957 | Bacteria | 2034 |
| 244 | Ga0265324_10240691 | 3300029957 | Unclassified | 614 |
| 245 | Ga0265330_10047851 | 3300031235 | Bacteria | 1881 |
| 246 | Ga0265330_10169071 | 3300031235 | Unclassified | 927 |
| 247 | Ga0265332_10009447 | 3300031238 | Bacteria | 4354 |
| 248 | Ga0265328_10182244 | 3300031239 | Unclassified | 794 |
| 249 | Ga0265328_10358020 | 3300031239 | Unclassified | 569 |
| 250 | Ga0265320_10006513 | 3300031240 | Bacteria | 7357 |
| 251 | Ga0265320_10020855 | 3300031240 | Bacteria | 3540 |
| 252 | Ga0265320_10169322 | 3300031240 | Bacteria | 982 |
| 253 | Ga0265320_10199449 | 3300031240 | Bacteria | 894 |
| 254 | Ga0265325_10056488 | 3300031241 | Bacteria | 2005 |
| 255 | Ga0265325_10081729 | 3300031241 | Bacteria | 1605 |
| 256 | Ga0265325_10113822 | 3300031241 | Unclassified | 1312 |
| 257 | Ga0265329_10002514 | 3300031242 | Bacteria | 8278 |
| 258 | Ga0265329_10005869 | 3300031242 | Bacteria | 4922 |
| 259 | Ga0265329_10145894 | 3300031242 | Unclassified | 765 |
| 260 | Ga0265340_10013761 | 3300031247 | Bacteria | 4243 |
| 261 | Ga0265339_10055404 | 3300031249 | Bacteria | 2151 |
| 262 | Ga0265339_10148297 | 3300031249 | Bacteria | 1188 |
| 263 | Ga0265339_10184469 | 3300031249 | Unclassified | 1037 |
| 264 | Ga0265339_10274291 | 3300031249 | Bacteria | 810 |
| 265 | Ga0265331_10023966 | 3300031250 | Bacteria | 3093 |
| 266 | Ga0265331_10143826 | 3300031250 | Bacteria | 1084 |
| 267 | Ga0265316_10069516 | 3300031344 | Bacteria | 2717 |
| 268 | Ga0265316_10082574 | 3300031344 | Bacteria | 2462 |
| 269 | Ga0265316_10137681 | 3300031344 | Bacteria | 1836 |
| 270 | Ga0307408_100250216 | 3300031548 | Bacteria | 1461 |
| 271 | Ga0265313_10037237 | 3300031595 | Unclassified | 2434 |
| 272 | Ga0265313_10144249 | 3300031595 | Bacteria | 1022 |
| 273 | Ga0265313_10304793 | 3300031595 | Bacteria | 639 |
| 274 | Ga0316575_10018399 | 3300031665 | Bacteria | 2663 |
| 275 | Ga0265314_10004439 | 3300031711 | Bacteria | 13024 |
| 276 | Ga0265314_10021387 | 3300031711 | Bacteria | 4974 |
| 277 | Ga0265314_10320668 | 3300031711 | Bacteria | 862 |
| 278 | Ga0265342_10028561 | 3300031712 | Bacteria | 3473 |
| 279 | Ga0265342_10046397 | 3300031712 | Bacteria | 2612 |
| 280 | Ga0265342_10336471 | 3300031712 | Unclassified | 788 |
| 281 | Ga0265342_10370148 | 3300031712 | Unclassified | 744 |
| 282 | Ga0316576_10007781 | 3300031727 | Bacteria | 6771 |
| 283 | Ga0316576_10040749 | 3300031727 | Bacteria | 3339 |
| 284 | Ga0316576_10057602 | 3300031727 | Bacteria | 2840 |
| 285 | Ga0316576_10122202 | 3300031727 | Unclassified | 1956 |
| 286 | Ga0316576_10293044 | 3300031727 | Bacteria | 1217 |
| 287 | Ga0316576_10530043 | 3300031727 | Bacteria | 864 |
| 288 | Ga0316576_10886560 | 3300031727 | Bacteria | 639 |
| 289 | Ga0316578_10037877 | 3300031728 | Unclassified | 2779 |
| 290 | Ga0316578_10330238 | 3300031728 | Bacteria | 909 |
| 291 | Ga0316578_10668874 | 3300031728 | Unclassified | 606 |
| 292 | Ga0316578_10850670 | 3300031728 | Unclassified | 528 |
| 293 | Ga0307405_10144741 | 3300031731 | Bacteria | 1663 |
| 294 | Ga0307405_10317922 | 3300031731 | Unclassified | 1188 |
| 295 | Ga0307413_10235558 | 3300031824 | Bacteria | 1348 |
| 296 | Ga0307410_11284556 | 3300031852 | Unclassified | 640 |
| 297 | Ga0307406_10098808 | 3300031901 | Unclassified | 1983 |
| 298 | Ga0307407_11184952 | 3300031903 | Unclassified | 596 |
| 299 | Ga0307412_11687308 | 3300031911 | Unclassified | 580 |
| 300 | Ga0307412_12107514 | 3300031911 | Unclassified | 524 |
| 301 | Ga0307409_100322491 | 3300031995 | Bacteria | 1446 |
| 302 | Ga0307416_100009750 | 3300032002 | Bacteria | 6309 |
| 303 | Ga0307416_100318507 | 3300032002 | Bacteria | 1556 |
| 304 | Ga0307414_10439129 | 3300032004 | Bacteria | 1142 |
| 305 | Ga0307411_10116737 | 3300032005 | Bacteria | 1922 |
| 306 | Ga0307411_10350905 | 3300032005 | Bacteria | 1203 |
| 307 | Ga0307415_100049572 | 3300032126 | Unclassified | 2840 |
| 308 | Ga0307415_100194555 | 3300032126 | Bacteria | 1603 |
| 309 | Ga0307415_100562086 | 3300032126 | Bacteria | 1009 |
| 310 | Ga0316583_10005396 | 3300032133 | Unclassified | 4589 |
| 311 | Ga0316583_10104753 | 3300032133 | Bacteria | 986 |
| 312 | Ga0316580_10043865 | 3300032139 | Bacteria | 1380 |
| 313 | Ga0316593_10006625 | 3300032168 | Unclassified | 3138 |
| 314 | Ga0316593_10007619 | 3300032168 | Unclassified | 2979 |
| 315 | Ga0316593_10029349 | 3300032168 | Bacteria | 1779 |
| 316 | Ga0316593_10035770 | 3300032168 | Bacteria | 1635 |
| 317 | Ga0316593_10130182 | 3300032168 | Bacteria | 907 |
| 318 | Ga0316593_10161357 | 3300032168 | Bacteria | 819 |
| 319 | Ga0316592_1002554 | 3300033524 | Bacteria | 3161 |
| 320 | Ga0316592_1003672 | 3300033524 | Bacteria | 2789 |
| 321 | Ga0316592_1074019 | 3300033524 | Unclassified | 772 |
| 322 | Ga0316592_1075343 | 3300033524 | Bacteria | 765 |
| 323 | Ga0316586_1012643 | 3300033527 | Bacteria | 1312 |
| 324 | Ga0316586_1019189 | 3300033527 | Bacteria | 1115 |
| 325 | Ga0316586_1030836 | 3300033527 | Bacteria | 918 |
| 326 | Ga0316586_1063942 | 3300033527 | Bacteria | 672 |
| 327 | Ga0316588_1006365 | 3300033528 | Bacteria | 2357 |
| 328 | Ga0316587_1081817 | 3300033529 | Bacteria | 611 |
| 329 | Ga0316596_1005564 | 3300033541 | Unclassified | 2883 |
| 330 | Ga0316596_1016396 | 3300033541 | Bacteria | 1856 |
| 331 | Ga0316596_1052970 | 3300033541 | Bacteria | 1076 |
| 332 | Ga0316596_1055758 | 3300033541 | Bacteria | 1050 |
| 333 | Ga0316596_1064591 | 3300033541 | Bacteria | 978 |
| 334 | Ga0316596_1082760 | 3300033541 | Unclassified | 863 |
| 335 | Ga0316596_1100801 | 3300033541 | Bacteria | 781 |
| 336 | Ga0316596_1146021 | 3300033541 | Bacteria | 649 |
| 337 | Ga0316596_1157585 | 3300033541 | Bacteria | 625 |
| 338 | Ga0316596_1186505 | 3300033541 | Bacteria | 575 |
| 339 | Ga0373948_0054460 | 3300034817 | Unclassified | 866 |
| 340 | Ga0373934_0441994 | 3300035086 | Bacteria | 545 |
| 341 | Ga0373951_0127629 | 3300035091 | Unclassified | 697 |
| 342 | Ga0373923_0330040 | 3300035111 | Unclassified | 726 |
| 343 | Ga0373939_0250030 | 3300035114 | Bacteria | 690 |
| 344 | Ga0373943_0037457 | 3300035170 | Unclassified | 2328 |
| 345 | Ga0373943_0049010 | 3300035170 | Bacteria | 2072 |
| 346 | Ga0316574_0076384 | 3300035398 | Bacteria | 2122 |
| 347 | Ga0316574_0102454 | 3300035398 | Bacteria | 1832 |
| 348 | Ga0316574_0108276 | 3300035398 | Bacteria | 1781 |
| 349 | Ga0316574_0114081 | 3300035398 | Unclassified | 1733 |
| 350 | Ga0316574_0200103 | 3300035398 | Bacteria | 1283 |
| 351 | Ga0316574_0281918 | 3300035398 | Bacteria | 1058 |
| 352 | Ga0373935_0543385 | 3300035692 | Bacteria | 846 |
| 353 | Ga0373947_0043091 | 3300035725 | Bacteria | 2695 |
| 354 | Ga0373947_0132589 | 3300035725 | Bacteria | 1592 |
| 355 | Ga0373947_0277473 | 3300035725 | Bacteria | 1114 |
| 356 | Ga0373937_0233145 | 3300036401 | Bacteria | 1734 |
| 357 | Ga0373937_0998143 | 3300036401 | Bacteria | 786 |
| 358 | Ga0316582_1274696 | 3300036647 | Bacteria | 500 |
| 359 | Ga0316584_0018846 | 3300036712 | Bacteria | 4983 |
| 360 | Ga0316584_0283478 | 3300036712 | Bacteria | 1203 |
| 361 | Ga0316584_0356953 | 3300036712 | Bacteria | 1048 |
| 362 | Ga0316584_0638500 | 3300036712 | Bacteria | 735 |
| 363 | Ga0316584_0984287 | 3300036712 | Bacteria | 564 |
| 364 | Ga0316584_1078653 | 3300036712 | Unclassified | 534 |
| 365 | Ga0373925_0346087 | 3300037068 | Bacteria | 1206 |
| 366 | Ga0373925_0817499 | 3300037068 | Bacteria | 768 |
| 367 | Ga0439453_0029124 | 3300041408 | Bacteria | 1038 |
| 368 | Ga0451800_0713708 | 3300041459 | Unclassified | 566 |
| 369 | Ga0451835_0118627 | 3300041492 | Unclassified | 726 |
| 370 | Ga0451855_1635569 | 3300041511 | Unclassified | 749 |
| 371 | Ga0451853_3340028 | 3300041512 | Bacteria | 1456 |
| 372 | Ga0439443_013293 | 3300042003 | Archaea | 1229 |
| 373 | Ga0439454_022476 | 3300042011 | Bacteria | 940 |
| 374 | Ga0439454_104862 | 3300042011 | Bacteria | 535 |
| 375 | Ga0439463_156678 | 3300042016 | Bacteria | 591 |
| 376 | Ga0450920_011506 | 3300042122 | Bacteria | 1650 |
| 377 | Ga0450910_018404 | 3300042147 | Bacteria | 1044 |
| 378 | Ga0439458_0098592 | 3300042157 | Unclassified | 757 |
| 379 | Ga0450908_014990 | 3300042184 | Bacteria | 1389 |
| 380 | Ga0439434_0215532 | 3300042435 | Unclassified | 650 |
| 381 | Ga0439435_0067058 | 3300042436 | Unclassified | 1056 |
| 382 | Ga0439435_0307087 | 3300042436 | Unclassified | 544 |
| 383 | Ga0439444_0063515 | 3300042437 | Archaea | 776 |
| 384 | Ga0439460_0014414 | 3300042461 | Bacteria | 2078 |
| 385 | Ga0450916_095995 | 3300042530 | Bacteria | 521 |
| 386 | Ga0451577_0409888 | 3300042876 | Unclassified | 1230 |
| 387 | Ga0439440_0076355 | 3300042993 | Bacteria | 880 |
| 388 | Ga0439440_0124429 | 3300042993 | Unclassified | 720 |
| 389 | Ga0453684_0222250 | 3300044712 | Bacteria | 2187 |
| 390 | Ga0451576_0761997 | 3300045051 | Unclassified | 1017 |
| 391 | Ga0495592_0157104 | 3300046454 | Bacteria | 1568 |
| 392 | Ga0495592_0382027 | 3300046454 | Bacteria | 896 |
| 393 | Ga0495603_0085193 | 3300046455 | Bacteria | 1850 |
| 394 | Ga0495603_0158973 | 3300046455 | Bacteria | 1311 |
| 395 | Ga0495603_0378881 | 3300046455 | Bacteria | 811 |
| 396 | Ga0495603_0867530 | 3300046455 | Unclassified | 513 |
| 397 | Ga0495629_0017235 | 3300046459 | Bacteria | 5181 |
| 398 | Ga0495629_0253312 | 3300046459 | Bacteria | 1211 |
| 399 | Ga0495641_0126030 | 3300046461 | Bacteria | 1142 |
| 400 | Ga0495651_0047581 | 3300046462 | Bacteria | 3315 |
| 401 | Ga0495580_0070197 | 3300046472 | Bacteria | 2447 |
| 402 | Ga0495582_0000200 | 3300046473 | Bacteria | 33369 |
| 403 | Ga0495582_0497483 | 3300046473 | Unclassified | 705 |
| 404 | Ga0495639_0011725 | 3300046475 | Bacteria | 3780 |
| 405 | Ga0495639_0275956 | 3300046475 | Unclassified | 835 |
| 406 | Ga0495662_0068237 | 3300046476 | Bacteria | 1722 |
| 407 | Ga0495594_0680751 | 3300046499 | Unclassified | 582 |
| 408 | Ga0495630_0216879 | 3300046517 | Bacteria | 1461 |
| 409 | Ga0495630_0354393 | 3300046517 | Bacteria | 1123 |
| 410 | Ga0495630_1456823 | 3300046517 | Unclassified | 514 |
| 411 | Ga0495666_0193353 | 3300046526 | Bacteria | 937 |
| 412 | Ga0495665_0011597 | 3300046531 | Bacteria | 4772 |
| 413 | Ga0495640_0654768 | 3300046533 | Unclassified | 632 |
| 414 | Ga0495586_0271352 | 3300046535 | Unclassified | 970 |
| 415 | Ga0495598_0333935 | 3300046537 | Bacteria | 580 |
| 416 | Ga0495667_0378619 | 3300046559 | Bacteria | 893 |
| 417 | Ga0495656_0034059 | 3300046615 | Unclassified | 2083 |
| 418 | Ga0495634_0343046 | 3300046642 | Unclassified | 896 |
| 419 | Ga0495635_0245516 | 3300046663 | Bacteria | 1208 |
| 420 | Ga0495588_0758653 | 3300046674 | Unclassified | 507 |
| 421 | Ga0495657_0210428 | 3300046675 | Bacteria | 1182 |
| 422 | Ga0495623_0214657 | 3300046679 | Bacteria | 1100 |
| 423 | Ga0495647_0216183 | 3300046681 | Bacteria | 845 |
| 424 | Ga0495658_0001000 | 3300046683 | Bacteria | 14932 |
| 425 | Ga0495658_0156507 | 3300046683 | Bacteria | 1403 |
| 426 | Ga0495658_0615257 | 3300046683 | Unclassified | 696 |
| 427 | Ga0495613_0002275 | 3300046689 | Bacteria | 14531 |
| 428 | Ga0495624_0249396 | 3300046690 | Bacteria | 1074 |
| 429 | Ga0495581_0001423 | 3300047315 | Bacteria | 13273 |
| 430 | Ga0495676_0058516 | 3300047321 | Bacteria | 3032 |
| 431 | Ga0495676_0600450 | 3300047321 | Unclassified | 717 |
| 432 | Ga0495676_0754417 | 3300047321 | Unclassified | 628 |
| 433 | Ga0495676_0765633 | 3300047321 | Bacteria | 623 |
| 434 | Ga0495676_0995173 | 3300047321 | Bacteria | 535 |
| 435 | Ga0495593_0704986 | 3300047673 | Unclassified | 507 |
| 436 | Ga0495602_0655686 | 3300048088 | Bacteria | 716 |
| 437 | Ga0495614_0239263 | 3300048089 | Bacteria | 828 |
| 438 | Ga0496100_0098275 | 3300048903 | Bacteria | 2012 |
| 439 | Ga0496100_0299646 | 3300048903 | Unclassified | 1203 |
| 440 | Ga0496100_0541096 | 3300048903 | Bacteria | 900 |
| 441 | Ga0496100_1238274 | 3300048903 | Unclassified | 589 |
| 442 | Ga0496101_0029448 | 3300048904 | Bacteria | 3840 |
| 443 | Ga0496101_0581647 | 3300048904 | Bacteria | 885 |
| 444 | Ga0496101_0993781 | 3300048904 | Unclassified | 660 |
| 445 | Ga0496102_0329695 | 3300048905 | Bacteria | 1438 |
| 446 | Ga0496102_0432322 | 3300048905 | Bacteria | 1236 |
| 447 | Ga0496102_1695352 | 3300048905 | Bacteria | 550 |
| 448 | Ga0496104_0001663 | 3300048907 | Bacteria | 19213 |
| 449 | Ga0496104_0003658 | 3300048907 | Bacteria | 13274 |
| 450 | Ga0496104_0009378 | 3300048907 | Bacteria | 8705 |
| 451 | Ga0496104_0073010 | 3300048907 | Bacteria | 3264 |
| 452 | Ga0496104_1855334 | 3300048907 | Unclassified | 505 |
| 453 | Ga0496105_0005723 | 3300048908 | Bacteria | 9461 |
| 454 | Ga0496105_0050162 | 3300048908 | Bacteria | 3447 |
| 455 | Ga0496105_0216809 | 3300048908 | Unclassified | 1559 |
| 456 | Ga0496105_0924127 | 3300048908 | Unclassified | 656 |
| 457 | Ga0496106_0153546 | 3300048909 | Unclassified | 1817 |
| 458 | Ga0496106_0190833 | 3300048909 | Bacteria | 1629 |
| 459 | Ga0496107_0107759 | 3300048910 | Bacteria | 2046 |
| 460 | Ga0496107_0154625 | 3300048910 | Bacteria | 1698 |
| 461 | Ga0496108_0001483 | 3300048911 | Bacteria | 18537 |
| 462 | Ga0496108_0014798 | 3300048911 | Bacteria | 6367 |
| 463 | Ga0496108_0261472 | 3300048911 | Bacteria | 1506 |
| 464 | Ga0496108_0489279 | 3300048911 | Bacteria | 1075 |
| 465 | Ga0496109_0002307 | 3300048912 | Bacteria | 15879 |
| 466 | Ga0496109_0008709 | 3300048912 | Bacteria | 8638 |
| 467 | Ga0496109_0234127 | 3300048912 | Bacteria | 1728 |
| 468 | Ga0496109_0251559 | 3300048912 | Unclassified | 1664 |
| 469 | Ga0496109_1107764 | 3300048912 | Unclassified | 729 |
| 470 | Ga0496109_1651697 | 3300048912 | Bacteria | 575 |
| 471 | Ga0496110_0008234 | 3300048913 | Bacteria | 8380 |
| 472 | Ga0496110_0247589 | 3300048913 | Unclassified | 1622 |
| 473 | Ga0496110_1462379 | 3300048913 | Unclassified | 593 |
| 474 | Ga0496111_0001853 | 3300048914 | Bacteria | 12475 |
| 475 | Ga0496111_0049409 | 3300048914 | Unclassified | 3033 |
| 476 | Ga0496111_0246479 | 3300048914 | Bacteria | 1326 |
| 477 | Ga0496112_0002831 | 3300048915 | Bacteria | 14082 |
| 478 | Ga0496112_0438119 | 3300048915 | Bacteria | 1245 |
| 479 | Ga0496112_0442901 | 3300048915 | Bacteria | 1237 |
| 480 | Ga0496112_0565068 | 3300048915 | Bacteria | 1071 |
| 481 | Ga0496112_1531613 | 3300048915 | Unclassified | 580 |
| 482 | Ga0496113_0010670 | 3300048916 | Bacteria | 6084 |
| 483 | Ga0496113_0143658 | 3300048916 | Unclassified | 1879 |
| 484 | Ga0496114_0005293 | 3300048917 | Bacteria | 10082 |
| 485 | Ga0496114_0338088 | 3300048917 | Bacteria | 1331 |
| 486 | Ga0496114_1003204 | 3300048917 | Archaea | 718 |
| 487 | Ga0501306_086203 | 3300049127 | Unclassified | 547 |
| 488 | Ga0501310_080486 | 3300049130 | Unclassified | 511 |
| 489 | Ga0501325_012218 | 3300049541 | Unclassified | 805 |
| 490 | Ga0501031_0002020 | 3300049568 | Bacteria | 12777 |
| 491 | Ga0501031_0004346 | 3300049568 | Bacteria | 9166 |
| 492 | Ga0501031_0007034 | 3300049568 | Bacteria | 7344 |
| 493 | Ga0501031_0110220 | 3300049568 | Bacteria | 1797 |
| 494 | Ga0501031_0246550 | 3300049568 | Bacteria | 1161 |
| 495 | Ga0501031_0253997 | 3300049568 | Bacteria | 1142 |
| 496 | Ga0501031_1072648 | 3300049568 | Bacteria | 514 |
| 497 | Ga0501032_0043392 | 3300049569 | Bacteria | 3046 |
| 498 | Ga0501032_0358692 | 3300049569 | Bacteria | 939 |
| 499 | Ga0501032_0738771 | 3300049569 | Bacteria | 623 |
| 500 | Ga0501033_0014111 | 3300049570 | Bacteria | 6075 |
| 501 | Ga0501033_0655563 | 3300049570 | Bacteria | 717 |
| 502 | Ga0501033_0985561 | 3300049570 | Unclassified | 564 |
| 503 | Ga0501034_0134418 | 3300049571 | Bacteria | 2455 |
| 504 | Ga0501036_0006726 | 3300049572 | Bacteria | 9345 |
| 505 | Ga0501036_0075284 | 3300049572 | Bacteria | 2855 |
| 506 | Ga0501036_0078835 | 3300049572 | Bacteria | 2786 |
| 507 | Ga0501036_0105183 | 3300049572 | Bacteria | 2387 |
| 508 | Ga0501036_0141777 | 3300049572 | Bacteria | 2028 |
| 509 | Ga0501036_0168660 | 3300049572 | Bacteria | 1845 |
| 510 | Ga0501036_0357061 | 3300049572 | Unclassified | 1220 |
| 511 | Ga0501036_0421130 | 3300049572 | Bacteria | 1113 |
| 512 | Ga0501037_0058493 | 3300049573 | Bacteria | 2813 |
| 513 | Ga0501037_0099383 | 3300049573 | Bacteria | 2101 |
| 514 | Ga0501037_0661000 | 3300049573 | Bacteria | 698 |
| 515 | Ga0501037_0820104 | 3300049573 | Unclassified | 613 |
| 516 | Ga0501037_0829664 | 3300049573 | Bacteria | 609 |
| 517 | Ga0501038_0010392 | 3300049574 | Bacteria | 8509 |
| 518 | Ga0501038_0136775 | 3300049574 | Archaea | 2007 |
| 519 | Ga0501038_0160233 | 3300049574 | Unclassified | 1829 |
| 520 | Ga0501038_0188586 | 3300049574 | Unclassified | 1660 |
| 521 | Ga0501038_0198573 | 3300049574 | Bacteria | 1611 |
| 522 | Ga0501038_0316505 | 3300049574 | Unclassified | 1222 |
| 523 | Ga0501038_0602219 | 3300049574 | Bacteria | 831 |
| 524 | Ga0501038_1289652 | 3300049574 | Bacteria | 528 |
| 525 | Ga0501039_0009311 | 3300049575 | Bacteria | 7481 |
| 526 | Ga0501039_0022486 | 3300049575 | Bacteria | 4840 |
| 527 | Ga0501039_0036539 | 3300049575 | Bacteria | 3791 |
| 528 | Ga0501039_0044398 | 3300049575 | Bacteria | 3433 |
| 529 | Ga0501039_0047952 | 3300049575 | Bacteria | 3302 |
| 530 | Ga0501039_0091637 | 3300049575 | Bacteria | 2369 |
| 531 | Ga0501039_0429278 | 3300049575 | Unclassified | 1038 |
| 532 | Ga0501039_0527626 | 3300049575 | Bacteria | 927 |
| 533 | Ga0501039_0592124 | 3300049575 | Unclassified | 869 |
| 534 | Ga0501040_0013469 | 3300049576 | Bacteria | 5375 |
| 535 | Ga0501040_0036632 | 3300049576 | Bacteria | 3330 |
| 536 | Ga0501040_0089487 | 3300049576 | Bacteria | 2139 |
| 537 | Ga0501040_0208750 | 3300049576 | Bacteria | 1388 |
| 538 | Ga0501040_0550952 | 3300049576 | Unclassified | 832 |
| 539 | Ga0501040_0708324 | 3300049576 | Bacteria | 728 |
| 540 | Ga0501040_1009008 | 3300049576 | Bacteria | 603 |
| 541 | Ga0501040_1184392 | 3300049576 | Bacteria | 554 |
| 542 | Ga0501041_0008168 | 3300049577 | Bacteria | 6158 |
| 543 | Ga0501041_0026991 | 3300049577 | Bacteria | 3458 |
| 544 | Ga0501041_0057014 | 3300049577 | Bacteria | 2388 |
| 545 | Ga0501041_0091033 | 3300049577 | Unclassified | 1883 |
| 546 | Ga0501042_0011055 | 3300049578 | Bacteria | 6078 |
| 547 | Ga0501042_0102726 | 3300049578 | Bacteria | 2056 |
| 548 | Ga0501042_0105477 | 3300049578 | Unclassified | 2028 |
| 549 | Ga0501042_0147905 | 3300049578 | Bacteria | 1693 |
| 550 | Ga0501042_0169465 | 3300049578 | Unclassified | 1576 |
| 551 | Ga0501042_0203556 | 3300049578 | Bacteria | 1427 |
| 552 | Ga0501042_0276154 | 3300049578 | Unclassified | 1213 |
| 553 | Ga0501042_0403660 | 3300049578 | Bacteria | 990 |
| 554 | Ga0501042_1379285 | 3300049578 | Unclassified | 514 |
| 555 | Ga0501043_0026684 | 3300049579 | Bacteria | 4531 |
| 556 | Ga0501043_0216005 | 3300049579 | Bacteria | 1485 |
| 557 | Ga0501043_0451414 | 3300049579 | Unclassified | 966 |
| 558 | Ga0501043_0777991 | 3300049579 | Bacteria | 694 |
| 559 | Ga0501043_1257969 | 3300049579 | Unclassified | 518 |
| 560 | Ga0501046_0025797 | 3300049580 | Bacteria | 4805 |
| 561 | Ga0501046_0134927 | 3300049580 | Unclassified | 1870 |
| 562 | Ga0501046_0273694 | 3300049580 | Unclassified | 1238 |
| 563 | Ga0501046_0308455 | 3300049580 | Bacteria | 1154 |
| 564 | Ga0501046_0367332 | 3300049580 | Bacteria | 1043 |
| 565 | Ga0501046_0808850 | 3300049580 | Bacteria | 656 |
| 566 | Ga0501048_0013255 | 3300049582 | Bacteria | 6117 |
| 567 | Ga0501048_0018516 | 3300049582 | Bacteria | 5119 |
| 568 | Ga0501048_0043639 | 3300049582 | Bacteria | 3209 |
| 569 | Ga0501048_0052568 | 3300049582 | Unclassified | 2900 |
| 570 | Ga0501048_0222402 | 3300049582 | Bacteria | 1339 |
| 571 | Ga0501048_0252619 | 3300049582 | Bacteria | 1252 |
| 572 | Ga0501048_0339360 | 3300049582 | Bacteria | 1071 |
| 573 | Ga0501048_0380831 | 3300049582 | Unclassified | 1007 |
| 574 | Ga0501067_0197041 | 3300049583 | Unclassified | 1122 |
| 575 | Ga0501067_0204509 | 3300049583 | Bacteria | 1100 |
| 576 | Ga0501068_0014796 | 3300049584 | Bacteria | 4465 |
| 577 | Ga0501068_0114740 | 3300049584 | Bacteria | 1677 |
| 578 | Ga0501068_0140528 | 3300049584 | Bacteria | 1514 |
| 579 | Ga0501068_0175541 | 3300049584 | Unclassified | 1354 |
| 580 | Ga0501068_0182296 | 3300049584 | Unclassified | 1328 |
| 581 | Ga0501068_0307167 | 3300049584 | Bacteria | 1016 |
| 582 | Ga0501068_0402204 | 3300049584 | Unclassified | 883 |
| 583 | Ga0501069_0015264 | 3300049585 | Bacteria | 4116 |
| 584 | Ga0501069_0277094 | 3300049585 | Bacteria | 981 |
| 585 | Ga0501069_0435482 | 3300049585 | Unclassified | 778 |
| 586 | Ga0501070_0011535 | 3300049586 | Bacteria | 7459 |
| 587 | Ga0501070_0237902 | 3300049586 | Unclassified | 1491 |
| 588 | Ga0501070_0563216 | 3300049586 | Unclassified | 911 |
| 589 | Ga0501070_0693657 | 3300049586 | Unclassified | 806 |
| 590 | Ga0501071_0024012 | 3300049587 | Bacteria | 4261 |
| 591 | Ga0501071_0028286 | 3300049587 | Bacteria | 3950 |
| 592 | Ga0501071_0030750 | 3300049587 | Bacteria | 3799 |
| 593 | Ga0501071_0032462 | 3300049587 | Bacteria | 3707 |
| 594 | Ga0501071_0051534 | 3300049587 | Unclassified | 2966 |
| 595 | Ga0501071_0123912 | 3300049587 | Unclassified | 1917 |
| 596 | Ga0501071_0427494 | 3300049587 | Unclassified | 1012 |
| 597 | Ga0501071_0480579 | 3300049587 | Unclassified | 952 |
| 598 | Ga0501071_0891225 | 3300049587 | Bacteria | 686 |
| 599 | Ga0501071_1455174 | 3300049587 | Bacteria | 529 |
| 600 | Ga0501071_1541371 | 3300049587 | Unclassified | 513 |
| 601 | Ga0501072_0001664 | 3300049588 | Bacteria | 16566 |
| 602 | Ga0501072_0008858 | 3300049588 | Bacteria | 7644 |
| 603 | Ga0501072_0034022 | 3300049588 | Bacteria | 3992 |
| 604 | Ga0501072_0081475 | 3300049588 | Unclassified | 2565 |
| 605 | Ga0501072_0143345 | 3300049588 | Bacteria | 1905 |
| 606 | Ga0501072_0262692 | 3300049588 | Bacteria | 1374 |
| 607 | Ga0501073_0021050 | 3300049589 | Bacteria | 4705 |
| 608 | Ga0501073_0174971 | 3300049589 | Bacteria | 1485 |
| 609 | Ga0501073_0299793 | 3300049589 | Unclassified | 1109 |
| 610 | Ga0501073_1009900 | 3300049589 | Bacteria | 572 |
| 611 | Ga0501074_0003913 | 3300049590 | Bacteria | 10610 |
| 612 | Ga0501074_0123611 | 3300049590 | Bacteria | 1851 |
| 613 | Ga0501074_0130081 | 3300049590 | Bacteria | 1801 |
| 614 | Ga0501074_0247227 | 3300049590 | Unclassified | 1268 |
| 615 | Ga0501074_0312628 | 3300049590 | Unclassified | 1116 |
| 616 | Ga0501074_0507218 | 3300049590 | Bacteria | 854 |
| 617 | Ga0501075_0004911 | 3300049591 | Bacteria | 9115 |
| 618 | Ga0501075_0005472 | 3300049591 | Bacteria | 8684 |
| 619 | Ga0501075_0010519 | 3300049591 | Bacteria | 6503 |
| 620 | Ga0501075_0013739 | 3300049591 | Bacteria | 5786 |
| 621 | Ga0501075_0023869 | 3300049591 | Bacteria | 4478 |
| 622 | Ga0501075_0028608 | 3300049591 | Bacteria | 4114 |
| 623 | Ga0501075_0129746 | 3300049591 | Bacteria | 1920 |
| 624 | Ga0501075_0291224 | 3300049591 | Bacteria | 1244 |
| 625 | Ga0501075_0628616 | 3300049591 | Bacteria | 819 |
| 626 | Ga0501075_0661154 | 3300049591 | Unclassified | 796 |
| 627 | Ga0501075_1079888 | 3300049591 | Unclassified | 609 |
| 628 | Ga0501076_0004368 | 3300049592 | Bacteria | 10039 |
| 629 | Ga0501076_0006758 | 3300049592 | Bacteria | 8325 |
| 630 | Ga0501076_0027428 | 3300049592 | Bacteria | 4417 |
| 631 | Ga0501076_0050210 | 3300049592 | Bacteria | 3300 |
| 632 | Ga0501076_0053557 | 3300049592 | Bacteria | 3198 |
| 633 | Ga0501076_0109416 | 3300049592 | Bacteria | 2233 |
| 634 | Ga0501076_0180991 | 3300049592 | Unclassified | 1718 |
| 635 | Ga0501076_0223139 | 3300049592 | Unclassified | 1540 |
| 636 | Ga0501076_0364300 | 3300049592 | Bacteria | 1187 |
| 637 | Ga0501076_0734614 | 3300049592 | Bacteria | 815 |
| 638 | Ga0501076_1464891 | 3300049592 | Bacteria | 561 |
| 639 | Ga0501077_0006742 | 3300049593 | Bacteria | 7067 |
| 640 | Ga0501077_0061890 | 3300049593 | Bacteria | 2375 |
| 641 | Ga0501077_0104986 | 3300049593 | Bacteria | 1790 |
| 642 | Ga0501077_0118041 | 3300049593 | Unclassified | 1681 |
| 643 | Ga0501077_0175408 | 3300049593 | Bacteria | 1362 |
| 644 | Ga0501077_0210537 | 3300049593 | Bacteria | 1235 |
| 645 | Ga0501077_0241273 | 3300049593 | Unclassified | 1149 |
| 646 | Ga0501079_0002556 | 3300049741 | Bacteria | 13215 |
| 647 | Ga0501079_0021490 | 3300049741 | Unclassified | 4936 |
| 648 | Ga0501079_0029382 | 3300049741 | Bacteria | 4220 |
| 649 | Ga0501079_0029782 | 3300049741 | Bacteria | 4192 |
| 650 | Ga0501079_0347759 | 3300049741 | Bacteria | 1161 |
| 651 | Ga0501079_0360157 | 3300049741 | Bacteria | 1140 |
| 652 | Ga0501080_0049582 | 3300049742 | Bacteria | 3907 |
| 653 | Ga0501080_0147768 | 3300049742 | Bacteria | 2173 |
| 654 | Ga0501080_0570181 | 3300049742 | Bacteria | 1007 |
| 655 | Ga0501080_0946248 | 3300049742 | Bacteria | 749 |
| 656 | Ga0501081_0019175 | 3300049743 | Bacteria | 4550 |
| 657 | Ga0501081_0023814 | 3300049743 | Bacteria | 4106 |
| 658 | Ga0501081_0199049 | 3300049743 | Unclassified | 1452 |
| 659 | Ga0501081_0209870 | 3300049743 | Bacteria | 1414 |
| 660 | Ga0501081_0584583 | 3300049743 | Bacteria | 835 |
| 661 | Ga0501083_0079371 | 3300049744 | Bacteria | 2176 |
| 662 | Ga0501083_0265000 | 3300049744 | Unclassified | 1118 |
| 663 | Ga0501035_0004781 | 3300049822 | Bacteria | 12857 |
| 664 | Ga0501035_0245061 | 3300049822 | Unclassified | 1523 |
| 665 | Ga0501035_0304902 | 3300049822 | Unclassified | 1341 |
| 666 | Ga0501035_0315184 | 3300049822 | Unclassified | 1315 |
| 667 | Ga0501035_0828632 | 3300049822 | Bacteria | 737 |
| 668 | Ga0501044_0082868 | 3300049823 | Bacteria | 3244 |
| 669 | Ga0501044_0540163 | 3300049823 | Unclassified | 1064 |
| 670 | Ga0501045_0009720 | 3300049824 | Bacteria | 6730 |
| 671 | Ga0501045_0011698 | 3300049824 | Bacteria | 6164 |
| 672 | Ga0501045_0019962 | 3300049824 | Bacteria | 4783 |
| 673 | Ga0501045_0064804 | 3300049824 | Archaea | 2682 |
| 674 | Ga0501045_0164392 | 3300049824 | Bacteria | 1652 |
| 675 | Ga0501045_0580726 | 3300049824 | Bacteria | 830 |
| 676 | Ga0501045_0812509 | 3300049824 | Unclassified | 688 |
| 677 | Ga0501045_0947341 | 3300049824 | Unclassified | 632 |
| 678 | nmdc:mga05p37_1968_c1 | 3300050507 | Bacteria | 23961 |
| 679 | nmdc:mga09592_164275_c1 | 3300050508 | Bacteria | 1918 |
| 680 | nmdc:mga08y16_37726_c1 | 3300050511 | Bacteria | 5072 |
| 681 | nmdc:mga0n895_1685305_c1 | 3300050512 | Unclassified | 597 |
| 682 | nmdc:mga0rr50_362877_c1 | 3300050513 | Unclassified | 1219 |
| 683 | nmdc:mga0a205_120463_c1 | 3300050515 | Bacteria | 2523 |
| 684 | nmdc:mga0a205_735275_c1 | 3300050515 | Unclassified | 836 |
| 685 | Ga0495601_0235843 | 3300053077 | Bacteria | 1195 |
| 686 | Ga0495601_0968539 | 3300053077 | Unclassified | 536 |
| 687 | Ga0495595_0104603 | 3300053084 | Bacteria | 1368 |
| 688 | Ga0495619_0109424 | 3300053085 | Bacteria | 1887 |
| 689 | Ga0500566_0339784 | 3300053094 | Bacteria | 692 |
| 690 | Ga0501084_0010698 | 3300054114 | Bacteria | 7593 |
| 691 | Ga0501084_0014654 | 3300054114 | Bacteria | 6499 |
| 692 | Ga0501084_0048616 | 3300054114 | Bacteria | 3550 |
| 693 | Ga0501084_0073678 | 3300054114 | Unclassified | 2859 |
| 694 | Ga0501084_0090222 | 3300054114 | Bacteria | 2573 |
| 695 | Ga0501084_0230299 | 3300054114 | Unclassified | 1564 |
| 696 | Ga0501084_0405889 | 3300054114 | Unclassified | 1151 |
| 697 | Ga0501084_0458476 | 3300054114 | Bacteria | 1078 |
| 698 | Ga0501084_0711094 | 3300054114 | Bacteria | 847 |
| 699 | Ga0501084_1400288 | 3300054114 | Bacteria | 586 |
| 700 | Ga0501082_0057220 | 3300060353 | Bacteria | 3359 |
| 701 | Ga0501082_0062393 | 3300060353 | Bacteria | 3208 |
| 702 | Ga0501082_0076013 | 3300060353 | Bacteria | 2894 |
| 703 | Ga0501082_0091952 | 3300060353 | Unclassified | 2620 |
| 704 | Ga0501082_0106552 | 3300060353 | Bacteria | 2425 |
| 705 | Ga0501082_0144403 | 3300060353 | Bacteria | 2065 |
| 706 | Ga0501082_0468188 | 3300060353 | Bacteria | 1101 |
| 707 | Ga0501082_0518104 | 3300060353 | Unclassified | 1042 |
| 708 | Ga0530510_0003811 | 3300061734 | Bacteria | 10392 |
| 709 | Ga0530510_0031510 | 3300061734 | Unclassified | 3812 |
| 710 | Ga0530510_0037843 | 3300061734 | Bacteria | 3480 |
| 711 | Ga0530510_0042054 | 3300061734 | Bacteria | 3301 |
| 712 | Ga0530510_0056080 | 3300061734 | Bacteria | 2846 |
| 713 | Ga0530510_0057603 | 3300061734 | Bacteria | 2808 |
| 714 | Ga0530510_0104721 | 3300061734 | Unclassified | 2070 |
| 715 | Ga0530510_0368160 | 3300061734 | Bacteria | 1081 |
| 716 | Ga0530510_0767923 | 3300061734 | Bacteria | 735 |
| 717 | Ga0530510_0916391 | 3300061734 | Unclassified | 670 |
| 718 | Ga0207683_10989719 | |||
| 719 | JGI24747J21853_1025621 | |||
| 720 | JGI24751J29686_10000350 | |||
| 721 | Ga0065715_10192854 | |||
| 722 | Ga0065707_10814445 | |||
| 723 | Ga0070683_100469364 | |||
| 724 | Ga0070683_101667168 | |||
| 725 | Ga0070690_100186865 | |||
| 726 | Ga0070670_100003123 | |||
| 727 | Ga0070670_101524270 | |||
| 728 | Ga0070670_101876495 | |||
| 729 | Ga0068869_100375491 | |||
| 730 | Ga0068869_100552825 | |||
| 731 | Ga0070666_10181643 | |||
| 732 | Ga0070666_10197160 | |||
| 733 | Ga0070682_100647678 | |||
| 734 | Ga0068868_100421540 | |||
| 735 | Ga0070692_10134084 | |||
| 736 | Ga0070692_10191381 | |||
| 737 | Ga0070674_100040870 | |||
| 738 | Ga0070674_100102902 | |||
| 739 | Ga0070674_100110206 | |||
| 740 | Ga0070673_100669731 | |||
| 741 | Ga0070688_100438699 | |||
| 742 | Ga0070688_100449897 | |||
| 743 | Ga0070688_100797411 | |||
| 744 | Ga0070659_101096353 | |||
| 745 | Ga0070667_102333133 | |||
| 746 | Ga0070714_100287512 | |||
| 747 | Ga0070711_101246389 | |||
| 748 | Ga0070705_100278846 | |||
| 749 | Ga0070700_100191082 | |||
| 750 | Ga0070694_101302694 | |||
| 751 | Ga0070708_100400820 | |||
| 752 | Ga0070708_101379779 | |||
| 753 | Ga0070678_100107743 | |||
| 754 | Ga0070678_100428206 | |||
| 755 | Ga0070678_100552980 | |||
| 756 | Ga0070681_10091928 | |||
| 757 | Ga0068867_100087308 | |||
| 758 | Ga0068867_100672155 | |||
| 759 | Ga0070685_10123209 | |||
| 760 | Ga0070706_100000215 | |||
| 761 | Ga0070706_100474005 | |||
| 762 | Ga0070706_101803360 | |||
| 763 | Ga0070698_100212429 | |||
| 764 | Ga0070699_100452815 | |||
| 765 | Ga0070699_101034931 | |||
| 766 | Ga0070679_101208054 | |||
| 767 | Ga0070684_100303282 | |||
| 768 | Ga0070697_100343617 | |||
| 769 | Ga0070672_100386463 | |||
| 770 | Ga0070686_100010945 | |||
| 771 | Ga0070686_100108291 | |||
| 772 | Ga0070686_101404075 | |||
| 773 | Ga0070695_100132537 | |||
| 774 | Ga0070696_100483718 | |||
| 775 | Ga0070693_100229336 | |||
| 776 | Ga0070693_101192908 | |||
| 777 | Ga0070665_101811676 | |||
| 778 | Ga0070704_100003389 | |||
| 779 | Ga0070664_100353324 | |||
| 780 | Ga0070664_101014800 | |||
| 781 | Ga0068857_100038556 | |||
| 782 | Ga0068857_100559076 | |||
| 783 | Ga0068856_100241135 | |||
| 784 | Ga0070702_100033848 | |||
| 785 | Ga0070702_101498663 | |||
| 786 | Ga0068859_100564913 | |||
| 787 | Ga0068864_100035416 | |||
| 788 | Ga0068864_100200705 | |||
| 789 | Ga0068864_100367286 | |||
| 790 | Ga0068864_101023864 | |||
| 791 | Ga0068864_101603265 | |||
| 792 | Ga0068864_101629541 | |||
| 793 | Ga0068864_101642889 | |||
| 794 | Ga0068866_10495546 | |||
| 795 | Ga0068861_101823545 | |||
| 796 | Ga0068870_10001954 | |||
| 797 | Ga0068870_10189070 | |||
| 798 | Ga0068863_100156394 | |||
| 799 | Ga0068863_101736765 | |||
| 800 | Ga0068863_102092625 | |||
| 801 | Ga0068858_100262471 | |||
| 802 | Ga0068860_100527866 | |||
| 803 | Ga0068862_101291456 | |||
| 804 | Ga0081455_10001266 | |||
| 805 | Ga0081455_10194303 | |||
| 806 | Ga0081455_10659939 | |||
| 807 | Ga0070712_100557422 | |||
| 808 | Ga0070712_101486076 | |||
| 809 | Ga0097621_100893756 | |||
| 810 | Ga0068871_100964436 | |||
| 811 | Ga0068871_101184083 | |||
| 812 | Ga0068871_102256335 | |||
| 813 | Ga0075428_100001182 | |||
| 814 | Ga0075433_10037944 | |||
| 815 | Ga0075433_10084021 | |||
| 816 | Ga0075433_10107013 | |||
| 817 | Ga0075429_100168680 | |||
| 818 | Ga0068865_100570263 | |||
| 819 | Ga0068865_101614208 | |||
| 820 | Ga0097620_100564869 | |||
| 821 | Ga0075435_100263803 | |||
| 822 | Ga0111539_10015824 | |||
| 823 | Ga0105247_10073191 | |||
| 824 | Ga0114129_10000286 | |||
| 825 | Ga0105243_10016596 | |||
| 826 | Ga0105243_10022853 | |||
| 827 | Ga0105243_12771164 | |||
| 828 | Ga0105242_10953670 | |||
| 829 | Ga0105248_10683947 | |||
| 830 | Ga0105248_10959913 | |||
| 831 | Ga0105248_10960026 | |||
| 832 | Ga0105248_12105800 | |||
| 833 | Ga0105237_12510795 | |||
| 834 | Ga0105249_10445468 | |||
| 835 | Ga0105249_12572774 | |||
| 836 | Ga0105239_10994616 | |||
| 837 | Ga0105239_13251455 | |||
| 838 | Ga0105239_13535239 | |||
| 839 | Ga0105246_10027632 | |||
| 840 | Ga0105246_10384491 | |||
| 841 | Ga0105246_11282308 | |||
| 842 | Ga0105246_12259880 | |||
| 843 | Ga0157373_10416866 | |||
| 844 | Ga0157378_10199257 | |||
| 845 | Ga0157378_11810253 | |||
| 846 | Ga0163162_10361457 | |||
| 847 | Ga0163162_12084751 | |||
| 848 | Ga0163162_12939103 | |||
| 849 | Ga0157375_10015545 | |||
| 850 | Ga0157375_10161444 | |||
| 851 | Ga0157375_11610049 | |||
| 852 | Ga0163163_10001255 | |||
| 853 | Ga0163163_10017578 | |||
| 854 | Ga0163163_10063661 | |||
| 855 | Ga0163163_10391920 | |||
| 856 | Ga0163163_10447307 | |||
| 857 | Ga0163163_12327206 | |||
| 858 | Ga0157380_10190708 | |||
| 859 | Ga0157380_10467636 | |||
| 860 | Ga0157380_10526006 | |||
| 861 | Ga0157380_13034648 | |||
| 862 | Ga0182008_10823366 | |||
| 863 | Ga0157379_10113749 | |||
| 864 | Ga0157379_10241986 | |||
| 865 | Ga0157379_10494831 | |||
| 866 | Ga0157379_10639014 | |||
| 867 | Ga0157376_10252941 | |||
| 868 | Ga0157376_12109889 | |||
| 869 | Ga0163161_11279645 | |||
| 870 | Ga0207642_10751173 | |||
| 871 | Ga0207710_10037066 | |||
| 872 | Ga0207680_10137043 | |||
| 873 | Ga0207680_10837304 | |||
| 874 | Ga0207645_10682629 | |||
| 875 | Ga0207643_10002955 | |||
| 876 | Ga0207643_10176499 | |||
| 877 | Ga0207684_10000013 | |||
| 878 | Ga0207684_10478407 | |||
| 879 | Ga0207654_11360148 | |||
| 880 | Ga0207693_11226767 | |||
| 881 | Ga0207662_10504678 | |||
| 882 | Ga0207649_10841468 | |||
| 883 | Ga0207652_11007646 | |||
| 884 | Ga0207646_11299056 | |||
| 885 | Ga0207650_10000664 | |||
| 886 | Ga0207650_11139622 | |||
| 887 | Ga0207659_10172156 | |||
| 888 | Ga0207687_10136072 | |||
| 889 | Ga0207644_11462866 | |||
| 890 | Ga0207686_10096360 | |||
| 891 | Ga0207709_10762929 | |||
| 892 | Ga0207669_10063804 | |||
| 893 | Ga0207669_10068893 | |||
| 894 | Ga0207691_10270243 | |||
| 895 | Ga0207711_10806226 | |||
| 896 | Ga0207661_10287517 | |||
| 897 | Ga0207661_11385767 | |||
| 898 | Ga0207679_10042742 | |||
| 899 | Ga0207679_12144874 | |||
| 900 | Ga0207651_10600073 | |||
| 901 | Ga0207668_10380030 | |||
| 902 | Ga0207677_11935105 | |||
| 903 | Ga0207703_10739124 | |||
| 904 | Ga0207703_10920049 | |||
| 905 | Ga0207708_10105314 | |||
| 906 | Ga0207708_11050980 | |||
| 907 | Ga0207702_10494125 | |||
| 908 | Ga0207702_12178153 | |||
| 909 | Ga0207641_10106456 | |||
| 910 | Ga0207641_10474697 | |||
| 911 | Ga0207641_11748162 | |||
| 912 | Ga0207648_10016610 | |||
| 913 | Ga0207648_10398406 | |||
| 914 | Ga0207676_10003790 | |||
| 915 | Ga0207676_10148981 | |||
| 916 | Ga0207676_10568828 | |||
| 917 | Ga0207676_10577523 | |||
| 918 | Ga0207676_10857546 | |||
| 919 | Ga0207674_10620044 | |||
| 920 | Ga0207674_10862862 | |||
| 921 | Ga0207675_101905550 | |||
| 922 | Ga0207675_102668108 | |||
| 923 | Ga0207683_10466927 | |||
| 924 | Ga0207683_10495217 | |||
| 925 | Ga0207683_10682072 | |||
| 926 | Ga0207698_10213543 | |||
| 927 | Ga0209969_1025896 | |||
| 928 | Ga0209996_1012640 | |||
| 929 | Ga0209984_1020234 | |||
| 930 | Ga0209968_1003052 | |||
| 931 | Ga0209999_1020279 | |||
| 932 | Ga0209999_1069601 | |||
| 933 | Ga0209982_1004579 | |||
| 934 | Ga0210002_1018874 | |||
| 935 | Ga0209983_1014764 | |||
| 936 | Ga0209983_1111489 | |||
| 937 | Ga0209971_1002642 | |||
| 938 | Ga0209966_1006311 | |||
| 939 | Ga0209998_10007931 | |||
| 940 | Ga0209974_10001443 | |||
| 941 | Ga0207428_10070341 | |||
| 942 | Ga0265326_10024283 | |||
| 943 | Ga0265326_10120116 | |||
| 944 | Ga0265326_10168321 | |||
| 945 | Ga0265319_1019322 | |||
| 946 | Ga0265334_10031261 | |||
| 947 | Ga0265334_10031842 | |||
| 948 | Ga0265334_10035279 | |||
| 949 | Ga0265334_10063716 | |||
| 950 | Ga0265318_10003654 | |||
| 951 | Ga0265318_10011724 | |||
| 952 | Ga0265318_10019556 | |||
| 953 | Ga0265318_10272643 | |||
| 954 | Ga0265323_10024956 | |||
| 955 | Ga0265322_10009410 | |||
| 956 | Ga0265322_10022289 | |||
| 957 | Ga0265336_10066296 | |||
| 958 | Ga0265338_10106050 | |||
| 959 | Ga0265338_10221827 | |||
| 960 | Ga0265324_10026902 | |||
| 961 | Ga0265324_10240691 | |||
| 962 | Ga0265330_10047851 | |||
| 963 | Ga0265330_10169071 | |||
| 964 | Ga0265332_10009447 | |||
| 965 | Ga0265328_10182244 | |||
| 966 | Ga0265328_10358020 | |||
| 967 | Ga0265320_10006513 | |||
| 968 | Ga0265320_10020855 | |||
| 969 | Ga0265320_10169322 | |||
| 970 | Ga0265320_10199449 | |||
| 971 | Ga0265325_10056488 | |||
| 972 | Ga0265325_10081729 | |||
| 973 | Ga0265325_10113822 | |||
| 974 | Ga0265329_10002514 | |||
| 975 | Ga0265329_10005869 | |||
| 976 | Ga0265329_10145894 | |||
| 977 | Ga0265340_10013761 | |||
| 978 | Ga0265339_10055404 | |||
| 979 | Ga0265339_10148297 | |||
| 980 | Ga0265339_10184469 | |||
| 981 | Ga0265339_10274291 | |||
| 982 | Ga0265331_10023966 | |||
| 983 | Ga0265331_10143826 | |||
| 984 | Ga0265316_10069516 | |||
| 985 | Ga0265316_10082574 | |||
| 986 | Ga0265316_10137681 | |||
| 987 | Ga0307408_100250216 | |||
| 988 | Ga0265313_10037237 | |||
| 989 | Ga0265313_10144249 | |||
| 990 | Ga0265313_10304793 | |||
| 991 | Ga0316575_10018399 | |||
| 992 | Ga0265314_10004439 | |||
| 993 | Ga0265314_10021387 | |||
| 994 | Ga0265314_10320668 | |||
| 995 | Ga0265342_10028561 | |||
| 996 | Ga0265342_10046397 | |||
| 997 | Ga0265342_10336471 | |||
| 998 | Ga0265342_10370148 | |||
| 999 | Ga0316576_10007781 | |||
| 1000 | Ga0316576_10040749 | |||
| 1001 | Ga0316576_10057602 | |||
| 1002 | Ga0316576_10122202 | |||
| 1003 | Ga0316576_10293044 | |||
| 1004 | Ga0316576_10530043 | |||
| 1005 | Ga0316576_10886560 | |||
| 1006 | Ga0316578_10037877 | |||
| 1007 | Ga0316578_10330238 | |||
| 1008 | Ga0316578_10668874 | |||
| 1009 | Ga0316578_10850670 | |||
| 1010 | Ga0307405_10144741 | |||
| 1011 | Ga0307405_10317922 | |||
| 1012 | Ga0307413_10235558 | |||
| 1013 | Ga0307410_11284556 | |||
| 1014 | Ga0307406_10098808 | |||
| 1015 | Ga0307407_11184952 | |||
| 1016 | Ga0307412_11687308 | |||
| 1017 | Ga0307412_12107514 | |||
| 1018 | Ga0307409_100322491 | |||
| 1019 | Ga0307416_100009750 | |||
| 1020 | Ga0307416_100318507 | |||
| 1021 | Ga0307414_10439129 | |||
| 1022 | Ga0307411_10116737 | |||
| 1023 | Ga0307411_10350905 | |||
| 1024 | Ga0307415_100049572 | |||
| 1025 | Ga0307415_100194555 | |||
| 1026 | Ga0307415_100562086 | |||
| 1027 | Ga0316583_10005396 | |||
| 1028 | Ga0316583_10104753 | |||
| 1029 | Ga0316580_10043865 | |||
| 1030 | Ga0316593_10006625 | |||
| 1031 | Ga0316593_10007619 | |||
| 1032 | Ga0316593_10029349 | |||
| 1033 | Ga0316593_10035770 | |||
| 1034 | Ga0316593_10130182 | |||
| 1035 | Ga0316593_10161357 | |||
| 1036 | Ga0316592_1002554 | |||
| 1037 | Ga0316592_1003672 | |||
| 1038 | Ga0316592_1074019 | |||
| 1039 | Ga0316592_1075343 | |||
| 1040 | Ga0316586_1012643 | |||
| 1041 | Ga0316586_1019189 | |||
| 1042 | Ga0316586_1030836 | |||
| 1043 | Ga0316586_1063942 | |||
| 1044 | Ga0316588_1006365 | |||
| 1045 | Ga0316587_1081817 | |||
| 1046 | Ga0316596_1005564 | |||
| 1047 | Ga0316596_1016396 | |||
| 1048 | Ga0316596_1052970 | |||
| 1049 | Ga0316596_1055758 | |||
| 1050 | Ga0316596_1064591 | |||
| 1051 | Ga0316596_1082760 | |||
| 1052 | Ga0316596_1100801 | |||
| 1053 | Ga0316596_1146021 | |||
| 1054 | Ga0316596_1157585 | |||
| 1055 | Ga0316596_1186505 | |||
| 1056 | Ga0373948_0054460 | |||
| 1057 | Ga0373934_0441994 | |||
| 1058 | Ga0373951_0127629 | |||
| 1059 | Ga0373923_0330040 | |||
| 1060 | Ga0373939_0250030 | |||
| 1061 | Ga0373943_0037457 | |||
| 1062 | Ga0373943_0049010 | |||
| 1063 | Ga0316574_0076384 | |||
| 1064 | Ga0316574_0102454 | |||
| 1065 | Ga0316574_0108276 | |||
| 1066 | Ga0316574_0114081 | |||
| 1067 | Ga0316574_0200103 | |||
| 1068 | Ga0316574_0281918 | |||
| 1069 | Ga0373935_0543385 | |||
| 1070 | Ga0373947_0043091 | |||
| 1071 | Ga0373947_0132589 | |||
| 1072 | Ga0373947_0277473 | |||
| 1073 | Ga0373937_0233145 | |||
| 1074 | Ga0373937_0998143 | |||
| 1075 | Ga0316582_1274696 | |||
| 1076 | Ga0316584_0018846 | |||
| 1077 | Ga0316584_0283478 | |||
| 1078 | Ga0316584_0356953 | |||
| 1079 | Ga0316584_0638500 | |||
| 1080 | Ga0316584_0984287 | |||
| 1081 | Ga0316584_1078653 | |||
| 1082 | Ga0373925_0346087 | |||
| 1083 | Ga0373925_0817499 | |||
| 1084 | Ga0439453_0029124 | |||
| 1085 | Ga0451800_0713708 | |||
| 1086 | Ga0451835_0118627 | |||
| 1087 | Ga0451855_1635569 | |||
| 1088 | Ga0451853_3340028 | |||
| 1089 | Ga0439443_013293 | |||
| 1090 | Ga0439454_022476 | |||
| 1091 | Ga0439454_104862 | |||
| 1092 | Ga0439463_156678 | |||
| 1093 | Ga0450920_011506 | |||
| 1094 | Ga0450910_018404 | |||
| 1095 | Ga0439458_0098592 | |||
| 1096 | Ga0450908_014990 | |||
| 1097 | Ga0439434_0215532 | |||
| 1098 | Ga0439435_0067058 | |||
| 1099 | Ga0439435_0307087 | |||
| 1100 | Ga0439444_0063515 | |||
| 1101 | Ga0439460_0014414 | |||
| 1102 | Ga0450916_095995 | |||
| 1103 | Ga0451577_0409888 | |||
| 1104 | Ga0439440_0076355 | |||
| 1105 | Ga0439440_0124429 | |||
| 1106 | Ga0453684_0222250 | |||
| 1107 | Ga0451576_0761997 | |||
| 1108 | Ga0495592_0157104 | |||
| 1109 | Ga0495592_0382027 | |||
| 1110 | Ga0495603_0085193 | |||
| 1111 | Ga0495603_0158973 | |||
| 1112 | Ga0495603_0378881 | |||
| 1113 | Ga0495603_0867530 | |||
| 1114 | Ga0495629_0017235 | |||
| 1115 | Ga0495629_0253312 | |||
| 1116 | Ga0495641_0126030 | |||
| 1117 | Ga0495651_0047581 | |||
| 1118 | Ga0495580_0070197 | |||
| 1119 | Ga0495582_0000200 | |||
| 1120 | Ga0495582_0497483 | |||
| 1121 | Ga0495639_0011725 | |||
| 1122 | Ga0495639_0275956 | |||
| 1123 | Ga0495662_0068237 | |||
| 1124 | Ga0495594_0680751 | |||
| 1125 | Ga0495630_0216879 | |||
| 1126 | Ga0495630_0354393 | |||
| 1127 | Ga0495630_1456823 | |||
| 1128 | Ga0495666_0193353 | |||
| 1129 | Ga0495665_0011597 | |||
| 1130 | Ga0495640_0654768 | |||
| 1131 | Ga0495586_0271352 | |||
| 1132 | Ga0495598_0333935 | |||
| 1133 | Ga0495667_0378619 | |||
| 1134 | Ga0495656_0034059 | |||
| 1135 | Ga0495634_0343046 | |||
| 1136 | Ga0495635_0245516 | |||
| 1137 | Ga0495588_0758653 | |||
| 1138 | Ga0495657_0210428 | |||
| 1139 | Ga0495623_0214657 | |||
| 1140 | Ga0495647_0216183 | |||
| 1141 | Ga0495658_0001000 | |||
| 1142 | Ga0495658_0156507 | |||
| 1143 | Ga0495658_0615257 | |||
| 1144 | Ga0495613_0002275 | |||
| 1145 | Ga0495624_0249396 | |||
| 1146 | Ga0495581_0001423 | |||
| 1147 | Ga0495676_0058516 | |||
| 1148 | Ga0495676_0600450 | |||
| 1149 | Ga0495676_0754417 | |||
| 1150 | Ga0495676_0765633 | |||
| 1151 | Ga0495676_0995173 | |||
| 1152 | Ga0495593_0704986 | |||
| 1153 | Ga0495602_0655686 | |||
| 1154 | Ga0495614_0239263 | |||
| 1155 | Ga0496100_0098275 | |||
| 1156 | Ga0496100_0299646 | |||
| 1157 | Ga0496100_0541096 | |||
| 1158 | Ga0496100_1238274 | |||
| 1159 | Ga0496101_0029448 | |||
| 1160 | Ga0496101_0581647 | |||
| 1161 | Ga0496101_0993781 | |||
| 1162 | Ga0496102_0329695 | |||
| 1163 | Ga0496102_0432322 | |||
| 1164 | Ga0496102_1695352 | |||
| 1165 | Ga0496104_0001663 | |||
| 1166 | Ga0496104_0003658 | |||
| 1167 | Ga0496104_0009378 | |||
| 1168 | Ga0496104_0073010 | |||
| 1169 | Ga0496104_1855334 | |||
| 1170 | Ga0496105_0005723 | |||
| 1171 | Ga0496105_0050162 | |||
| 1172 | Ga0496105_0216809 | |||
| 1173 | Ga0496105_0924127 | |||
| 1174 | Ga0496106_0153546 | |||
| 1175 | Ga0496106_0190833 | |||
| 1176 | Ga0496107_0107759 | |||
| 1177 | Ga0496107_0154625 | |||
| 1178 | Ga0496108_0001483 | |||
| 1179 | Ga0496108_0014798 | |||
| 1180 | Ga0496108_0261472 | |||
| 1181 | Ga0496108_0489279 | |||
| 1182 | Ga0496109_0002307 | |||
| 1183 | Ga0496109_0008709 | |||
| 1184 | Ga0496109_0234127 | |||
| 1185 | Ga0496109_0251559 | |||
| 1186 | Ga0496109_1107764 | |||
| 1187 | Ga0496109_1651697 | |||
| 1188 | Ga0496110_0008234 | |||
| 1189 | Ga0496110_0247589 | |||
| 1190 | Ga0496110_1462379 | |||
| 1191 | Ga0496111_0001853 | |||
| 1192 | Ga0496111_0049409 | |||
| 1193 | Ga0496111_0246479 | |||
| 1194 | Ga0496112_0002831 | |||
| 1195 | Ga0496112_0438119 | |||
| 1196 | Ga0496112_0442901 | |||
| 1197 | Ga0496112_0565068 | |||
| 1198 | Ga0496112_1531613 | |||
| 1199 | Ga0496113_0010670 | |||
| 1200 | Ga0496113_0143658 | |||
| 1201 | Ga0496114_0005293 | |||
| 1202 | Ga0496114_0338088 | |||
| 1203 | Ga0496114_1003204 | |||
| 1204 | Ga0501306_086203 | |||
| 1205 | Ga0501310_080486 | |||
| 1206 | Ga0501325_012218 | |||
| 1207 | Ga0501031_0002020 | |||
| 1208 | Ga0501031_0004346 | |||
| 1209 | Ga0501031_0007034 | |||
| 1210 | Ga0501031_0110220 | |||
| 1211 | Ga0501031_0246550 | |||
| 1212 | Ga0501031_0253997 | |||
| 1213 | Ga0501031_1072648 | |||
| 1214 | Ga0501032_0043392 | |||
| 1215 | Ga0501032_0358692 | |||
| 1216 | Ga0501032_0738771 | |||
| 1217 | Ga0501033_0014111 | |||
| 1218 | Ga0501033_0655563 | |||
| 1219 | Ga0501033_0985561 | |||
| 1220 | Ga0501034_0134418 | |||
| 1221 | Ga0501036_0006726 | |||
| 1222 | Ga0501036_0075284 | |||
| 1223 | Ga0501036_0078835 | |||
| 1224 | Ga0501036_0105183 | |||
| 1225 | Ga0501036_0141777 | |||
| 1226 | Ga0501036_0168660 | |||
| 1227 | Ga0501036_0357061 | |||
| 1228 | Ga0501036_0421130 | |||
| 1229 | Ga0501037_0058493 | |||
| 1230 | Ga0501037_0099383 | |||
| 1231 | Ga0501037_0661000 | |||
| 1232 | Ga0501037_0820104 | |||
| 1233 | Ga0501037_0829664 | |||
| 1234 | Ga0501038_0010392 | |||
| 1235 | Ga0501038_0136775 | |||
| 1236 | Ga0501038_0160233 | |||
| 1237 | Ga0501038_0188586 | |||
| 1238 | Ga0501038_0198573 | |||
| 1239 | Ga0501038_0316505 | |||
| 1240 | Ga0501038_0602219 | |||
| 1241 | Ga0501038_1289652 | |||
| 1242 | Ga0501039_0009311 | |||
| 1243 | Ga0501039_0022486 | |||
| 1244 | Ga0501039_0036539 | |||
| 1245 | Ga0501039_0044398 | |||
| 1246 | Ga0501039_0047952 | |||
| 1247 | Ga0501039_0091637 | |||
| 1248 | Ga0501039_0429278 | |||
| 1249 | Ga0501039_0527626 | |||
| 1250 | Ga0501039_0592124 | |||
| 1251 | Ga0501040_0013469 | |||
| 1252 | Ga0501040_0036632 | |||
| 1253 | Ga0501040_0089487 | |||
| 1254 | Ga0501040_0208750 | |||
| 1255 | Ga0501040_0550952 | |||
| 1256 | Ga0501040_0708324 | |||
| 1257 | Ga0501040_1009008 | |||
| 1258 | Ga0501040_1184392 | |||
| 1259 | Ga0501041_0008168 | |||
| 1260 | Ga0501041_0026991 | |||
| 1261 | Ga0501041_0057014 | |||
| 1262 | Ga0501041_0091033 | |||
| 1263 | Ga0501042_0011055 | |||
| 1264 | Ga0501042_0102726 | |||
| 1265 | Ga0501042_0105477 | |||
| 1266 | Ga0501042_0147905 | |||
| 1267 | Ga0501042_0169465 | |||
| 1268 | Ga0501042_0203556 | |||
| 1269 | Ga0501042_0276154 | |||
| 1270 | Ga0501042_0403660 | |||
| 1271 | Ga0501042_1379285 | |||
| 1272 | Ga0501043_0026684 | |||
| 1273 | Ga0501043_0216005 | |||
| 1274 | Ga0501043_0451414 | |||
| 1275 | Ga0501043_0777991 | |||
| 1276 | Ga0501043_1257969 | |||
| 1277 | Ga0501046_0025797 | |||
| 1278 | Ga0501046_0134927 | |||
| 1279 | Ga0501046_0273694 | |||
| 1280 | Ga0501046_0308455 | |||
| 1281 | Ga0501046_0367332 | |||
| 1282 | Ga0501046_0808850 | |||
| 1283 | Ga0501048_0013255 | |||
| 1284 | Ga0501048_0018516 | |||
| 1285 | Ga0501048_0043639 | |||
| 1286 | Ga0501048_0052568 | |||
| 1287 | Ga0501048_0222402 | |||
| 1288 | Ga0501048_0252619 | |||
| 1289 | Ga0501048_0339360 | |||
| 1290 | Ga0501048_0380831 | |||
| 1291 | Ga0501067_0197041 | |||
| 1292 | Ga0501067_0204509 | |||
| 1293 | Ga0501068_0014796 | |||
| 1294 | Ga0501068_0114740 | |||
| 1295 | Ga0501068_0140528 | |||
| 1296 | Ga0501068_0175541 | |||
| 1297 | Ga0501068_0182296 | |||
| 1298 | Ga0501068_0307167 | |||
| 1299 | Ga0501068_0402204 | |||
| 1300 | Ga0501069_0015264 | |||
| 1301 | Ga0501069_0277094 | |||
| 1302 | Ga0501069_0435482 | |||
| 1303 | Ga0501070_0011535 | |||
| 1304 | Ga0501070_0237902 | |||
| 1305 | Ga0501070_0563216 | |||
| 1306 | Ga0501070_0693657 | |||
| 1307 | Ga0501071_0024012 | |||
| 1308 | Ga0501071_0028286 | |||
| 1309 | Ga0501071_0030750 | |||
| 1310 | Ga0501071_0032462 | |||
| 1311 | Ga0501071_0051534 | |||
| 1312 | Ga0501071_0123912 | |||
| 1313 | Ga0501071_0427494 | |||
| 1314 | Ga0501071_0480579 | |||
| 1315 | Ga0501071_0891225 | |||
| 1316 | Ga0501071_1455174 | |||
| 1317 | Ga0501071_1541371 | |||
| 1318 | Ga0501072_0001664 | |||
| 1319 | Ga0501072_0008858 | |||
| 1320 | Ga0501072_0034022 | |||
| 1321 | Ga0501072_0081475 | |||
| 1322 | Ga0501072_0143345 | |||
| 1323 | Ga0501072_0262692 | |||
| 1324 | Ga0501073_0021050 | |||
| 1325 | Ga0501073_0174971 | |||
| 1326 | Ga0501073_0299793 | |||
| 1327 | Ga0501073_1009900 | |||
| 1328 | Ga0501074_0003913 | |||
| 1329 | Ga0501074_0123611 | |||
| 1330 | Ga0501074_0130081 | |||
| 1331 | Ga0501074_0247227 | |||
| 1332 | Ga0501074_0312628 | |||
| 1333 | Ga0501074_0507218 | |||
| 1334 | Ga0501075_0004911 | |||
| 1335 | Ga0501075_0005472 | |||
| 1336 | Ga0501075_0010519 | |||
| 1337 | Ga0501075_0013739 | |||
| 1338 | Ga0501075_0023869 | |||
| 1339 | Ga0501075_0028608 | |||
| 1340 | Ga0501075_0129746 | |||
| 1341 | Ga0501075_0291224 | |||
| 1342 | Ga0501075_0628616 | |||
| 1343 | Ga0501075_0661154 | |||
| 1344 | Ga0501075_1079888 | |||
| 1345 | Ga0501076_0004368 | |||
| 1346 | Ga0501076_0006758 | |||
| 1347 | Ga0501076_0027428 | |||
| 1348 | Ga0501076_0050210 | |||
| 1349 | Ga0501076_0053557 | |||
| 1350 | Ga0501076_0109416 | |||
| 1351 | Ga0501076_0180991 | |||
| 1352 | Ga0501076_0223139 | |||
| 1353 | Ga0501076_0364300 | |||
| 1354 | Ga0501076_0734614 | |||
| 1355 | Ga0501076_1464891 | |||
| 1356 | Ga0501077_0006742 | |||
| 1357 | Ga0501077_0061890 | |||
| 1358 | Ga0501077_0104986 | |||
| 1359 | Ga0501077_0118041 | |||
| 1360 | Ga0501077_0175408 | |||
| 1361 | Ga0501077_0210537 | |||
| 1362 | Ga0501077_0241273 | |||
| 1363 | Ga0501079_0002556 | |||
| 1364 | Ga0501079_0021490 | |||
| 1365 | Ga0501079_0029382 | |||
| 1366 | Ga0501079_0029782 | |||
| 1367 | Ga0501079_0347759 | |||
| 1368 | Ga0501079_0360157 | |||
| 1369 | Ga0501080_0049582 | |||
| 1370 | Ga0501080_0147768 | |||
| 1371 | Ga0501080_0570181 | |||
| 1372 | Ga0501080_0946248 | |||
| 1373 | Ga0501081_0019175 | |||
| 1374 | Ga0501081_0023814 | |||
| 1375 | Ga0501081_0199049 | |||
| 1376 | Ga0501081_0209870 | |||
| 1377 | Ga0501081_0584583 | |||
| 1378 | Ga0501083_0079371 | |||
| 1379 | Ga0501083_0265000 | |||
| 1380 | Ga0501035_0004781 | |||
| 1381 | Ga0501035_0245061 | |||
| 1382 | Ga0501035_0304902 | |||
| 1383 | Ga0501035_0315184 | |||
| 1384 | Ga0501035_0828632 | |||
| 1385 | Ga0501044_0082868 | |||
| 1386 | Ga0501044_0540163 | |||
| 1387 | Ga0501045_0009720 | |||
| 1388 | Ga0501045_0011698 | |||
| 1389 | Ga0501045_0019962 | |||
| 1390 | Ga0501045_0064804 | |||
| 1391 | Ga0501045_0164392 | |||
| 1392 | Ga0501045_0580726 | |||
| 1393 | Ga0501045_0812509 | |||
| 1394 | Ga0501045_0947341 | |||
| 1395 | nmdc:mga05p37_1968_c1 | |||
| 1396 | nmdc:mga09592_164275_c1 | |||
| 1397 | nmdc:mga08y16_37726_c1 | |||
| 1398 | nmdc:mga0n895_1685305_c1 | |||
| 1399 | nmdc:mga0rr50_362877_c1 | |||
| 1400 | nmdc:mga0a205_120463_c1 | |||
| 1401 | nmdc:mga0a205_735275_c1 | |||
| 1402 | Ga0495601_0235843 | |||
| 1403 | Ga0495601_0968539 | |||
| 1404 | Ga0495595_0104603 | |||
| 1405 | Ga0495619_0109424 | |||
| 1406 | Ga0500566_0339784 | |||
| 1407 | Ga0501084_0010698 | |||
| 1408 | Ga0501084_0014654 | |||
| 1409 | Ga0501084_0048616 | |||
| 1410 | Ga0501084_0073678 | |||
| 1411 | Ga0501084_0090222 | |||
| 1412 | Ga0501084_0230299 | |||
| 1413 | Ga0501084_0405889 | |||
| 1414 | Ga0501084_0458476 | |||
| 1415 | Ga0501084_0711094 | |||
| 1416 | Ga0501084_1400288 | |||
| 1417 | Ga0501082_0057220 | |||
| 1418 | Ga0501082_0062393 | |||
| 1419 | Ga0501082_0076013 | |||
| 1420 | Ga0501082_0091952 | |||
| 1421 | Ga0501082_0106552 | |||
| 1422 | Ga0501082_0144403 | |||
| 1423 | Ga0501082_0468188 | |||
| 1424 | Ga0501082_0518104 | |||
| 1425 | Ga0530510_0003811 | |||
| 1426 | Ga0530510_0031510 | |||
| 1427 | Ga0530510_0037843 | |||
| 1428 | Ga0530510_0042054 | |||
| 1429 | Ga0530510_0056080 | |||
| 1430 | Ga0530510_0057603 | |||
| 1431 | Ga0530510_0104721 | |||
| 1432 | Ga0530510_0368160 | |||
| 1433 | Ga0530510_0767923 | |||
| 1434 | Ga0530510_0916391 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hz7-assembly1.cif.gz_A | crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a | 0.9018 | 6 | 75 |
| 3lvk-assembly1.cif.gz_B-2 | crystal structure of e.coli iscs-tusa complex (form 2) | 0.8959 | 1 | 76 |
| 3lvk-assembly1.cif.gz_B-2 | crystal structure of e.coli iscs-tusa complex (form 2) | 0.8848 | 1 | 76 |
| 1dcj-assembly1.cif.gz_A | solution structure of yhhp, a novel escherichia coli protein implicated in the cell division | 0.8802 | 2 | 76 |
| 1dcj-assembly1.cif.gz_A | solution structure of yhhp, a novel escherichia coli protein implicated in the cell division | 0.8499 | 2 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1R7_113_189_3.30.110.40 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain | 0.9762 | 7 | 77 | 3.30.110.40 |
| af_Q2FWL8_3_73_3.30.110.40 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain | 0.9456 | 8 | 76 | 3.30.110.40 |
| af_Q58397_3_75_3.30.110.40 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain | 0.9322 | 4 | 76 | 3.30.110.40 |
| af_Q58397_3_75_3.30.110.40 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain | 0.9203 | 4 | 76 | 3.30.110.40 |
| af_Q58170_72_142_3.30.110.40 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain | 0.9153 | 7 | 75 | 3.30.110.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1L3RVE4-F1-model_v4 | deleted | 1.004 | 7 | 77 |
|
| AF-A0A0S1YA77-F1-model_v4 | UPF0033 domain-containing protein | 1.002 | 8 | 77 |
|
| AF-A0A7Y0E1H7-F1-model_v4 | Sulfurtransferase TusA family protein | 0.9998 | 8 | 77 |
GO:0016740
|
| AF-A0A367XCW3-F1-model_v4 | UPF0033 domain-containing protein | 0.9995 | 8 | 77 |
|
| AF-A0A2E5Z5L4-F1-model_v4 | SirA family protein | 0.9991 | 8 | 76 |
|