F477112

General Info

Members Datasets Scaffolds Average Seq Length
717 305 1434 78

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10989719|Ga0207683_109897191
Length 86
Sequence VVKDISWTMPVVEITQTVDARGLSCPMPIVKTAQAAKGLPSGAVIELLATDAGSIKDVAAWCRSTGNELIDQTSDGAVYHFVIRRK

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
172 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
192 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
193 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
194 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
197 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
198 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
199 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
200 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 4.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 6.97
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 32.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10989719 3300026121 Bacteria 781
2 JGI24747J21853_1025621 3300001978 Bacteria 658
3 JGI24751J29686_10000350 3300002459 Bacteria 16255
4 Ga0065715_10192854 3300005293 Unclassified 1405
5 Ga0065707_10814445 3300005295 Unclassified 594
6 Ga0070683_100469364 3300005329 Unclassified 1201
7 Ga0070683_101667168 3300005329 Unclassified 613
8 Ga0070690_100186865 3300005330 Unclassified 1434
9 Ga0070670_100003123 3300005331 Bacteria 13711
10 Ga0070670_101524270 3300005331 Unclassified 614
11 Ga0070670_101876495 3300005331 Unclassified 552
12 Ga0068869_100375491 3300005334 Bacteria 1164
13 Ga0068869_100552825 3300005334 Bacteria 967
14 Ga0070666_10181643 3300005335 Archaea 1476
15 Ga0070666_10197160 3300005335 Bacteria 1416
16 Ga0070682_100647678 3300005337 Unclassified 841
17 Ga0068868_100421540 3300005338 Archaea 1156
18 Ga0070692_10134084 3300005345 Unclassified 1395
19 Ga0070692_10191381 3300005345 Bacteria 1192
20 Ga0070674_100040870 3300005356 Bacteria 3139
21 Ga0070674_100102902 3300005356 Bacteria 2084
22 Ga0070674_100110206 3300005356 Archaea 2020
23 Ga0070673_100669731 3300005364 Bacteria 951
24 Ga0070688_100438699 3300005365 Bacteria 974
25 Ga0070688_100449897 3300005365 Unclassified 963
26 Ga0070688_100797411 3300005365 Unclassified 738
27 Ga0070659_101096353 3300005366 Unclassified 702
28 Ga0070667_102333133 3300005367 Unclassified 504
29 Ga0070714_100287512 3300005435 Bacteria 1529
30 Ga0070711_101246389 3300005439 Unclassified 644
31 Ga0070705_100278846 3300005440 Unclassified 1187
32 Ga0070700_100191082 3300005441 Bacteria 1432
33 Ga0070694_101302694 3300005444 Unclassified 611
34 Ga0070708_100400820 3300005445 Bacteria 1294
35 Ga0070708_101379779 3300005445 Unclassified 658
36 Ga0070678_100107743 3300005456 Unclassified 2174
37 Ga0070678_100428206 3300005456 Unclassified 1155
38 Ga0070678_100552980 3300005456 Bacteria 1022
39 Ga0070681_10091928 3300005458 Bacteria 2984
40 Ga0068867_100087308 3300005459 Archaea 2361
41 Ga0068867_100672155 3300005459 Bacteria 911
42 Ga0070685_10123209 3300005466 Unclassified 1612
43 Ga0070706_100000215 3300005467 Bacteria 71421
44 Ga0070706_100474005 3300005467 Bacteria 1164
45 Ga0070706_101803360 3300005467 Bacteria 556
46 Ga0070698_100212429 3300005471 Unclassified 1869
47 Ga0070699_100452815 3300005518 Unclassified 1164
48 Ga0070699_101034931 3300005518 Unclassified 753
49 Ga0070679_101208054 3300005530 Unclassified 701
50 Ga0070684_100303282 3300005535 Bacteria 1466
51 Ga0070697_100343617 3300005536 Bacteria 1288
52 Ga0070672_100386463 3300005543 Unclassified 1198
53 Ga0070686_100010945 3300005544 Bacteria 5135
54 Ga0070686_100108291 3300005544 Bacteria 1888
55 Ga0070686_101404075 3300005544 Bacteria 586
56 Ga0070695_100132537 3300005545 Bacteria 1719
57 Ga0070696_100483718 3300005546 Unclassified 982
58 Ga0070693_100229336 3300005547 Archaea 1221
59 Ga0070693_101192908 3300005547 Bacteria 584
60 Ga0070665_101811676 3300005548 Unclassified 617
61 Ga0070704_100003389 3300005549 Bacteria 9134
62 Ga0070664_100353324 3300005564 Unclassified 1337
63 Ga0070664_101014800 3300005564 Bacteria 780
64 Ga0068857_100038556 3300005577 Bacteria 4231
65 Ga0068857_100559076 3300005577 Unclassified 1078
66 Ga0068856_100241135 3300005614 Bacteria 1823
67 Ga0070702_100033848 3300005615 Archaea 2812
68 Ga0070702_101498663 3300005615 Bacteria 555
69 Ga0068859_100564913 3300005617 Bacteria 1232
70 Ga0068864_100035416 3300005618 Bacteria 4249
71 Ga0068864_100200705 3300005618 Unclassified 1832
72 Ga0068864_100367286 3300005618 Bacteria 1361
73 Ga0068864_101023864 3300005618 Bacteria 820
74 Ga0068864_101603265 3300005618 Unclassified 655
75 Ga0068864_101629541 3300005618 Bacteria 649
76 Ga0068864_101642889 3300005618 Bacteria 647
77 Ga0068866_10495546 3300005718 Unclassified 807
78 Ga0068861_101823545 3300005719 Bacteria 604
79 Ga0068870_10001954 3300005840 Bacteria 8521
80 Ga0068870_10189070 3300005840 Unclassified 1241
81 Ga0068863_100156394 3300005841 Bacteria 2183
82 Ga0068863_101736765 3300005841 Bacteria 634
83 Ga0068863_102092625 3300005841 Unclassified 576
84 Ga0068858_100262471 3300005842 Unclassified 1642
85 Ga0068860_100527866 3300005843 Bacteria 1181
86 Ga0068862_101291456 3300005844 Unclassified 731
87 Ga0081455_10001266 3300005937 Bacteria 31572
88 Ga0081455_10194303 3300005937 Bacteria 1525
89 Ga0081455_10659939 3300005937 Unclassified 672
90 Ga0070712_100557422 3300006175 Bacteria 966
91 Ga0070712_101486076 3300006175 Unclassified 592
92 Ga0097621_100893756 3300006237 Bacteria 827
93 Ga0068871_100964436 3300006358 Unclassified 793
94 Ga0068871_101184083 3300006358 Bacteria 716
95 Ga0068871_102256335 3300006358 Bacteria 519
96 Ga0075428_100001182 3300006844 Bacteria 27941
97 Ga0075433_10037944 3300006852 Bacteria 4159
98 Ga0075433_10084021 3300006852 Bacteria 2810
99 Ga0075433_10107013 3300006852 Bacteria 2479
100 Ga0075429_100168680 3300006880 Bacteria 1917
101 Ga0068865_100570263 3300006881 Bacteria 953
102 Ga0068865_101614208 3300006881 Bacteria 583
103 Ga0097620_100564869 3300006931 Bacteria 1232
104 Ga0075435_100263803 3300007076 Archaea 1468
105 Ga0111539_10015824 3300009094 Bacteria 9369
106 Ga0105247_10073191 3300009101 Bacteria 2147
107 Ga0114129_10000286 3300009147 Bacteria 58249
108 Ga0105243_10016596 3300009148 Bacteria 5568
109 Ga0105243_10022853 3300009148 Archaea 4754
110 Ga0105243_12771164 3300009148 Unclassified 531
111 Ga0105242_10953670 3300009176 Unclassified 862
112 Ga0105248_10683947 3300009177 Bacteria 1157
113 Ga0105248_10959913 3300009177 Bacteria 965
114 Ga0105248_10960026 3300009177 Bacteria 965
115 Ga0105248_12105800 3300009177 Bacteria 641
116 Ga0105237_12510795 3300009545 Unclassified 526
117 Ga0105249_10445468 3300009553 Unclassified 1333
118 Ga0105249_12572774 3300009553 Unclassified 581
119 Ga0105239_10994616 3300010375 Bacteria 964
120 Ga0105239_13251455 3300010375 Unclassified 529
121 Ga0105239_13535239 3300010375 Bacteria 508
122 Ga0105246_10027632 3300011119 Unclassified 3720
123 Ga0105246_10384491 3300011119 Bacteria 1161
124 Ga0105246_11282308 3300011119 Unclassified 678
125 Ga0105246_12259880 3300011119 Unclassified 530
126 Ga0157373_10416866 3300013100 Bacteria 964
127 Ga0157378_10199257 3300013297 Bacteria 1893
128 Ga0157378_11810253 3300013297 Unclassified 659
129 Ga0163162_10361457 3300013306 Bacteria 1585
130 Ga0163162_12084751 3300013306 Unclassified 650
131 Ga0163162_12939103 3300013306 Unclassified 548
132 Ga0157375_10015545 3300013308 Bacteria 6816
133 Ga0157375_10161444 3300013308 Bacteria 2383
134 Ga0157375_11610049 3300013308 Bacteria 768
135 Ga0163163_10001255 3300014325 Bacteria 21393
136 Ga0163163_10017578 3300014325 Bacteria 6673
137 Ga0163163_10063661 3300014325 Bacteria 3658
138 Ga0163163_10391920 3300014325 Bacteria 1447
139 Ga0163163_10447307 3300014325 Bacteria 1352
140 Ga0163163_12327206 3300014325 Unclassified 594
141 Ga0157380_10190708 3300014326 Unclassified 1809
142 Ga0157380_10467636 3300014326 Bacteria 1216
143 Ga0157380_10526006 3300014326 Bacteria 1155
144 Ga0157380_13034648 3300014326 Unclassified 535
145 Ga0182008_10823366 3300014497 Bacteria 540
146 Ga0157379_10113749 3300014968 Bacteria 2432
147 Ga0157379_10241986 3300014968 Unclassified 1637
148 Ga0157379_10494831 3300014968 Bacteria 1133
149 Ga0157379_10639014 3300014968 Bacteria 996
150 Ga0157376_10252941 3300014969 Bacteria 1646
151 Ga0157376_12109889 3300014969 Bacteria 602
152 Ga0163161_11279645 3300017792 Unclassified 637
153 Ga0207642_10751173 3300025899 Unclassified 617
154 Ga0207710_10037066 3300025900 Bacteria 2152
155 Ga0207680_10137043 3300025903 Bacteria 1619
156 Ga0207680_10837304 3300025903 Unclassified 659
157 Ga0207645_10682629 3300025907 Unclassified 698
158 Ga0207643_10002955 3300025908 Bacteria 9172
159 Ga0207643_10176499 3300025908 Unclassified 1291
160 Ga0207684_10000013 3300025910 Bacteria 443468
161 Ga0207684_10478407 3300025910 Bacteria 1068
162 Ga0207654_11360148 3300025911 Unclassified 518
163 Ga0207693_11226767 3300025915 Bacteria 564
164 Ga0207662_10504678 3300025918 Unclassified 833
165 Ga0207649_10841468 3300025920 Unclassified 718
166 Ga0207652_11007646 3300025921 Unclassified 732
167 Ga0207646_11299056 3300025922 Unclassified 635
168 Ga0207650_10000664 3300025925 Bacteria 27105
169 Ga0207650_11139622 3300025925 Unclassified 664
170 Ga0207659_10172156 3300025926 Unclassified 1709
171 Ga0207687_10136072 3300025927 Bacteria 1858
172 Ga0207644_11462866 3300025931 Bacteria 574
173 Ga0207686_10096360 3300025934 Bacteria 1966
174 Ga0207709_10762929 3300025935 Bacteria 778
175 Ga0207669_10063804 3300025937 Archaea 2276
176 Ga0207669_10068893 3300025937 Bacteria 2212
177 Ga0207691_10270243 3300025940 Archaea 1464
178 Ga0207711_10806226 3300025941 Bacteria 874
179 Ga0207661_10287517 3300025944 Unclassified 1471
180 Ga0207661_11385767 3300025944 Unclassified 645
181 Ga0207679_10042742 3300025945 Bacteria 3259
182 Ga0207679_12144874 3300025945 Unclassified 507
183 Ga0207651_10600073 3300025960 Bacteria 962
184 Ga0207668_10380030 3300025972 Bacteria 1189
185 Ga0207677_11935105 3300026023 Unclassified 548
186 Ga0207703_10739124 3300026035 Bacteria 937
187 Ga0207703_10920049 3300026035 Bacteria 838
188 Ga0207708_10105314 3300026075 Unclassified 2186
189 Ga0207708_11050980 3300026075 Bacteria 709
190 Ga0207702_10494125 3300026078 Unclassified 1192
191 Ga0207702_12178153 3300026078 Unclassified 543
192 Ga0207641_10106456 3300026088 Bacteria 2479
193 Ga0207641_10474697 3300026088 Unclassified 1212
194 Ga0207641_11748162 3300026088 Bacteria 624
195 Ga0207648_10016610 3300026089 Bacteria 6719
196 Ga0207648_10398406 3300026089 Bacteria 1247
197 Ga0207676_10003790 3300026095 Bacteria 10691
198 Ga0207676_10148981 3300026095 Bacteria 2013
199 Ga0207676_10568828 3300026095 Bacteria 1085
200 Ga0207676_10577523 3300026095 Bacteria 1077
201 Ga0207676_10857546 3300026095 Unclassified 889
202 Ga0207674_10620044 3300026116 Unclassified 1045
203 Ga0207674_10862862 3300026116 Bacteria 873
204 Ga0207675_101905550 3300026118 Unclassified 613
205 Ga0207675_102668108 3300026118 Unclassified 508
206 Ga0207683_10466927 3300026121 Bacteria 1164
207 Ga0207683_10495217 3300026121 Unclassified 1128
208 Ga0207683_10682072 3300026121 Bacteria 952
209 Ga0207698_10213543 3300026142 Unclassified 1738
210 Ga0209969_1025896 3300027360 Bacteria 885
211 Ga0209996_1012640 3300027395 Bacteria 1135
212 Ga0209984_1020234 3300027424 Unclassified 909
213 Ga0209968_1003052 3300027526 Unclassified 2513
214 Ga0209999_1020279 3300027543 Bacteria 1221
215 Ga0209999_1069601 3300027543 Bacteria 674
216 Ga0209982_1004579 3300027552 Bacteria 1983
217 Ga0210002_1018874 3300027617 Bacteria 1104
218 Ga0209983_1014764 3300027665 Bacteria 1610
219 Ga0209983_1111489 3300027665 Unclassified 622
220 Ga0209971_1002642 3300027682 Bacteria 4291
221 Ga0209966_1006311 3300027695 Bacteria 2056
222 Ga0209998_10007931 3300027717 Bacteria 2203
223 Ga0209974_10001443 3300027876 Bacteria 8618
224 Ga0207428_10070341 3300027907 Bacteria 2750
225 Ga0265326_10024283 3300028558 Unclassified 1730
226 Ga0265326_10120116 3300028558 Bacteria 747
227 Ga0265326_10168321 3300028558 Unclassified 627
228 Ga0265319_1019322 3300028563 Bacteria 2545
229 Ga0265334_10031261 3300028573 Unclassified 2128
230 Ga0265334_10031842 3300028573 Bacteria 2106
231 Ga0265334_10035279 3300028573 Unclassified 1981
232 Ga0265334_10063716 3300028573 Unclassified 1385
233 Ga0265318_10003654 3300028577 Bacteria 7680
234 Ga0265318_10011724 3300028577 Bacteria 3759
235 Ga0265318_10019556 3300028577 Bacteria 2745
236 Ga0265318_10272643 3300028577 Unclassified 617
237 Ga0265323_10024956 3300028653 Bacteria 2269
238 Ga0265322_10009410 3300028654 Bacteria 2837
239 Ga0265322_10022289 3300028654 Bacteria 1812
240 Ga0265336_10066296 3300028666 Unclassified 1080
241 Ga0265338_10106050 3300028800 Bacteria 2276
242 Ga0265338_10221827 3300028800 Unclassified 1412
243 Ga0265324_10026902 3300029957 Bacteria 2034
244 Ga0265324_10240691 3300029957 Unclassified 614
245 Ga0265330_10047851 3300031235 Bacteria 1881
246 Ga0265330_10169071 3300031235 Unclassified 927
247 Ga0265332_10009447 3300031238 Bacteria 4354
248 Ga0265328_10182244 3300031239 Unclassified 794
249 Ga0265328_10358020 3300031239 Unclassified 569
250 Ga0265320_10006513 3300031240 Bacteria 7357
251 Ga0265320_10020855 3300031240 Bacteria 3540
252 Ga0265320_10169322 3300031240 Bacteria 982
253 Ga0265320_10199449 3300031240 Bacteria 894
254 Ga0265325_10056488 3300031241 Bacteria 2005
255 Ga0265325_10081729 3300031241 Bacteria 1605
256 Ga0265325_10113822 3300031241 Unclassified 1312
257 Ga0265329_10002514 3300031242 Bacteria 8278
258 Ga0265329_10005869 3300031242 Bacteria 4922
259 Ga0265329_10145894 3300031242 Unclassified 765
260 Ga0265340_10013761 3300031247 Bacteria 4243
261 Ga0265339_10055404 3300031249 Bacteria 2151
262 Ga0265339_10148297 3300031249 Bacteria 1188
263 Ga0265339_10184469 3300031249 Unclassified 1037
264 Ga0265339_10274291 3300031249 Bacteria 810
265 Ga0265331_10023966 3300031250 Bacteria 3093
266 Ga0265331_10143826 3300031250 Bacteria 1084
267 Ga0265316_10069516 3300031344 Bacteria 2717
268 Ga0265316_10082574 3300031344 Bacteria 2462
269 Ga0265316_10137681 3300031344 Bacteria 1836
270 Ga0307408_100250216 3300031548 Bacteria 1461
271 Ga0265313_10037237 3300031595 Unclassified 2434
272 Ga0265313_10144249 3300031595 Bacteria 1022
273 Ga0265313_10304793 3300031595 Bacteria 639
274 Ga0316575_10018399 3300031665 Bacteria 2663
275 Ga0265314_10004439 3300031711 Bacteria 13024
276 Ga0265314_10021387 3300031711 Bacteria 4974
277 Ga0265314_10320668 3300031711 Bacteria 862
278 Ga0265342_10028561 3300031712 Bacteria 3473
279 Ga0265342_10046397 3300031712 Bacteria 2612
280 Ga0265342_10336471 3300031712 Unclassified 788
281 Ga0265342_10370148 3300031712 Unclassified 744
282 Ga0316576_10007781 3300031727 Bacteria 6771
283 Ga0316576_10040749 3300031727 Bacteria 3339
284 Ga0316576_10057602 3300031727 Bacteria 2840
285 Ga0316576_10122202 3300031727 Unclassified 1956
286 Ga0316576_10293044 3300031727 Bacteria 1217
287 Ga0316576_10530043 3300031727 Bacteria 864
288 Ga0316576_10886560 3300031727 Bacteria 639
289 Ga0316578_10037877 3300031728 Unclassified 2779
290 Ga0316578_10330238 3300031728 Bacteria 909
291 Ga0316578_10668874 3300031728 Unclassified 606
292 Ga0316578_10850670 3300031728 Unclassified 528
293 Ga0307405_10144741 3300031731 Bacteria 1663
294 Ga0307405_10317922 3300031731 Unclassified 1188
295 Ga0307413_10235558 3300031824 Bacteria 1348
296 Ga0307410_11284556 3300031852 Unclassified 640
297 Ga0307406_10098808 3300031901 Unclassified 1983
298 Ga0307407_11184952 3300031903 Unclassified 596
299 Ga0307412_11687308 3300031911 Unclassified 580
300 Ga0307412_12107514 3300031911 Unclassified 524
301 Ga0307409_100322491 3300031995 Bacteria 1446
302 Ga0307416_100009750 3300032002 Bacteria 6309
303 Ga0307416_100318507 3300032002 Bacteria 1556
304 Ga0307414_10439129 3300032004 Bacteria 1142
305 Ga0307411_10116737 3300032005 Bacteria 1922
306 Ga0307411_10350905 3300032005 Bacteria 1203
307 Ga0307415_100049572 3300032126 Unclassified 2840
308 Ga0307415_100194555 3300032126 Bacteria 1603
309 Ga0307415_100562086 3300032126 Bacteria 1009
310 Ga0316583_10005396 3300032133 Unclassified 4589
311 Ga0316583_10104753 3300032133 Bacteria 986
312 Ga0316580_10043865 3300032139 Bacteria 1380
313 Ga0316593_10006625 3300032168 Unclassified 3138
314 Ga0316593_10007619 3300032168 Unclassified 2979
315 Ga0316593_10029349 3300032168 Bacteria 1779
316 Ga0316593_10035770 3300032168 Bacteria 1635
317 Ga0316593_10130182 3300032168 Bacteria 907
318 Ga0316593_10161357 3300032168 Bacteria 819
319 Ga0316592_1002554 3300033524 Bacteria 3161
320 Ga0316592_1003672 3300033524 Bacteria 2789
321 Ga0316592_1074019 3300033524 Unclassified 772
322 Ga0316592_1075343 3300033524 Bacteria 765
323 Ga0316586_1012643 3300033527 Bacteria 1312
324 Ga0316586_1019189 3300033527 Bacteria 1115
325 Ga0316586_1030836 3300033527 Bacteria 918
326 Ga0316586_1063942 3300033527 Bacteria 672
327 Ga0316588_1006365 3300033528 Bacteria 2357
328 Ga0316587_1081817 3300033529 Bacteria 611
329 Ga0316596_1005564 3300033541 Unclassified 2883
330 Ga0316596_1016396 3300033541 Bacteria 1856
331 Ga0316596_1052970 3300033541 Bacteria 1076
332 Ga0316596_1055758 3300033541 Bacteria 1050
333 Ga0316596_1064591 3300033541 Bacteria 978
334 Ga0316596_1082760 3300033541 Unclassified 863
335 Ga0316596_1100801 3300033541 Bacteria 781
336 Ga0316596_1146021 3300033541 Bacteria 649
337 Ga0316596_1157585 3300033541 Bacteria 625
338 Ga0316596_1186505 3300033541 Bacteria 575
339 Ga0373948_0054460 3300034817 Unclassified 866
340 Ga0373934_0441994 3300035086 Bacteria 545
341 Ga0373951_0127629 3300035091 Unclassified 697
342 Ga0373923_0330040 3300035111 Unclassified 726
343 Ga0373939_0250030 3300035114 Bacteria 690
344 Ga0373943_0037457 3300035170 Unclassified 2328
345 Ga0373943_0049010 3300035170 Bacteria 2072
346 Ga0316574_0076384 3300035398 Bacteria 2122
347 Ga0316574_0102454 3300035398 Bacteria 1832
348 Ga0316574_0108276 3300035398 Bacteria 1781
349 Ga0316574_0114081 3300035398 Unclassified 1733
350 Ga0316574_0200103 3300035398 Bacteria 1283
351 Ga0316574_0281918 3300035398 Bacteria 1058
352 Ga0373935_0543385 3300035692 Bacteria 846
353 Ga0373947_0043091 3300035725 Bacteria 2695
354 Ga0373947_0132589 3300035725 Bacteria 1592
355 Ga0373947_0277473 3300035725 Bacteria 1114
356 Ga0373937_0233145 3300036401 Bacteria 1734
357 Ga0373937_0998143 3300036401 Bacteria 786
358 Ga0316582_1274696 3300036647 Bacteria 500
359 Ga0316584_0018846 3300036712 Bacteria 4983
360 Ga0316584_0283478 3300036712 Bacteria 1203
361 Ga0316584_0356953 3300036712 Bacteria 1048
362 Ga0316584_0638500 3300036712 Bacteria 735
363 Ga0316584_0984287 3300036712 Bacteria 564
364 Ga0316584_1078653 3300036712 Unclassified 534
365 Ga0373925_0346087 3300037068 Bacteria 1206
366 Ga0373925_0817499 3300037068 Bacteria 768
367 Ga0439453_0029124 3300041408 Bacteria 1038
368 Ga0451800_0713708 3300041459 Unclassified 566
369 Ga0451835_0118627 3300041492 Unclassified 726
370 Ga0451855_1635569 3300041511 Unclassified 749
371 Ga0451853_3340028 3300041512 Bacteria 1456
372 Ga0439443_013293 3300042003 Archaea 1229
373 Ga0439454_022476 3300042011 Bacteria 940
374 Ga0439454_104862 3300042011 Bacteria 535
375 Ga0439463_156678 3300042016 Bacteria 591
376 Ga0450920_011506 3300042122 Bacteria 1650
377 Ga0450910_018404 3300042147 Bacteria 1044
378 Ga0439458_0098592 3300042157 Unclassified 757
379 Ga0450908_014990 3300042184 Bacteria 1389
380 Ga0439434_0215532 3300042435 Unclassified 650
381 Ga0439435_0067058 3300042436 Unclassified 1056
382 Ga0439435_0307087 3300042436 Unclassified 544
383 Ga0439444_0063515 3300042437 Archaea 776
384 Ga0439460_0014414 3300042461 Bacteria 2078
385 Ga0450916_095995 3300042530 Bacteria 521
386 Ga0451577_0409888 3300042876 Unclassified 1230
387 Ga0439440_0076355 3300042993 Bacteria 880
388 Ga0439440_0124429 3300042993 Unclassified 720
389 Ga0453684_0222250 3300044712 Bacteria 2187
390 Ga0451576_0761997 3300045051 Unclassified 1017
391 Ga0495592_0157104 3300046454 Bacteria 1568
392 Ga0495592_0382027 3300046454 Bacteria 896
393 Ga0495603_0085193 3300046455 Bacteria 1850
394 Ga0495603_0158973 3300046455 Bacteria 1311
395 Ga0495603_0378881 3300046455 Bacteria 811
396 Ga0495603_0867530 3300046455 Unclassified 513
397 Ga0495629_0017235 3300046459 Bacteria 5181
398 Ga0495629_0253312 3300046459 Bacteria 1211
399 Ga0495641_0126030 3300046461 Bacteria 1142
400 Ga0495651_0047581 3300046462 Bacteria 3315
401 Ga0495580_0070197 3300046472 Bacteria 2447
402 Ga0495582_0000200 3300046473 Bacteria 33369
403 Ga0495582_0497483 3300046473 Unclassified 705
404 Ga0495639_0011725 3300046475 Bacteria 3780
405 Ga0495639_0275956 3300046475 Unclassified 835
406 Ga0495662_0068237 3300046476 Bacteria 1722
407 Ga0495594_0680751 3300046499 Unclassified 582
408 Ga0495630_0216879 3300046517 Bacteria 1461
409 Ga0495630_0354393 3300046517 Bacteria 1123
410 Ga0495630_1456823 3300046517 Unclassified 514
411 Ga0495666_0193353 3300046526 Bacteria 937
412 Ga0495665_0011597 3300046531 Bacteria 4772
413 Ga0495640_0654768 3300046533 Unclassified 632
414 Ga0495586_0271352 3300046535 Unclassified 970
415 Ga0495598_0333935 3300046537 Bacteria 580
416 Ga0495667_0378619 3300046559 Bacteria 893
417 Ga0495656_0034059 3300046615 Unclassified 2083
418 Ga0495634_0343046 3300046642 Unclassified 896
419 Ga0495635_0245516 3300046663 Bacteria 1208
420 Ga0495588_0758653 3300046674 Unclassified 507
421 Ga0495657_0210428 3300046675 Bacteria 1182
422 Ga0495623_0214657 3300046679 Bacteria 1100
423 Ga0495647_0216183 3300046681 Bacteria 845
424 Ga0495658_0001000 3300046683 Bacteria 14932
425 Ga0495658_0156507 3300046683 Bacteria 1403
426 Ga0495658_0615257 3300046683 Unclassified 696
427 Ga0495613_0002275 3300046689 Bacteria 14531
428 Ga0495624_0249396 3300046690 Bacteria 1074
429 Ga0495581_0001423 3300047315 Bacteria 13273
430 Ga0495676_0058516 3300047321 Bacteria 3032
431 Ga0495676_0600450 3300047321 Unclassified 717
432 Ga0495676_0754417 3300047321 Unclassified 628
433 Ga0495676_0765633 3300047321 Bacteria 623
434 Ga0495676_0995173 3300047321 Bacteria 535
435 Ga0495593_0704986 3300047673 Unclassified 507
436 Ga0495602_0655686 3300048088 Bacteria 716
437 Ga0495614_0239263 3300048089 Bacteria 828
438 Ga0496100_0098275 3300048903 Bacteria 2012
439 Ga0496100_0299646 3300048903 Unclassified 1203
440 Ga0496100_0541096 3300048903 Bacteria 900
441 Ga0496100_1238274 3300048903 Unclassified 589
442 Ga0496101_0029448 3300048904 Bacteria 3840
443 Ga0496101_0581647 3300048904 Bacteria 885
444 Ga0496101_0993781 3300048904 Unclassified 660
445 Ga0496102_0329695 3300048905 Bacteria 1438
446 Ga0496102_0432322 3300048905 Bacteria 1236
447 Ga0496102_1695352 3300048905 Bacteria 550
448 Ga0496104_0001663 3300048907 Bacteria 19213
449 Ga0496104_0003658 3300048907 Bacteria 13274
450 Ga0496104_0009378 3300048907 Bacteria 8705
451 Ga0496104_0073010 3300048907 Bacteria 3264
452 Ga0496104_1855334 3300048907 Unclassified 505
453 Ga0496105_0005723 3300048908 Bacteria 9461
454 Ga0496105_0050162 3300048908 Bacteria 3447
455 Ga0496105_0216809 3300048908 Unclassified 1559
456 Ga0496105_0924127 3300048908 Unclassified 656
457 Ga0496106_0153546 3300048909 Unclassified 1817
458 Ga0496106_0190833 3300048909 Bacteria 1629
459 Ga0496107_0107759 3300048910 Bacteria 2046
460 Ga0496107_0154625 3300048910 Bacteria 1698
461 Ga0496108_0001483 3300048911 Bacteria 18537
462 Ga0496108_0014798 3300048911 Bacteria 6367
463 Ga0496108_0261472 3300048911 Bacteria 1506
464 Ga0496108_0489279 3300048911 Bacteria 1075
465 Ga0496109_0002307 3300048912 Bacteria 15879
466 Ga0496109_0008709 3300048912 Bacteria 8638
467 Ga0496109_0234127 3300048912 Bacteria 1728
468 Ga0496109_0251559 3300048912 Unclassified 1664
469 Ga0496109_1107764 3300048912 Unclassified 729
470 Ga0496109_1651697 3300048912 Bacteria 575
471 Ga0496110_0008234 3300048913 Bacteria 8380
472 Ga0496110_0247589 3300048913 Unclassified 1622
473 Ga0496110_1462379 3300048913 Unclassified 593
474 Ga0496111_0001853 3300048914 Bacteria 12475
475 Ga0496111_0049409 3300048914 Unclassified 3033
476 Ga0496111_0246479 3300048914 Bacteria 1326
477 Ga0496112_0002831 3300048915 Bacteria 14082
478 Ga0496112_0438119 3300048915 Bacteria 1245
479 Ga0496112_0442901 3300048915 Bacteria 1237
480 Ga0496112_0565068 3300048915 Bacteria 1071
481 Ga0496112_1531613 3300048915 Unclassified 580
482 Ga0496113_0010670 3300048916 Bacteria 6084
483 Ga0496113_0143658 3300048916 Unclassified 1879
484 Ga0496114_0005293 3300048917 Bacteria 10082
485 Ga0496114_0338088 3300048917 Bacteria 1331
486 Ga0496114_1003204 3300048917 Archaea 718
487 Ga0501306_086203 3300049127 Unclassified 547
488 Ga0501310_080486 3300049130 Unclassified 511
489 Ga0501325_012218 3300049541 Unclassified 805
490 Ga0501031_0002020 3300049568 Bacteria 12777
491 Ga0501031_0004346 3300049568 Bacteria 9166
492 Ga0501031_0007034 3300049568 Bacteria 7344
493 Ga0501031_0110220 3300049568 Bacteria 1797
494 Ga0501031_0246550 3300049568 Bacteria 1161
495 Ga0501031_0253997 3300049568 Bacteria 1142
496 Ga0501031_1072648 3300049568 Bacteria 514
497 Ga0501032_0043392 3300049569 Bacteria 3046
498 Ga0501032_0358692 3300049569 Bacteria 939
499 Ga0501032_0738771 3300049569 Bacteria 623
500 Ga0501033_0014111 3300049570 Bacteria 6075
501 Ga0501033_0655563 3300049570 Bacteria 717
502 Ga0501033_0985561 3300049570 Unclassified 564
503 Ga0501034_0134418 3300049571 Bacteria 2455
504 Ga0501036_0006726 3300049572 Bacteria 9345
505 Ga0501036_0075284 3300049572 Bacteria 2855
506 Ga0501036_0078835 3300049572 Bacteria 2786
507 Ga0501036_0105183 3300049572 Bacteria 2387
508 Ga0501036_0141777 3300049572 Bacteria 2028
509 Ga0501036_0168660 3300049572 Bacteria 1845
510 Ga0501036_0357061 3300049572 Unclassified 1220
511 Ga0501036_0421130 3300049572 Bacteria 1113
512 Ga0501037_0058493 3300049573 Bacteria 2813
513 Ga0501037_0099383 3300049573 Bacteria 2101
514 Ga0501037_0661000 3300049573 Bacteria 698
515 Ga0501037_0820104 3300049573 Unclassified 613
516 Ga0501037_0829664 3300049573 Bacteria 609
517 Ga0501038_0010392 3300049574 Bacteria 8509
518 Ga0501038_0136775 3300049574 Archaea 2007
519 Ga0501038_0160233 3300049574 Unclassified 1829
520 Ga0501038_0188586 3300049574 Unclassified 1660
521 Ga0501038_0198573 3300049574 Bacteria 1611
522 Ga0501038_0316505 3300049574 Unclassified 1222
523 Ga0501038_0602219 3300049574 Bacteria 831
524 Ga0501038_1289652 3300049574 Bacteria 528
525 Ga0501039_0009311 3300049575 Bacteria 7481
526 Ga0501039_0022486 3300049575 Bacteria 4840
527 Ga0501039_0036539 3300049575 Bacteria 3791
528 Ga0501039_0044398 3300049575 Bacteria 3433
529 Ga0501039_0047952 3300049575 Bacteria 3302
530 Ga0501039_0091637 3300049575 Bacteria 2369
531 Ga0501039_0429278 3300049575 Unclassified 1038
532 Ga0501039_0527626 3300049575 Bacteria 927
533 Ga0501039_0592124 3300049575 Unclassified 869
534 Ga0501040_0013469 3300049576 Bacteria 5375
535 Ga0501040_0036632 3300049576 Bacteria 3330
536 Ga0501040_0089487 3300049576 Bacteria 2139
537 Ga0501040_0208750 3300049576 Bacteria 1388
538 Ga0501040_0550952 3300049576 Unclassified 832
539 Ga0501040_0708324 3300049576 Bacteria 728
540 Ga0501040_1009008 3300049576 Bacteria 603
541 Ga0501040_1184392 3300049576 Bacteria 554
542 Ga0501041_0008168 3300049577 Bacteria 6158
543 Ga0501041_0026991 3300049577 Bacteria 3458
544 Ga0501041_0057014 3300049577 Bacteria 2388
545 Ga0501041_0091033 3300049577 Unclassified 1883
546 Ga0501042_0011055 3300049578 Bacteria 6078
547 Ga0501042_0102726 3300049578 Bacteria 2056
548 Ga0501042_0105477 3300049578 Unclassified 2028
549 Ga0501042_0147905 3300049578 Bacteria 1693
550 Ga0501042_0169465 3300049578 Unclassified 1576
551 Ga0501042_0203556 3300049578 Bacteria 1427
552 Ga0501042_0276154 3300049578 Unclassified 1213
553 Ga0501042_0403660 3300049578 Bacteria 990
554 Ga0501042_1379285 3300049578 Unclassified 514
555 Ga0501043_0026684 3300049579 Bacteria 4531
556 Ga0501043_0216005 3300049579 Bacteria 1485
557 Ga0501043_0451414 3300049579 Unclassified 966
558 Ga0501043_0777991 3300049579 Bacteria 694
559 Ga0501043_1257969 3300049579 Unclassified 518
560 Ga0501046_0025797 3300049580 Bacteria 4805
561 Ga0501046_0134927 3300049580 Unclassified 1870
562 Ga0501046_0273694 3300049580 Unclassified 1238
563 Ga0501046_0308455 3300049580 Bacteria 1154
564 Ga0501046_0367332 3300049580 Bacteria 1043
565 Ga0501046_0808850 3300049580 Bacteria 656
566 Ga0501048_0013255 3300049582 Bacteria 6117
567 Ga0501048_0018516 3300049582 Bacteria 5119
568 Ga0501048_0043639 3300049582 Bacteria 3209
569 Ga0501048_0052568 3300049582 Unclassified 2900
570 Ga0501048_0222402 3300049582 Bacteria 1339
571 Ga0501048_0252619 3300049582 Bacteria 1252
572 Ga0501048_0339360 3300049582 Bacteria 1071
573 Ga0501048_0380831 3300049582 Unclassified 1007
574 Ga0501067_0197041 3300049583 Unclassified 1122
575 Ga0501067_0204509 3300049583 Bacteria 1100
576 Ga0501068_0014796 3300049584 Bacteria 4465
577 Ga0501068_0114740 3300049584 Bacteria 1677
578 Ga0501068_0140528 3300049584 Bacteria 1514
579 Ga0501068_0175541 3300049584 Unclassified 1354
580 Ga0501068_0182296 3300049584 Unclassified 1328
581 Ga0501068_0307167 3300049584 Bacteria 1016
582 Ga0501068_0402204 3300049584 Unclassified 883
583 Ga0501069_0015264 3300049585 Bacteria 4116
584 Ga0501069_0277094 3300049585 Bacteria 981
585 Ga0501069_0435482 3300049585 Unclassified 778
586 Ga0501070_0011535 3300049586 Bacteria 7459
587 Ga0501070_0237902 3300049586 Unclassified 1491
588 Ga0501070_0563216 3300049586 Unclassified 911
589 Ga0501070_0693657 3300049586 Unclassified 806
590 Ga0501071_0024012 3300049587 Bacteria 4261
591 Ga0501071_0028286 3300049587 Bacteria 3950
592 Ga0501071_0030750 3300049587 Bacteria 3799
593 Ga0501071_0032462 3300049587 Bacteria 3707
594 Ga0501071_0051534 3300049587 Unclassified 2966
595 Ga0501071_0123912 3300049587 Unclassified 1917
596 Ga0501071_0427494 3300049587 Unclassified 1012
597 Ga0501071_0480579 3300049587 Unclassified 952
598 Ga0501071_0891225 3300049587 Bacteria 686
599 Ga0501071_1455174 3300049587 Bacteria 529
600 Ga0501071_1541371 3300049587 Unclassified 513
601 Ga0501072_0001664 3300049588 Bacteria 16566
602 Ga0501072_0008858 3300049588 Bacteria 7644
603 Ga0501072_0034022 3300049588 Bacteria 3992
604 Ga0501072_0081475 3300049588 Unclassified 2565
605 Ga0501072_0143345 3300049588 Bacteria 1905
606 Ga0501072_0262692 3300049588 Bacteria 1374
607 Ga0501073_0021050 3300049589 Bacteria 4705
608 Ga0501073_0174971 3300049589 Bacteria 1485
609 Ga0501073_0299793 3300049589 Unclassified 1109
610 Ga0501073_1009900 3300049589 Bacteria 572
611 Ga0501074_0003913 3300049590 Bacteria 10610
612 Ga0501074_0123611 3300049590 Bacteria 1851
613 Ga0501074_0130081 3300049590 Bacteria 1801
614 Ga0501074_0247227 3300049590 Unclassified 1268
615 Ga0501074_0312628 3300049590 Unclassified 1116
616 Ga0501074_0507218 3300049590 Bacteria 854
617 Ga0501075_0004911 3300049591 Bacteria 9115
618 Ga0501075_0005472 3300049591 Bacteria 8684
619 Ga0501075_0010519 3300049591 Bacteria 6503
620 Ga0501075_0013739 3300049591 Bacteria 5786
621 Ga0501075_0023869 3300049591 Bacteria 4478
622 Ga0501075_0028608 3300049591 Bacteria 4114
623 Ga0501075_0129746 3300049591 Bacteria 1920
624 Ga0501075_0291224 3300049591 Bacteria 1244
625 Ga0501075_0628616 3300049591 Bacteria 819
626 Ga0501075_0661154 3300049591 Unclassified 796
627 Ga0501075_1079888 3300049591 Unclassified 609
628 Ga0501076_0004368 3300049592 Bacteria 10039
629 Ga0501076_0006758 3300049592 Bacteria 8325
630 Ga0501076_0027428 3300049592 Bacteria 4417
631 Ga0501076_0050210 3300049592 Bacteria 3300
632 Ga0501076_0053557 3300049592 Bacteria 3198
633 Ga0501076_0109416 3300049592 Bacteria 2233
634 Ga0501076_0180991 3300049592 Unclassified 1718
635 Ga0501076_0223139 3300049592 Unclassified 1540
636 Ga0501076_0364300 3300049592 Bacteria 1187
637 Ga0501076_0734614 3300049592 Bacteria 815
638 Ga0501076_1464891 3300049592 Bacteria 561
639 Ga0501077_0006742 3300049593 Bacteria 7067
640 Ga0501077_0061890 3300049593 Bacteria 2375
641 Ga0501077_0104986 3300049593 Bacteria 1790
642 Ga0501077_0118041 3300049593 Unclassified 1681
643 Ga0501077_0175408 3300049593 Bacteria 1362
644 Ga0501077_0210537 3300049593 Bacteria 1235
645 Ga0501077_0241273 3300049593 Unclassified 1149
646 Ga0501079_0002556 3300049741 Bacteria 13215
647 Ga0501079_0021490 3300049741 Unclassified 4936
648 Ga0501079_0029382 3300049741 Bacteria 4220
649 Ga0501079_0029782 3300049741 Bacteria 4192
650 Ga0501079_0347759 3300049741 Bacteria 1161
651 Ga0501079_0360157 3300049741 Bacteria 1140
652 Ga0501080_0049582 3300049742 Bacteria 3907
653 Ga0501080_0147768 3300049742 Bacteria 2173
654 Ga0501080_0570181 3300049742 Bacteria 1007
655 Ga0501080_0946248 3300049742 Bacteria 749
656 Ga0501081_0019175 3300049743 Bacteria 4550
657 Ga0501081_0023814 3300049743 Bacteria 4106
658 Ga0501081_0199049 3300049743 Unclassified 1452
659 Ga0501081_0209870 3300049743 Bacteria 1414
660 Ga0501081_0584583 3300049743 Bacteria 835
661 Ga0501083_0079371 3300049744 Bacteria 2176
662 Ga0501083_0265000 3300049744 Unclassified 1118
663 Ga0501035_0004781 3300049822 Bacteria 12857
664 Ga0501035_0245061 3300049822 Unclassified 1523
665 Ga0501035_0304902 3300049822 Unclassified 1341
666 Ga0501035_0315184 3300049822 Unclassified 1315
667 Ga0501035_0828632 3300049822 Bacteria 737
668 Ga0501044_0082868 3300049823 Bacteria 3244
669 Ga0501044_0540163 3300049823 Unclassified 1064
670 Ga0501045_0009720 3300049824 Bacteria 6730
671 Ga0501045_0011698 3300049824 Bacteria 6164
672 Ga0501045_0019962 3300049824 Bacteria 4783
673 Ga0501045_0064804 3300049824 Archaea 2682
674 Ga0501045_0164392 3300049824 Bacteria 1652
675 Ga0501045_0580726 3300049824 Bacteria 830
676 Ga0501045_0812509 3300049824 Unclassified 688
677 Ga0501045_0947341 3300049824 Unclassified 632
678 nmdc:mga05p37_1968_c1 3300050507 Bacteria 23961
679 nmdc:mga09592_164275_c1 3300050508 Bacteria 1918
680 nmdc:mga08y16_37726_c1 3300050511 Bacteria 5072
681 nmdc:mga0n895_1685305_c1 3300050512 Unclassified 597
682 nmdc:mga0rr50_362877_c1 3300050513 Unclassified 1219
683 nmdc:mga0a205_120463_c1 3300050515 Bacteria 2523
684 nmdc:mga0a205_735275_c1 3300050515 Unclassified 836
685 Ga0495601_0235843 3300053077 Bacteria 1195
686 Ga0495601_0968539 3300053077 Unclassified 536
687 Ga0495595_0104603 3300053084 Bacteria 1368
688 Ga0495619_0109424 3300053085 Bacteria 1887
689 Ga0500566_0339784 3300053094 Bacteria 692
690 Ga0501084_0010698 3300054114 Bacteria 7593
691 Ga0501084_0014654 3300054114 Bacteria 6499
692 Ga0501084_0048616 3300054114 Bacteria 3550
693 Ga0501084_0073678 3300054114 Unclassified 2859
694 Ga0501084_0090222 3300054114 Bacteria 2573
695 Ga0501084_0230299 3300054114 Unclassified 1564
696 Ga0501084_0405889 3300054114 Unclassified 1151
697 Ga0501084_0458476 3300054114 Bacteria 1078
698 Ga0501084_0711094 3300054114 Bacteria 847
699 Ga0501084_1400288 3300054114 Bacteria 586
700 Ga0501082_0057220 3300060353 Bacteria 3359
701 Ga0501082_0062393 3300060353 Bacteria 3208
702 Ga0501082_0076013 3300060353 Bacteria 2894
703 Ga0501082_0091952 3300060353 Unclassified 2620
704 Ga0501082_0106552 3300060353 Bacteria 2425
705 Ga0501082_0144403 3300060353 Bacteria 2065
706 Ga0501082_0468188 3300060353 Bacteria 1101
707 Ga0501082_0518104 3300060353 Unclassified 1042
708 Ga0530510_0003811 3300061734 Bacteria 10392
709 Ga0530510_0031510 3300061734 Unclassified 3812
710 Ga0530510_0037843 3300061734 Bacteria 3480
711 Ga0530510_0042054 3300061734 Bacteria 3301
712 Ga0530510_0056080 3300061734 Bacteria 2846
713 Ga0530510_0057603 3300061734 Bacteria 2808
714 Ga0530510_0104721 3300061734 Unclassified 2070
715 Ga0530510_0368160 3300061734 Bacteria 1081
716 Ga0530510_0767923 3300061734 Bacteria 735
717 Ga0530510_0916391 3300061734 Unclassified 670
718 Ga0207683_10989719
719 JGI24747J21853_1025621
720 JGI24751J29686_10000350
721 Ga0065715_10192854
722 Ga0065707_10814445
723 Ga0070683_100469364
724 Ga0070683_101667168
725 Ga0070690_100186865
726 Ga0070670_100003123
727 Ga0070670_101524270
728 Ga0070670_101876495
729 Ga0068869_100375491
730 Ga0068869_100552825
731 Ga0070666_10181643
732 Ga0070666_10197160
733 Ga0070682_100647678
734 Ga0068868_100421540
735 Ga0070692_10134084
736 Ga0070692_10191381
737 Ga0070674_100040870
738 Ga0070674_100102902
739 Ga0070674_100110206
740 Ga0070673_100669731
741 Ga0070688_100438699
742 Ga0070688_100449897
743 Ga0070688_100797411
744 Ga0070659_101096353
745 Ga0070667_102333133
746 Ga0070714_100287512
747 Ga0070711_101246389
748 Ga0070705_100278846
749 Ga0070700_100191082
750 Ga0070694_101302694
751 Ga0070708_100400820
752 Ga0070708_101379779
753 Ga0070678_100107743
754 Ga0070678_100428206
755 Ga0070678_100552980
756 Ga0070681_10091928
757 Ga0068867_100087308
758 Ga0068867_100672155
759 Ga0070685_10123209
760 Ga0070706_100000215
761 Ga0070706_100474005
762 Ga0070706_101803360
763 Ga0070698_100212429
764 Ga0070699_100452815
765 Ga0070699_101034931
766 Ga0070679_101208054
767 Ga0070684_100303282
768 Ga0070697_100343617
769 Ga0070672_100386463
770 Ga0070686_100010945
771 Ga0070686_100108291
772 Ga0070686_101404075
773 Ga0070695_100132537
774 Ga0070696_100483718
775 Ga0070693_100229336
776 Ga0070693_101192908
777 Ga0070665_101811676
778 Ga0070704_100003389
779 Ga0070664_100353324
780 Ga0070664_101014800
781 Ga0068857_100038556
782 Ga0068857_100559076
783 Ga0068856_100241135
784 Ga0070702_100033848
785 Ga0070702_101498663
786 Ga0068859_100564913
787 Ga0068864_100035416
788 Ga0068864_100200705
789 Ga0068864_100367286
790 Ga0068864_101023864
791 Ga0068864_101603265
792 Ga0068864_101629541
793 Ga0068864_101642889
794 Ga0068866_10495546
795 Ga0068861_101823545
796 Ga0068870_10001954
797 Ga0068870_10189070
798 Ga0068863_100156394
799 Ga0068863_101736765
800 Ga0068863_102092625
801 Ga0068858_100262471
802 Ga0068860_100527866
803 Ga0068862_101291456
804 Ga0081455_10001266
805 Ga0081455_10194303
806 Ga0081455_10659939
807 Ga0070712_100557422
808 Ga0070712_101486076
809 Ga0097621_100893756
810 Ga0068871_100964436
811 Ga0068871_101184083
812 Ga0068871_102256335
813 Ga0075428_100001182
814 Ga0075433_10037944
815 Ga0075433_10084021
816 Ga0075433_10107013
817 Ga0075429_100168680
818 Ga0068865_100570263
819 Ga0068865_101614208
820 Ga0097620_100564869
821 Ga0075435_100263803
822 Ga0111539_10015824
823 Ga0105247_10073191
824 Ga0114129_10000286
825 Ga0105243_10016596
826 Ga0105243_10022853
827 Ga0105243_12771164
828 Ga0105242_10953670
829 Ga0105248_10683947
830 Ga0105248_10959913
831 Ga0105248_10960026
832 Ga0105248_12105800
833 Ga0105237_12510795
834 Ga0105249_10445468
835 Ga0105249_12572774
836 Ga0105239_10994616
837 Ga0105239_13251455
838 Ga0105239_13535239
839 Ga0105246_10027632
840 Ga0105246_10384491
841 Ga0105246_11282308
842 Ga0105246_12259880
843 Ga0157373_10416866
844 Ga0157378_10199257
845 Ga0157378_11810253
846 Ga0163162_10361457
847 Ga0163162_12084751
848 Ga0163162_12939103
849 Ga0157375_10015545
850 Ga0157375_10161444
851 Ga0157375_11610049
852 Ga0163163_10001255
853 Ga0163163_10017578
854 Ga0163163_10063661
855 Ga0163163_10391920
856 Ga0163163_10447307
857 Ga0163163_12327206
858 Ga0157380_10190708
859 Ga0157380_10467636
860 Ga0157380_10526006
861 Ga0157380_13034648
862 Ga0182008_10823366
863 Ga0157379_10113749
864 Ga0157379_10241986
865 Ga0157379_10494831
866 Ga0157379_10639014
867 Ga0157376_10252941
868 Ga0157376_12109889
869 Ga0163161_11279645
870 Ga0207642_10751173
871 Ga0207710_10037066
872 Ga0207680_10137043
873 Ga0207680_10837304
874 Ga0207645_10682629
875 Ga0207643_10002955
876 Ga0207643_10176499
877 Ga0207684_10000013
878 Ga0207684_10478407
879 Ga0207654_11360148
880 Ga0207693_11226767
881 Ga0207662_10504678
882 Ga0207649_10841468
883 Ga0207652_11007646
884 Ga0207646_11299056
885 Ga0207650_10000664
886 Ga0207650_11139622
887 Ga0207659_10172156
888 Ga0207687_10136072
889 Ga0207644_11462866
890 Ga0207686_10096360
891 Ga0207709_10762929
892 Ga0207669_10063804
893 Ga0207669_10068893
894 Ga0207691_10270243
895 Ga0207711_10806226
896 Ga0207661_10287517
897 Ga0207661_11385767
898 Ga0207679_10042742
899 Ga0207679_12144874
900 Ga0207651_10600073
901 Ga0207668_10380030
902 Ga0207677_11935105
903 Ga0207703_10739124
904 Ga0207703_10920049
905 Ga0207708_10105314
906 Ga0207708_11050980
907 Ga0207702_10494125
908 Ga0207702_12178153
909 Ga0207641_10106456
910 Ga0207641_10474697
911 Ga0207641_11748162
912 Ga0207648_10016610
913 Ga0207648_10398406
914 Ga0207676_10003790
915 Ga0207676_10148981
916 Ga0207676_10568828
917 Ga0207676_10577523
918 Ga0207676_10857546
919 Ga0207674_10620044
920 Ga0207674_10862862
921 Ga0207675_101905550
922 Ga0207675_102668108
923 Ga0207683_10466927
924 Ga0207683_10495217
925 Ga0207683_10682072
926 Ga0207698_10213543
927 Ga0209969_1025896
928 Ga0209996_1012640
929 Ga0209984_1020234
930 Ga0209968_1003052
931 Ga0209999_1020279
932 Ga0209999_1069601
933 Ga0209982_1004579
934 Ga0210002_1018874
935 Ga0209983_1014764
936 Ga0209983_1111489
937 Ga0209971_1002642
938 Ga0209966_1006311
939 Ga0209998_10007931
940 Ga0209974_10001443
941 Ga0207428_10070341
942 Ga0265326_10024283
943 Ga0265326_10120116
944 Ga0265326_10168321
945 Ga0265319_1019322
946 Ga0265334_10031261
947 Ga0265334_10031842
948 Ga0265334_10035279
949 Ga0265334_10063716
950 Ga0265318_10003654
951 Ga0265318_10011724
952 Ga0265318_10019556
953 Ga0265318_10272643
954 Ga0265323_10024956
955 Ga0265322_10009410
956 Ga0265322_10022289
957 Ga0265336_10066296
958 Ga0265338_10106050
959 Ga0265338_10221827
960 Ga0265324_10026902
961 Ga0265324_10240691
962 Ga0265330_10047851
963 Ga0265330_10169071
964 Ga0265332_10009447
965 Ga0265328_10182244
966 Ga0265328_10358020
967 Ga0265320_10006513
968 Ga0265320_10020855
969 Ga0265320_10169322
970 Ga0265320_10199449
971 Ga0265325_10056488
972 Ga0265325_10081729
973 Ga0265325_10113822
974 Ga0265329_10002514
975 Ga0265329_10005869
976 Ga0265329_10145894
977 Ga0265340_10013761
978 Ga0265339_10055404
979 Ga0265339_10148297
980 Ga0265339_10184469
981 Ga0265339_10274291
982 Ga0265331_10023966
983 Ga0265331_10143826
984 Ga0265316_10069516
985 Ga0265316_10082574
986 Ga0265316_10137681
987 Ga0307408_100250216
988 Ga0265313_10037237
989 Ga0265313_10144249
990 Ga0265313_10304793
991 Ga0316575_10018399
992 Ga0265314_10004439
993 Ga0265314_10021387
994 Ga0265314_10320668
995 Ga0265342_10028561
996 Ga0265342_10046397
997 Ga0265342_10336471
998 Ga0265342_10370148
999 Ga0316576_10007781
1000 Ga0316576_10040749
1001 Ga0316576_10057602
1002 Ga0316576_10122202
1003 Ga0316576_10293044
1004 Ga0316576_10530043
1005 Ga0316576_10886560
1006 Ga0316578_10037877
1007 Ga0316578_10330238
1008 Ga0316578_10668874
1009 Ga0316578_10850670
1010 Ga0307405_10144741
1011 Ga0307405_10317922
1012 Ga0307413_10235558
1013 Ga0307410_11284556
1014 Ga0307406_10098808
1015 Ga0307407_11184952
1016 Ga0307412_11687308
1017 Ga0307412_12107514
1018 Ga0307409_100322491
1019 Ga0307416_100009750
1020 Ga0307416_100318507
1021 Ga0307414_10439129
1022 Ga0307411_10116737
1023 Ga0307411_10350905
1024 Ga0307415_100049572
1025 Ga0307415_100194555
1026 Ga0307415_100562086
1027 Ga0316583_10005396
1028 Ga0316583_10104753
1029 Ga0316580_10043865
1030 Ga0316593_10006625
1031 Ga0316593_10007619
1032 Ga0316593_10029349
1033 Ga0316593_10035770
1034 Ga0316593_10130182
1035 Ga0316593_10161357
1036 Ga0316592_1002554
1037 Ga0316592_1003672
1038 Ga0316592_1074019
1039 Ga0316592_1075343
1040 Ga0316586_1012643
1041 Ga0316586_1019189
1042 Ga0316586_1030836
1043 Ga0316586_1063942
1044 Ga0316588_1006365
1045 Ga0316587_1081817
1046 Ga0316596_1005564
1047 Ga0316596_1016396
1048 Ga0316596_1052970
1049 Ga0316596_1055758
1050 Ga0316596_1064591
1051 Ga0316596_1082760
1052 Ga0316596_1100801
1053 Ga0316596_1146021
1054 Ga0316596_1157585
1055 Ga0316596_1186505
1056 Ga0373948_0054460
1057 Ga0373934_0441994
1058 Ga0373951_0127629
1059 Ga0373923_0330040
1060 Ga0373939_0250030
1061 Ga0373943_0037457
1062 Ga0373943_0049010
1063 Ga0316574_0076384
1064 Ga0316574_0102454
1065 Ga0316574_0108276
1066 Ga0316574_0114081
1067 Ga0316574_0200103
1068 Ga0316574_0281918
1069 Ga0373935_0543385
1070 Ga0373947_0043091
1071 Ga0373947_0132589
1072 Ga0373947_0277473
1073 Ga0373937_0233145
1074 Ga0373937_0998143
1075 Ga0316582_1274696
1076 Ga0316584_0018846
1077 Ga0316584_0283478
1078 Ga0316584_0356953
1079 Ga0316584_0638500
1080 Ga0316584_0984287
1081 Ga0316584_1078653
1082 Ga0373925_0346087
1083 Ga0373925_0817499
1084 Ga0439453_0029124
1085 Ga0451800_0713708
1086 Ga0451835_0118627
1087 Ga0451855_1635569
1088 Ga0451853_3340028
1089 Ga0439443_013293
1090 Ga0439454_022476
1091 Ga0439454_104862
1092 Ga0439463_156678
1093 Ga0450920_011506
1094 Ga0450910_018404
1095 Ga0439458_0098592
1096 Ga0450908_014990
1097 Ga0439434_0215532
1098 Ga0439435_0067058
1099 Ga0439435_0307087
1100 Ga0439444_0063515
1101 Ga0439460_0014414
1102 Ga0450916_095995
1103 Ga0451577_0409888
1104 Ga0439440_0076355
1105 Ga0439440_0124429
1106 Ga0453684_0222250
1107 Ga0451576_0761997
1108 Ga0495592_0157104
1109 Ga0495592_0382027
1110 Ga0495603_0085193
1111 Ga0495603_0158973
1112 Ga0495603_0378881
1113 Ga0495603_0867530
1114 Ga0495629_0017235
1115 Ga0495629_0253312
1116 Ga0495641_0126030
1117 Ga0495651_0047581
1118 Ga0495580_0070197
1119 Ga0495582_0000200
1120 Ga0495582_0497483
1121 Ga0495639_0011725
1122 Ga0495639_0275956
1123 Ga0495662_0068237
1124 Ga0495594_0680751
1125 Ga0495630_0216879
1126 Ga0495630_0354393
1127 Ga0495630_1456823
1128 Ga0495666_0193353
1129 Ga0495665_0011597
1130 Ga0495640_0654768
1131 Ga0495586_0271352
1132 Ga0495598_0333935
1133 Ga0495667_0378619
1134 Ga0495656_0034059
1135 Ga0495634_0343046
1136 Ga0495635_0245516
1137 Ga0495588_0758653
1138 Ga0495657_0210428
1139 Ga0495623_0214657
1140 Ga0495647_0216183
1141 Ga0495658_0001000
1142 Ga0495658_0156507
1143 Ga0495658_0615257
1144 Ga0495613_0002275
1145 Ga0495624_0249396
1146 Ga0495581_0001423
1147 Ga0495676_0058516
1148 Ga0495676_0600450
1149 Ga0495676_0754417
1150 Ga0495676_0765633
1151 Ga0495676_0995173
1152 Ga0495593_0704986
1153 Ga0495602_0655686
1154 Ga0495614_0239263
1155 Ga0496100_0098275
1156 Ga0496100_0299646
1157 Ga0496100_0541096
1158 Ga0496100_1238274
1159 Ga0496101_0029448
1160 Ga0496101_0581647
1161 Ga0496101_0993781
1162 Ga0496102_0329695
1163 Ga0496102_0432322
1164 Ga0496102_1695352
1165 Ga0496104_0001663
1166 Ga0496104_0003658
1167 Ga0496104_0009378
1168 Ga0496104_0073010
1169 Ga0496104_1855334
1170 Ga0496105_0005723
1171 Ga0496105_0050162
1172 Ga0496105_0216809
1173 Ga0496105_0924127
1174 Ga0496106_0153546
1175 Ga0496106_0190833
1176 Ga0496107_0107759
1177 Ga0496107_0154625
1178 Ga0496108_0001483
1179 Ga0496108_0014798
1180 Ga0496108_0261472
1181 Ga0496108_0489279
1182 Ga0496109_0002307
1183 Ga0496109_0008709
1184 Ga0496109_0234127
1185 Ga0496109_0251559
1186 Ga0496109_1107764
1187 Ga0496109_1651697
1188 Ga0496110_0008234
1189 Ga0496110_0247589
1190 Ga0496110_1462379
1191 Ga0496111_0001853
1192 Ga0496111_0049409
1193 Ga0496111_0246479
1194 Ga0496112_0002831
1195 Ga0496112_0438119
1196 Ga0496112_0442901
1197 Ga0496112_0565068
1198 Ga0496112_1531613
1199 Ga0496113_0010670
1200 Ga0496113_0143658
1201 Ga0496114_0005293
1202 Ga0496114_0338088
1203 Ga0496114_1003204
1204 Ga0501306_086203
1205 Ga0501310_080486
1206 Ga0501325_012218
1207 Ga0501031_0002020
1208 Ga0501031_0004346
1209 Ga0501031_0007034
1210 Ga0501031_0110220
1211 Ga0501031_0246550
1212 Ga0501031_0253997
1213 Ga0501031_1072648
1214 Ga0501032_0043392
1215 Ga0501032_0358692
1216 Ga0501032_0738771
1217 Ga0501033_0014111
1218 Ga0501033_0655563
1219 Ga0501033_0985561
1220 Ga0501034_0134418
1221 Ga0501036_0006726
1222 Ga0501036_0075284
1223 Ga0501036_0078835
1224 Ga0501036_0105183
1225 Ga0501036_0141777
1226 Ga0501036_0168660
1227 Ga0501036_0357061
1228 Ga0501036_0421130
1229 Ga0501037_0058493
1230 Ga0501037_0099383
1231 Ga0501037_0661000
1232 Ga0501037_0820104
1233 Ga0501037_0829664
1234 Ga0501038_0010392
1235 Ga0501038_0136775
1236 Ga0501038_0160233
1237 Ga0501038_0188586
1238 Ga0501038_0198573
1239 Ga0501038_0316505
1240 Ga0501038_0602219
1241 Ga0501038_1289652
1242 Ga0501039_0009311
1243 Ga0501039_0022486
1244 Ga0501039_0036539
1245 Ga0501039_0044398
1246 Ga0501039_0047952
1247 Ga0501039_0091637
1248 Ga0501039_0429278
1249 Ga0501039_0527626
1250 Ga0501039_0592124
1251 Ga0501040_0013469
1252 Ga0501040_0036632
1253 Ga0501040_0089487
1254 Ga0501040_0208750
1255 Ga0501040_0550952
1256 Ga0501040_0708324
1257 Ga0501040_1009008
1258 Ga0501040_1184392
1259 Ga0501041_0008168
1260 Ga0501041_0026991
1261 Ga0501041_0057014
1262 Ga0501041_0091033
1263 Ga0501042_0011055
1264 Ga0501042_0102726
1265 Ga0501042_0105477
1266 Ga0501042_0147905
1267 Ga0501042_0169465
1268 Ga0501042_0203556
1269 Ga0501042_0276154
1270 Ga0501042_0403660
1271 Ga0501042_1379285
1272 Ga0501043_0026684
1273 Ga0501043_0216005
1274 Ga0501043_0451414
1275 Ga0501043_0777991
1276 Ga0501043_1257969
1277 Ga0501046_0025797
1278 Ga0501046_0134927
1279 Ga0501046_0273694
1280 Ga0501046_0308455
1281 Ga0501046_0367332
1282 Ga0501046_0808850
1283 Ga0501048_0013255
1284 Ga0501048_0018516
1285 Ga0501048_0043639
1286 Ga0501048_0052568
1287 Ga0501048_0222402
1288 Ga0501048_0252619
1289 Ga0501048_0339360
1290 Ga0501048_0380831
1291 Ga0501067_0197041
1292 Ga0501067_0204509
1293 Ga0501068_0014796
1294 Ga0501068_0114740
1295 Ga0501068_0140528
1296 Ga0501068_0175541
1297 Ga0501068_0182296
1298 Ga0501068_0307167
1299 Ga0501068_0402204
1300 Ga0501069_0015264
1301 Ga0501069_0277094
1302 Ga0501069_0435482
1303 Ga0501070_0011535
1304 Ga0501070_0237902
1305 Ga0501070_0563216
1306 Ga0501070_0693657
1307 Ga0501071_0024012
1308 Ga0501071_0028286
1309 Ga0501071_0030750
1310 Ga0501071_0032462
1311 Ga0501071_0051534
1312 Ga0501071_0123912
1313 Ga0501071_0427494
1314 Ga0501071_0480579
1315 Ga0501071_0891225
1316 Ga0501071_1455174
1317 Ga0501071_1541371
1318 Ga0501072_0001664
1319 Ga0501072_0008858
1320 Ga0501072_0034022
1321 Ga0501072_0081475
1322 Ga0501072_0143345
1323 Ga0501072_0262692
1324 Ga0501073_0021050
1325 Ga0501073_0174971
1326 Ga0501073_0299793
1327 Ga0501073_1009900
1328 Ga0501074_0003913
1329 Ga0501074_0123611
1330 Ga0501074_0130081
1331 Ga0501074_0247227
1332 Ga0501074_0312628
1333 Ga0501074_0507218
1334 Ga0501075_0004911
1335 Ga0501075_0005472
1336 Ga0501075_0010519
1337 Ga0501075_0013739
1338 Ga0501075_0023869
1339 Ga0501075_0028608
1340 Ga0501075_0129746
1341 Ga0501075_0291224
1342 Ga0501075_0628616
1343 Ga0501075_0661154
1344 Ga0501075_1079888
1345 Ga0501076_0004368
1346 Ga0501076_0006758
1347 Ga0501076_0027428
1348 Ga0501076_0050210
1349 Ga0501076_0053557
1350 Ga0501076_0109416
1351 Ga0501076_0180991
1352 Ga0501076_0223139
1353 Ga0501076_0364300
1354 Ga0501076_0734614
1355 Ga0501076_1464891
1356 Ga0501077_0006742
1357 Ga0501077_0061890
1358 Ga0501077_0104986
1359 Ga0501077_0118041
1360 Ga0501077_0175408
1361 Ga0501077_0210537
1362 Ga0501077_0241273
1363 Ga0501079_0002556
1364 Ga0501079_0021490
1365 Ga0501079_0029382
1366 Ga0501079_0029782
1367 Ga0501079_0347759
1368 Ga0501079_0360157
1369 Ga0501080_0049582
1370 Ga0501080_0147768
1371 Ga0501080_0570181
1372 Ga0501080_0946248
1373 Ga0501081_0019175
1374 Ga0501081_0023814
1375 Ga0501081_0199049
1376 Ga0501081_0209870
1377 Ga0501081_0584583
1378 Ga0501083_0079371
1379 Ga0501083_0265000
1380 Ga0501035_0004781
1381 Ga0501035_0245061
1382 Ga0501035_0304902
1383 Ga0501035_0315184
1384 Ga0501035_0828632
1385 Ga0501044_0082868
1386 Ga0501044_0540163
1387 Ga0501045_0009720
1388 Ga0501045_0011698
1389 Ga0501045_0019962
1390 Ga0501045_0064804
1391 Ga0501045_0164392
1392 Ga0501045_0580726
1393 Ga0501045_0812509
1394 Ga0501045_0947341
1395 nmdc:mga05p37_1968_c1
1396 nmdc:mga09592_164275_c1
1397 nmdc:mga08y16_37726_c1
1398 nmdc:mga0n895_1685305_c1
1399 nmdc:mga0rr50_362877_c1
1400 nmdc:mga0a205_120463_c1
1401 nmdc:mga0a205_735275_c1
1402 Ga0495601_0235843
1403 Ga0495601_0968539
1404 Ga0495595_0104603
1405 Ga0495619_0109424
1406 Ga0500566_0339784
1407 Ga0501084_0010698
1408 Ga0501084_0014654
1409 Ga0501084_0048616
1410 Ga0501084_0073678
1411 Ga0501084_0090222
1412 Ga0501084_0230299
1413 Ga0501084_0405889
1414 Ga0501084_0458476
1415 Ga0501084_0711094
1416 Ga0501084_1400288
1417 Ga0501082_0057220
1418 Ga0501082_0062393
1419 Ga0501082_0076013
1420 Ga0501082_0091952
1421 Ga0501082_0106552
1422 Ga0501082_0144403
1423 Ga0501082_0468188
1424 Ga0501082_0518104
1425 Ga0530510_0003811
1426 Ga0530510_0031510
1427 Ga0530510_0037843
1428 Ga0530510_0042054
1429 Ga0530510_0056080
1430 Ga0530510_0057603
1431 Ga0530510_0104721
1432 Ga0530510_0368160
1433 Ga0530510_0767923
1434 Ga0530510_0916391

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01206

TusA

Sulfurtransferase TusA

16

85

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hz7-assembly1.cif.gz_A crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a 0.9018 6 75
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.8959 1 76
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.8848 1 76
1dcj-assembly1.cif.gz_A solution structure of yhhp, a novel escherichia coli protein implicated in the cell division 0.8802 2 76
1dcj-assembly1.cif.gz_A solution structure of yhhp, a novel escherichia coli protein implicated in the cell division 0.8499 2 76
ID Description Score Start End Superfamily
af_Q2G1R7_113_189_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9762 7 77 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9456 8 76 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9322 4 76 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9203 4 76 3.30.110.40
af_Q58170_72_142_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9153 7 75 3.30.110.40
ID Description Score Start End GO Terms
AF-A0A1L3RVE4-F1-model_v4 deleted 1.004 7 77
AF-A0A0S1YA77-F1-model_v4 UPF0033 domain-containing protein 1.002 8 77
AF-A0A7Y0E1H7-F1-model_v4 Sulfurtransferase TusA family protein 0.9998 8 77 GO:0016740
AF-A0A367XCW3-F1-model_v4 UPF0033 domain-containing protein 0.9995 8 77
AF-A0A2E5Z5L4-F1-model_v4 SirA family protein 0.9991 8 76

Map