F477098

General Info

Members Datasets Scaffolds Average Seq Length
717 487 547 319

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10138269|Ga0114129_101382692
Length 353
Sequence VALIGLADIALKALAPFFVQLRNDHSNKEQVMKAVVMNGTGGREMLEHVERPDPVAGPGQALVDIAFAGVNFMDIGVRQGMAWTDTPNPKVLGVEGVGRVVAVGDGVEGIAPGQRVAWVYAPGSYAERIAIPAASLVPVPDAIDDRTAASVMMQGLTASHFATDFYPVQPGDVAFVHAAAGGLGLLLTQIVKLRGGQVIGRVSSDEKVAAANEAGADHVIVDAEGRFAEEALRLTDGEGVHVVYDGSGPKTFQGSLDVLRRSGVFCWYGPVLGGPGPLNIMSLPKSIKIGYAIFFDHIHTPELLRTRSAQLFDWITEGNLRVRIGGEYPLADAARAHADMESRKTTGKLLLVP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
3 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
4 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
5 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
6 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
9 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
10 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
11 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
12 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
13 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
14 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
15 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
16 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
17 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
18 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
19 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
20 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
21 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
22 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
23 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
24 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
25 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
26 2643221557 Ensifer sp. Root558 Isolate Unclassified
27 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
28 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
29 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
30 2643221610 Ensifer sp. Root74 Isolate Unclassified
31 2643221618 Ensifer sp. Root231 Isolate Unclassified
32 2643221626 Ensifer sp. Root31 Isolate Unclassified
33 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
34 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
35 2643221655 Ensifer sp. Root1252 Isolate Unclassified
36 2643221659 Ensifer sp. Root127 Isolate Unclassified
37 2643221668 Ensifer sp. Root423 Isolate Unclassified
38 2643221675 Ensifer sp. Root1298 Isolate Unclassified
39 2643221680 Ensifer sp. Root1312 Isolate Unclassified
40 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
41 2643221698 Ensifer sp. Root142 Isolate Unclassified
42 2643221712 Ensifer sp. Root258 Isolate Unclassified
43 2643221723 Ensifer sp. Root278 Isolate Unclassified
44 2643221726 Ensifer sp. Root954 Isolate Unclassified
45 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
46 2738541277 Variovorax sp. GV051 Isolate Unclassified
47 2738541297 Duganella sp. GV083 Isolate Unclassified
48 2738541300 Massilia sp. GV016 Isolate Unclassified
49 2738541357 Duganella sp. GV053 Isolate Unclassified
50 2738543003 Duganella sp. GV066 Isolate Unclassified
51 2738543018 Massilia sp. GV045 Isolate Unclassified
52 2738543019 Variovorax sp. GV040 Isolate Unclassified
53 2738543026 Duganella sp. GV089 Isolate Unclassified
54 2738543029 Duganella sp. GV039 Isolate Unclassified
55 2738543030 Massilia sp. GV097 Isolate Unclassified
56 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
57 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
58 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
59 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
60 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
61 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
62 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
63 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
64 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
65 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
66 2818991457 Xanthomonas translucens 569 Isolate Unclassified
67 2821131069 Duganella sp. 1224 Isolate Unclassified
68 2844163670 Ensifer sp. 1H6 Isolate Unclassified
69 2857558681 Duganella sp. R-74565 Isolate Unclassified
70 2857564685 Duganella sp. R-74599 Isolate Unclassified
71 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
72 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
73 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
74 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
75 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
76 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
77 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
78 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
79 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
80 2909042592 Labrys sp. LIt4 Isolate Nodule
81 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
82 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
83 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
84 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
85 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
86 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
87 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
88 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
89 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
90 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
91 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
92 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
93 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
94 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
95 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
96 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
97 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
98 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
99 2928163908 Burkholderia sp. 567 Isolate Unclassified
100 2929520902 Variovorax beijingensis 502 Isolate Unclassified
101 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
102 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
103 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
104 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
105 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
106 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
107 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
108 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
109 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
110 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
111 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
112 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
113 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
114 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
115 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
116 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
117 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
118 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
119 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
120 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
121 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
122 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
123 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
124 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
125 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
126 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
127 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
128 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
129 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
130 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
131 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
132 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
133 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
134 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
135 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
136 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
137 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
138 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
139 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
140 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
141 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
142 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
143 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
144 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
145 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
146 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
147 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
148 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
149 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
150 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
151 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
152 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
153 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
154 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
155 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
156 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
157 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
158 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
159 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
160 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
161 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
162 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
163 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
164 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
165 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
166 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
167 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
168 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
169 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
170 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
171 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
172 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
173 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
174 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
175 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
176 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
177 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
178 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
179 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
180 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
181 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
182 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
183 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
184 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
185 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
186 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
187 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
188 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
189 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
190 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
191 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
192 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
193 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
194 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
195 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
196 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
197 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
198 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
199 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
200 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
201 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
202 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
203 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
204 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
205 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
206 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
207 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
208 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
209 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
210 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
211 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
212 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
213 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
214 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
215 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
216 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
217 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
218 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
219 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
220 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
221 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
222 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
223 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
224 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
225 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
226 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
227 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
228 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
229 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
230 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
231 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
232 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
233 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
234 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
235 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
236 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
237 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
238 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
239 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
240 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
241 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
242 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
243 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
244 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
245 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
246 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
247 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
248 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
249 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
250 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
251 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
252 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
253 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
254 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
255 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
256 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
257 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
258 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
259 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
260 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
261 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
262 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
263 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
264 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
265 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
266 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
267 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
268 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
269 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
270 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
271 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
272 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
273 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
274 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
275 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
276 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
277 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
278 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
279 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
280 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
281 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
282 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
283 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
284 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
285 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
286 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
287 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
288 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
289 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
290 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
291 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
292 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
293 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
295 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
296 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
298 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
299 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
300 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
303 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
347 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
348 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
350 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
353 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
354 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
355 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
356 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
357 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
358 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
359 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
360 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
361 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
362 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
363 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
364 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
365 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
366 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
367 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
368 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
369 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
370 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
371 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
372 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
373 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
374 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
375 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
376 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
377 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
378 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
379 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
380 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
381 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
382 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
383 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
384 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
385 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
386 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
387 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
390 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
391 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
392 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
393 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
394 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
395 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
396 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
397 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
398 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
399 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
400 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
401 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
402 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
403 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
404 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
405 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
406 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
407 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
408 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
409 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
410 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
411 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
412 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
413 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
414 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
415 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
416 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
417 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
418 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
423 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
424 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
425 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
426 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
427 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
428 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
429 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
430 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
431 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
437 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
438 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
439 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
440 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
441 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
442 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
443 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
444 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
445 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
446 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
447 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
448 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
449 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
450 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
451 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
452 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
453 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
454 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
455 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
467 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
468 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
469 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
470 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
471 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
472 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
473 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
474 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
475 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
478 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
479 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
480 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
481 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
482 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
483 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
484 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
485 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
486 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
487 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.29
Metatranscriptomes 0
Isolates 23.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.09
Nodule 15.76
Rhizoplane 3.63
Rhizosphere 56.62
Stem 0
Stem Tuber 0
Unclassified 15.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2558692 2162886007 Bacteria 26233
2 SwRhRL2b_contig_516673 2162886007 Bacteria 1063
3 JGI24736J21556_1000213 3300001904 Bacteria 10513
4 JGI24741J21665_1000455 3300001915 Bacteria 12414
5 JGI24740J21852_10007624 3300001979 Bacteria 4384
6 JGI24744J21845_10002140 3300002077 Bacteria 4011
7 JGI24742J22300_10004073 3300002244 Bacteria 2381
8 JGI25152J39213_1005325 3300002773 Bacteria 3787
9 JGI25159J45721_1000115 3300002987 Bacteria 38259
10 JGI25165J46597_1006826 3300003214 Bacteria 1976
11 JGI25153J46596_10002065 3300003215 Bacteria 11829
12 rootH1_10150699 3300003323 Bacteria 3887
13 rootH1_10154766 3300003323 Bacteria 4799
14 JGI25161J50226_1000067 3300003374 Bacteria 90681
15 Ga0055526_1014931 3300003771 Bacteria 3155
16 Ga0055524_1004369 3300003775 Bacteria 6526
17 Ga0055524_1014809 3300003775 Bacteria 2872
18 Ga0055536_1021076 3300003781 Bacteria 1990
19 Ga0055528_1008026 3300003790 Bacteria 4585
20 Ga0055540_1005088 3300003792 Bacteria 5676
21 Ga0055540_1018085 3300003792 Bacteria 1943
22 Ga0055531_10001400 3300003794 Bacteria 17849
23 Ga0055543_1001588 3300004625 Bacteria 8763
24 Ga0065165_1001176 3300005262 Bacteria 30422
25 Ga0065165_1033096 3300005262 Bacteria 1612
26 Ga0065704_10005660 3300005289 Bacteria 3249
27 Ga0065704_10070250 3300005289 Bacteria 48491
28 Ga0070658_10044332 3300005327 Bacteria 3595
29 Ga0070676_10035179 3300005328 Bacteria 2880
30 Ga0070666_10123109 3300005335 Bacteria 1799
31 Ga0070682_100007990 3300005337 Bacteria 5954
32 Ga0068868_100005286 3300005338 Bacteria 9070
33 Ga0070660_100000002 3300005339 Bacteria 177777
34 Ga0070660_100054533 3300005339 Bacteria 3087
35 Ga0070691_10013764 3300005341 Bacteria 3711
36 Ga0070691_10068275 3300005341 Bacteria 1721
37 Ga0070661_100148012 3300005344 Bacteria 1774
38 Ga0070692_10016432 3300005345 Bacteria 3519
39 Ga0070692_10032529 3300005345 Bacteria 2623
40 Ga0070668_100016138 3300005347 Bacteria 5589
41 Ga0070668_100437121 3300005347 Bacteria 1123
42 Ga0070669_100009003 3300005353 Bacteria 7122
43 Ga0070671_100103535 3300005355 Bacteria 2388
44 Ga0070674_100009523 3300005356 Bacteria 5818
45 Ga0070673_100206423 3300005364 Bacteria 1694
46 Ga0070688_100025484 3300005365 Bacteria 3502
47 Ga0070659_100000658 3300005366 Bacteria 25157
48 Ga0070659_100011982 3300005366 Bacteria 6419
49 Ga0070659_100019469 3300005366 Bacteria 5144
50 Ga0070667_100010119 3300005367 Bacteria 7802
51 Ga0070709_10005359 3300005434 Bacteria 6949
52 Ga0070701_10005450 3300005438 Bacteria 5259
53 Ga0070711_100000357 3300005439 Bacteria 23614
54 Ga0070705_100010866 3300005440 Bacteria 4572
55 Ga0070705_100030004 3300005440 Bacteria 2998
56 Ga0070700_100028169 3300005441 Bacteria 3338
57 Ga0070700_100105023 3300005441 Bacteria 1867
58 Ga0070694_100067271 3300005444 Bacteria 2459
59 Ga0070694_100263337 3300005444 Bacteria 1308
60 Ga0070708_100068424 3300005445 Bacteria 3192
61 Ga0070708_100381146 3300005445 Bacteria 1329
62 Ga0070663_100000708 3300005455 Bacteria 17996
63 Ga0070663_100007992 3300005455 Bacteria 6480
64 Ga0070663_100019034 3300005455 Bacteria 4515
65 Ga0070678_100006197 3300005456 Bacteria 6993
66 Ga0070662_100056981 3300005457 Bacteria 2838
67 Ga0070662_100202907 3300005457 Bacteria 1574
68 Ga0068867_100005115 3300005459 Bacteria 9267
69 Ga0070706_100439763 3300005467 Bacteria 1214
70 Ga0068853_100000661 3300005539 Bacteria 23692
71 Ga0068853_100226710 3300005539 Bacteria 1708
72 Ga0070672_100089292 3300005543 Bacteria 2483
73 Ga0070672_100144674 3300005543 Bacteria 1964
74 Ga0070695_100038041 3300005545 Bacteria 3034
75 Ga0070695_100091765 3300005545 Bacteria 2029
76 Ga0070696_100002146 3300005546 Bacteria 12982
77 Ga0070693_100005441 3300005547 Bacteria 6119
78 Ga0070665_100003169 3300005548 Bacteria 17699
79 Ga0070665_100028279 3300005548 Bacteria 5647
80 Ga0070665_100057718 3300005548 Bacteria 3891
81 Ga0070704_100002326 3300005549 Bacteria 10648
82 Ga0070704_100195611 3300005549 Bacteria 1628
83 Ga0068855_100020734 3300005563 Bacteria 7883
84 Ga0068855_100183594 3300005563 Bacteria 2364
85 Ga0068855_100400003 3300005563 Bacteria 1505
86 Ga0070664_100071128 3300005564 Bacteria 2981
87 Ga0068857_100008434 3300005577 Bacteria 8906
88 Ga0068854_100026841 3300005578 Bacteria 3962
89 Ga0068854_100056149 3300005578 Bacteria 2837
90 Ga0068856_100039442 3300005614 Bacteria 4637
91 Ga0068856_100476536 3300005614 Bacteria 1269
92 Ga0070702_100002008 3300005615 Bacteria 8579
93 Ga0068852_100006285 3300005616 Bacteria 8577
94 Ga0068852_100015186 3300005616 Bacteria 5960
95 Ga0068852_100031887 3300005616 Bacteria 4356
96 Ga0068859_100041225 3300005617 Bacteria 4637
97 Ga0068866_10001662 3300005718 Bacteria 9375
98 Ga0068861_100000260 3300005719 Bacteria 29429
99 Ga0068851_10006262 3300005834 Bacteria 5430
100 Ga0068860_100180103 3300005843 Bacteria 2042
101 Ga0068860_100442281 3300005843 Bacteria 1291
102 Ga0068862_100001680 3300005844 Bacteria 20041
103 Ga0068862_100073999 3300005844 Bacteria 2944
104 Ga0068862_100392526 3300005844 Bacteria 1296
105 Ga0070717_10190266 3300006028 Bacteria 1793
106 Ga0075363_100031360 3300006048 Bacteria 2756
107 Ga0070715_10011439 3300006163 Bacteria 3197
108 Ga0070716_100001699 3300006173 Bacteria 9937
109 Ga0070712_100057460 3300006175 Bacteria 2733
110 Ga0075367_10136570 3300006178 Bacteria 1517
111 Ga0075427_10001542 3300006194 Bacteria 2975
112 Ga0097621_100035792 3300006237 Bacteria 3969
113 Ga0075370_10012925 3300006353 Bacteria 4425
114 Ga0068871_100159711 3300006358 Bacteria 1927
115 Ga0075433_10009609 3300006852 Bacteria 7739
116 Ga0075434_100061326 3300006871 Bacteria 3741
117 Ga0075434_100389480 3300006871 Bacteria 1415
118 Ga0075429_100062276 3300006880 Bacteria 3251
119 Ga0075429_100360383 3300006880 Bacteria 1273
120 Ga0068865_100030463 3300006881 Bacteria 3589
121 Ga0097620_100041226 3300006931 Bacteria 4637
122 Ga0075435_100036306 3300007076 Bacteria 3915
123 Ga0099795_10018112 3300007788 Bacteria 2257
124 Ga0099795_10027883 3300007788 Bacteria 1915
125 Ga0105240_10000012 3300009093 Bacteria 496639
126 Ga0105240_10028333 3300009093 Bacteria 7318
127 Ga0105240_10075158 3300009093 Bacteria 4168
128 Ga0105240_10110082 3300009093 Bacteria 3335
129 Ga0105240_10113529 3300009093 Unclassified 3274
130 Ga0105240_10293499 3300009093 Bacteria 1863
131 Ga0105240_10462938 3300009093 Bacteria 1416
132 Ga0111539_10356136 3300009094 Bacteria 1703
133 Ga0105245_10000820 3300009098 Bacteria 28320
134 Ga0105247_10000364 3300009101 Bacteria 38644
135 Ga0114129_10138269 3300009147 Bacteria 3342
136 Ga0105243_10001527 3300009148 Bacteria 20228
137 Ga0105243_10048632 3300009148 Bacteria 3344
138 Ga0105243_10223723 3300009148 Bacteria 1665
139 Ga0105241_10067469 3300009174 Bacteria 2769
140 Ga0105242_10001735 3300009176 Bacteria 17213
141 Ga0105248_10004023 3300009177 Bacteria 16256
142 Ga0105237_10002001 3300009545 Bacteria 25940
143 Ga0105237_10002890 3300009545 Bacteria 20846
144 Ga0105237_10014594 3300009545 Bacteria 8209
145 Ga0105238_10006379 3300009551 Bacteria 11734
146 Ga0105238_10074767 3300009551 Bacteria 3380
147 Ga0105238_10111793 3300009551 Bacteria 2712
148 Ga0123340_1000005 3300009763 Bacteria 71174
149 Ga0123341_1003152 3300009765 Bacteria 14000
150 Ga0099796_10005037 3300010159 Bacteria 3261
151 Ga0099796_10016118 3300010159 Bacteria 2200
152 Ga0105239_10001995 3300010375 Bacteria 26528
153 Ga0105239_10007763 3300010375 Bacteria 12280
154 Ga0105239_10099021 3300010375 Bacteria 3223
155 Ga0105239_10172017 3300010375 Bacteria 2422
156 Ga0105239_10204641 3300010375 Bacteria 2212
157 Ga0105246_10066636 3300011119 Bacteria 2521
158 Ga0105246_10080551 3300011119 Bacteria 2318
159 Ga0157373_10014631 3300013100 Bacteria 5752
160 Ga0157373_10054488 3300013100 Bacteria 2841
161 Ga0157370_10004553 3300013104 Bacteria 15865
162 Ga0157370_10027359 3300013104 Bacteria 5624
163 Ga0157370_10071625 3300013104 Bacteria 3270
164 Ga0157369_10049609 3300013105 Bacteria 4550
165 Ga0171462_1014 3300013250 Bacteria 198579
166 Ga0157374_10217605 3300013296 Bacteria 1874
167 Ga0157378_10004085 3300013297 Bacteria 12897
168 Ga0157378_10178673 3300013297 Bacteria 1995
169 Ga0163162_10080786 3300013306 Bacteria 3320
170 Ga0157372_10011854 3300013307 Bacteria 9285
171 Ga0157372_10034277 3300013307 Bacteria 5580
172 Ga0157375_10044185 3300013308 Bacteria 4326
173 Ga0157375_10148690 3300013308 Bacteria 2476
174 Ga0163163_10116210 3300014325 Bacteria 2706
175 Ga0157380_10000424 3300014326 Bacteria 25659
176 Ga0182008_10008979 3300014497 Bacteria 5416
177 Ga0182008_10106787 3300014497 Bacteria 1386
178 Ga0157379_10002302 3300014968 Bacteria 15920
179 Ga0157376_10043868 3300014969 Bacteria 3672
180 Ga0182006_1003998 3300015261 Bacteria 7366
181 Ga0182006_1008274 3300015261 Bacteria 4715
182 Ga0182006_1026708 3300015261 Bacteria 2361
183 Ga0182006_1041758 3300015261 Bacteria 1799
184 Ga0182007_10002632 3300015262 Bacteria 8829
185 Ga0182005_1004268 3300015265 Bacteria 4658
186 Ga0163161_10002117 3300017792 Bacteria 14362
187 Ga0163161_10134076 3300017792 Bacteria 1870
188 Ga0213872_10000400 3300021361 Bacteria 36083
189 Ga0213872_10006612 3300021361 Bacteria 5784
190 Ga0228710_1000227 3300022740 Bacteria 59028
191 Ga0209436_100019 3300025208 Bacteria 112688
192 Ga0209437_104460 3300025233 Bacteria 2466
193 Ga0209646_1000126 3300025246 Bacteria 132815
194 Ga0209026_1002111 3300025250 Bacteria 7796
195 Ga0209677_102574 3300025253 Bacteria 6676
196 Ga0209233_1000146 3300025261 Bacteria 187269
197 Ga0209130_1000066 3300025284 Bacteria 192626
198 Ga0209676_1008431 3300025292 Bacteria 4594
199 Ga0209676_1019575 3300025292 Bacteria 2326
200 Ga0209676_1028981 3300025292 Bacteria 1716
201 Ga0209025_1000532 3300025294 Bacteria 72555
202 Ga0209025_1037718 3300025294 Bacteria 2138
203 Ga0209564_1001143 3300025295 Bacteria 31118
204 Ga0209564_1001513 3300025295 Bacteria 23230
205 Ga0209564_1002896 3300025295 Bacteria 12521
206 Ga0209564_1019821 3300025295 Bacteria 2495
207 Ga0209758_1003019 3300025297 Bacteria 16076
208 Ga0209050_1000289 3300025298 Bacteria 106319
209 Ga0209256_1002761 3300025299 Bacteria 13550
210 Ga0209256_1010139 3300025299 Bacteria 4000
211 Ga0207426_1000008 3300025302 Bacteria 848730
212 Ga0207426_1000395 3300025302 Bacteria 74251
213 Ga0209051_1005027 3300025303 Bacteria 7874
214 Ga0209051_1032810 3300025303 Bacteria 1974
215 Ga0209257_1000155 3300025304 Bacteria 182928
216 Ga0209257_1001088 3300025304 Bacteria 35525
217 Ga0209257_1003944 3300025304 Bacteria 12039
218 Ga0209257_1004056 3300025304 Bacteria 11758
219 Ga0207656_10011110 3300025321 Bacteria 3394
220 Ga0207710_10014502 3300025900 Bacteria 3325
221 Ga0207688_10026009 3300025901 Bacteria 3216
222 Ga0207680_10008650 3300025903 Bacteria 5010
223 Ga0207647_10025332 3300025904 Bacteria 3900
224 Ga0207645_10054584 3300025907 Bacteria 2552
225 Ga0207705_10055207 3300025909 Bacteria 2864
226 Ga0207695_10000120 3300025913 Bacteria 234247
227 Ga0207695_10002449 3300025913 Bacteria 27444
228 Ga0207695_10056348 3300025913 Bacteria 4090
229 Ga0207695_10329694 3300025913 Bacteria 1415
230 Ga0207671_10000023 3300025914 Bacteria 274756
231 Ga0207671_10017603 3300025914 Bacteria 5503
232 Ga0207693_10000826 3300025915 Bacteria 27503
233 Ga0207663_10062541 3300025916 Bacteria 2366
234 Ga0207657_10000012 3300025919 Bacteria 185417
235 Ga0207657_10044654 3300025919 Bacteria 3894
236 Ga0207681_10049963 3300025923 Bacteria 2829
237 Ga0207681_10302154 3300025923 Bacteria 1267
238 Ga0207694_10206026 3300025924 Bacteria 1601
239 Ga0207694_10386827 3300025924 Bacteria 1162
240 Ga0207687_10123241 3300025927 Bacteria 1942
241 Ga0207644_10317690 3300025931 Bacteria 1259
242 Ga0207690_10000008 3300025932 Bacteria 366090
243 Ga0207686_10011269 3300025934 Bacteria 4891
244 Ga0207709_10014307 3300025935 Bacteria 4380
245 Ga0207670_10022471 3300025936 Bacteria 3910
246 Ga0207669_10066263 3300025937 Bacteria 2244
247 Ga0207704_10015476 3300025938 Bacteria 3888
248 Ga0207665_10004131 3300025939 Bacteria 9674
249 Ga0207691_10040363 3300025940 Bacteria 4312
250 Ga0207691_10155009 3300025940 Bacteria 2012
251 Ga0207711_10094695 3300025941 Bacteria 2632
252 Ga0207679_10037205 3300025945 Bacteria 3458
253 Ga0207667_10003504 3300025949 Bacteria 19387
254 Ga0207668_10162751 3300025972 Bacteria 1740
255 Ga0207668_10268450 3300025972 Bacteria 1394
256 Ga0207640_10037170 3300025981 Bacteria 3062
257 Ga0207658_10122008 3300025986 Bacteria 2079
258 Ga0207677_10061878 3300026023 Bacteria 2594
259 Ga0207703_10011619 3300026035 Bacteria 6845
260 Ga0207678_10001018 3300026067 Bacteria 25567
261 Ga0207678_10014630 3300026067 Bacteria 6905
262 Ga0207708_10001860 3300026075 Bacteria 15555
263 Ga0207708_10084771 3300026075 Bacteria 2437
264 Ga0207702_10000439 3300026078 Bacteria 47451
265 Ga0207641_10573222 3300026088 Bacteria 1103
266 Ga0207648_10014364 3300026089 Bacteria 7320
267 Ga0207674_10029135 3300026116 Bacteria 5818
268 Ga0207674_10515918 3300026116 Bacteria 1154
269 Ga0207675_100000781 3300026118 Bacteria 31801
270 Ga0207675_100227666 3300026118 Bacteria 1798
271 Ga0207683_10000591 3300026121 Bacteria 33380
272 Ga0207698_10013551 3300026142 Bacteria 5385
273 Ga0207698_10027221 3300026142 Bacteria 4056
274 Ga0207698_10031154 3300026142 Bacteria 3846
275 Ga0209281_1000348 3300027111 Bacteria 76877
276 Ga0209281_1001492 3300027111 Bacteria 13414
277 Ga0209281_1002977 3300027111 Bacteria 6033
278 Ga0209282_1000070 3300027666 Bacteria 85274
279 Ga0209588_1023155 3300027671 Bacteria 1957
280 Ga0209813_10000187 3300027866 Bacteria 19692
281 Ga0268266_10002913 3300028379 Bacteria 17710
282 Ga0268266_10031259 3300028379 Bacteria 4520
283 Ga0268266_10070116 3300028379 Bacteria 3038
284 Ga0268264_10092396 3300028381 Bacteria 2612
285 Ga0268264_10193344 3300028381 Bacteria 1856
286 Ga0307517_10041405 3300028786 Bacteria 4976
287 Ga0307517_10164914 3300028786 Bacteria 1475
288 Ga0307515_10006952 3300028794 Bacteria 22469
289 Ga0307515_10286332 3300028794 Bacteria 1349
290 Ga0307513_10000703 3300031456 Bacteria 48051
291 Ga0307513_10000984 3300031456 Bacteria 41224
292 Ga0307513_10002296 3300031456 Bacteria 26693
293 Ga0307513_10019533 3300031456 Bacteria 8066
294 Ga0307513_10052970 3300031456 Bacteria 4365
295 Ga0307509_10120587 3300031507 Bacteria 2601
296 Ga0307408_100116162 3300031548 Bacteria 2065
297 Ga0307408_100121579 3300031548 Bacteria 2023
298 Ga0307508_10026330 3300031616 Bacteria 5270
299 Ga0307514_10010993 3300031649 Bacteria 7554
300 Ga0307406_10004554 3300031901 Bacteria 7550
301 Ga0307412_10090085 3300031911 Bacteria 2143
302 Ga0307412_10120330 3300031911 Bacteria 1889
303 Ga0315914_1000082 3300031967 Bacteria 78317
304 Ga0307414_10137534 3300032004 Bacteria 1907
305 Ga0307510_10010889 3300033180 Bacteria 10807
306 Ga0315913_1000028 3300033430 Bacteria 78319
307 Ga0315915_1000004 3300033464 Bacteria 403083
308 Ga0373962_0008811 3300035242 Bacteria 2491
309 Ga0373931_0015831 3300035691 Bacteria 3703
310 Ga0395899_0111611 3300037312 Bacteria 1965
311 Ga0395900_0085036 3300037418 Bacteria 3251
312 Ga0395905_0000057 3300037471 Bacteria 203452
313 Ga0395905_0000388 3300037471 Bacteria 62670
314 Ga0395905_0040901 3300037471 Bacteria 4348
315 Ga0395901_0156877 3300038443 Bacteria 2390
316 Ga0436361_0660576 3300039447 Bacteria 2292
317 Ga0436361_0886293 3300039447 Bacteria 22531
318 Ga0436361_1045937 3300039447 Bacteria 9057
319 Ga0439436_0003496 3300041404 Bacteria 4777
320 Ga0439436_0055417 3300041404 Bacteria 1114
321 Ga0439466_0000817 3300041411 Bacteria 11861
322 Ga0439465_0000099 3300041413 Bacteria 19766
323 Ga0439431_0002493 3300041997 Bacteria 4074
324 Ga0439433_0001261 3300041999 Bacteria 5226
325 Ga0439442_003511 3300042002 Bacteria 3099
326 Ga0439432_000645 3300042006 Bacteria 13060
327 Ga0439449_0001392 3300042007 Bacteria 9448
328 Ga0439449_0002167 3300042007 Bacteria 7718
329 Ga0439452_001701 3300042010 Bacteria 8652
330 Ga0439463_026951 3300042016 Bacteria 1445
331 Ga0439434_0014254 3300042435 Bacteria 2364
332 Ga0450918_011755 3300042531 Unclassified 1524
333 Ga0466986_0066415 3300044650 Bacteria 2497
334 Ga0495617_000004 3300046452 Bacteria 511274
335 Ga0495617_001586 3300046452 Bacteria 9824
336 Ga0495617_007423 3300046452 Bacteria 3803
337 Ga0495603_0018666 3300046455 Bacteria 4195
338 Ga0495603_0035994 3300046455 Bacteria 2972
339 Ga0495590_0013437 3300046457 Bacteria 3010
340 Ga0495638_0001529 3300046460 Bacteria 20835
341 Ga0495638_0001906 3300046460 Bacteria 17977
342 Ga0495638_0002495 3300046460 Bacteria 14975
343 Ga0495638_0081549 3300046460 Bacteria 1964
344 Ga0495653_0000044 3300046463 Bacteria 115591
345 Ga0495650_0002214 3300046471 Bacteria 16366
346 Ga0495580_0003570 3300046472 Bacteria 13212
347 Ga0495580_0004911 3300046472 Bacteria 11183
348 Ga0495605_0015262 3300046474 Bacteria 4183
349 Ga0495584_0000005 3300046491 Bacteria 306957
350 Ga0495584_0000901 3300046491 Bacteria 19022
351 Ga0495584_0128443 3300046491 Bacteria 1285
352 Ga0495585_0000023 3300046492 Bacteria 149218
353 Ga0495585_0000264 3300046492 Bacteria 52455
354 Ga0495585_0001274 3300046492 Bacteria 20169
355 Ga0495585_0032064 3300046492 Bacteria 2979
356 Ga0495585_0048142 3300046492 Bacteria 2371
357 Ga0495585_0070074 3300046492 Bacteria 1913
358 Ga0495585_0100835 3300046492 Bacteria 1544
359 Ga0495596_0004811 3300046500 Bacteria 6495
360 Ga0495596_0005439 3300046500 Bacteria 6016
361 Ga0495607_0037877 3300046501 Bacteria 2892
362 Ga0495607_0053035 3300046501 Bacteria 2345
363 Ga0495583_0001097 3300046506 Bacteria 29963
364 Ga0495583_0010635 3300046506 Bacteria 5350
365 Ga0495583_0053430 3300046506 Bacteria 1833
366 Ga0495606_0000080 3300046507 Bacteria 161866
367 Ga0495606_0000175 3300046507 Bacteria 113577
368 Ga0495606_0000563 3300046507 Bacteria 58807
369 Ga0495606_0000883 3300046507 Bacteria 44862
370 Ga0495606_0031533 3300046507 Bacteria 3683
371 Ga0495606_0034156 3300046507 Bacteria 3495
372 Ga0495606_0071289 3300046507 Bacteria 2188
373 Ga0495610_0000010 3300046512 Bacteria 538821
374 Ga0495616_0000355 3300046513 Bacteria 35882
375 Ga0495616_0003675 3300046513 Bacteria 9798
376 Ga0495616_0022692 3300046513 Bacteria 3386
377 Ga0495616_0028641 3300046513 Bacteria 2948
378 Ga0495620_0012841 3300046515 Bacteria 4306
379 Ga0495632_0000307 3300046519 Bacteria 47308
380 Ga0495632_0015169 3300046519 Bacteria 4332
381 Ga0495637_0009128 3300046520 Bacteria 4843
382 Ga0495637_0083274 3300046520 Bacteria 1272
383 Ga0495643_0020268 3300046522 Bacteria 3836
384 Ga0495648_0000048 3300046524 Bacteria 164840
385 Ga0495648_0002921 3300046524 Bacteria 15354
386 Ga0495648_0006525 3300046524 Bacteria 9503
387 Ga0495648_0030044 3300046524 Bacteria 3599
388 Ga0495654_0006501 3300046530 Bacteria 6635
389 Ga0495654_0115277 3300046530 Bacteria 1222
390 Ga0495665_0040085 3300046531 Bacteria 2494
391 Ga0495609_0011325 3300046538 Bacteria 4250
392 Ga0495609_0057703 3300046538 Bacteria 1718
393 Ga0495597_0006248 3300046542 Bacteria 6176
394 Ga0495597_0044826 3300046542 Bacteria 1965
395 Ga0495622_0000055 3300046557 Bacteria 102577
396 Ga0495622_0104393 3300046557 Bacteria 1298
397 Ga0495633_0000702 3300046558 Bacteria 30531
398 Ga0495633_0001317 3300046558 Bacteria 19570
399 Ga0495633_0081558 3300046558 Bacteria 1505
400 Ga0495633_0136575 3300046558 Bacteria 1134
401 Ga0495656_0000897 3300046615 Bacteria 9639
402 Ga0495668_0000014 3300046616 Bacteria 442055
403 Ga0495668_0001721 3300046616 Bacteria 20164
404 Ga0495611_0013856 3300046648 Bacteria 3439
405 Ga0495611_0084941 3300046648 Bacteria 1459
406 Ga0495625_0004405 3300046660 Bacteria 13347
407 Ga0495625_0005069 3300046660 Bacteria 12195
408 Ga0495625_0063847 3300046660 Bacteria 2600
409 Ga0495659_0014756 3300046664 Bacteria 2562
410 Ga0495661_0039227 3300046665 Bacteria 2944
411 Ga0495661_0126691 3300046665 Bacteria 1404
412 Ga0495670_0000835 3300046691 Bacteria 14893
413 Ga0495670_0002745 3300046691 Bacteria 8700
414 Ga0495670_0051150 3300046691 Bacteria 2068
415 Ga0495671_0006445 3300046692 Bacteria 6776
416 Ga0495671_0008669 3300046692 Bacteria 5711
417 Ga0495660_0002139 3300046810 Bacteria 12745
418 Ga0495660_0011379 3300046810 Bacteria 5166
419 Ga0495660_0070282 3300046810 Bacteria 1859
420 Ga0495660_0105958 3300046810 Bacteria 1440
421 Ga0495636_0006196 3300047318 Bacteria 4697
422 Ga0495674_0013307 3300047319 Bacteria 7736
423 Ga0495674_0463725 3300047319 Bacteria 1017
424 Ga0495672_0019850 3300047320 Bacteria 4420
425 Ga0495683_0000083 3300047323 Bacteria 93743
426 Ga0495683_0011803 3300047323 Bacteria 4595
427 Ga0495683_0042323 3300047323 Bacteria 2296
428 Ga0495687_007896 3300047443 Bacteria 6186
429 Ga0495687_023756 3300047443 Bacteria 2924
430 Ga0495679_065268 3300047446 Bacteria 1059
431 Ga0495673_0000027 3300047469 Bacteria 475440
432 Ga0495673_0000028 3300047469 Bacteria 473418
433 Ga0495673_0000207 3300047469 Bacteria 89423
434 Ga0495673_0020080 3300047469 Bacteria 3333
435 Ga0495673_0037313 3300047469 Bacteria 2220
436 Ga0495681_0002701 3300047470 Bacteria 12563
437 Ga0495681_0131258 3300047470 Bacteria 1066
438 Ga0495686_0000670 3300047472 Bacteria 46425
439 Ga0495686_0002926 3300047472 Bacteria 15309
440 Ga0495686_0076116 3300047472 Bacteria 2056
441 Ga0495686_0166823 3300047472 Bacteria 1283
442 Ga0495626_0001187 3300048091 Bacteria 21620
443 Ga0495626_0014465 3300048091 Bacteria 4067
444 Ga0496100_0001141 3300048903 Bacteria 12906
445 Ga0496100_0015722 3300048903 Bacteria 4424
446 Ga0496100_0018264 3300048903 Bacteria 4156
447 Ga0496101_0000393 3300048904 Bacteria 28520
448 Ga0496101_0021531 3300048904 Bacteria 4430
449 Ga0496101_0033024 3300048904 Bacteria 3647
450 Ga0496101_0074867 3300048904 Bacteria 2491
451 Ga0496101_0137564 3300048904 Bacteria 1860
452 Ga0496102_0000874 3300048905 Bacteria 28778
453 Ga0496102_0001639 3300048905 Bacteria 19731
454 Ga0496103_0001138 3300048906 Bacteria 18488
455 Ga0496103_0008266 3300048906 Bacteria 6179
456 Ga0496103_0013514 3300048906 Bacteria 4843
457 Ga0496105_0120515 3300048908 Bacteria 2163
458 Ga0496105_0214923 3300048908 Bacteria 1566
459 Ga0496106_0000126 3300048909 Bacteria 58930
460 Ga0496106_0044584 3300048909 Bacteria 3329
461 Ga0496106_0179716 3300048909 Bacteria 1679
462 Ga0496107_0007043 3300048910 Bacteria 7745
463 Ga0496111_0378899 3300048914 Bacteria 1046
464 Ga0496112_0249491 3300048915 Bacteria 1726
465 Ga0496113_0005655 3300048916 Bacteria 7823
466 Ga0496114_0019735 3300048917 Bacteria 5463
467 Ga0496115_0054324 3300048918 Bacteria 3216
468 Ga0496116_0000465 3300048919 Bacteria 56103
469 Ga0496116_0000582 3300048919 Bacteria 48827
470 Ga0496116_0001025 3300048919 Bacteria 34122
471 Ga0496116_0004319 3300048919 Bacteria 13599
472 Ga0496116_0006396 3300048919 Bacteria 10696
473 Ga0496116_0041604 3300048919 Bacteria 3151
474 Ga0496116_0081761 3300048919 Bacteria 2001
475 Ga0496117_0000237 3300048920 Bacteria 104534
476 Ga0496117_0001748 3300048920 Bacteria 29936
477 Ga0496117_0010105 3300048920 Bacteria 8663
478 Ga0496117_0039802 3300048920 Bacteria 3465
479 Ga0496118_0000280 3300048921 Bacteria 89951
480 Ga0496118_0000563 3300048921 Bacteria 61249
481 Ga0496118_0015531 3300048921 Bacteria 7043
482 Ga0496118_0072534 3300048921 Bacteria 2472
483 Ga0496119_0000107 3300048922 Bacteria 116784
484 Ga0496119_0054098 3300048922 Bacteria 2446
485 Ga0496120_0000011 3300048923 Bacteria 365549
486 Ga0496120_0009021 3300048923 Bacteria 7128
487 Ga0496120_0034733 3300048923 Bacteria 3018
488 Ga0496121_0000872 3300048924 Bacteria 54529
489 Ga0496121_0002797 3300048924 Bacteria 25842
490 Ga0496121_0003047 3300048924 Bacteria 24306
491 Ga0496121_0003612 3300048924 Bacteria 21840
492 Ga0496121_0025282 3300048924 Bacteria 5641
493 Ga0496121_0030699 3300048924 Bacteria 4930
494 Ga0496121_0077364 3300048924 Bacteria 2649
495 Ga0496122_0000253 3300048925 Bacteria 120534
496 Ga0496122_0009990 3300048925 Bacteria 9880
497 Ga0496122_0036208 3300048925 Bacteria 3997
498 Ga0496122_0039135 3300048925 Bacteria 3785
499 Ga0496122_0128803 3300048925 Bacteria 1613
500 Ga0496123_0000206 3300048926 Bacteria 120598
501 Ga0496123_0000934 3300048926 Bacteria 45665
502 Ga0496123_0001228 3300048926 Bacteria 37305
503 Ga0496123_0085754 3300048926 Bacteria 1892
504 Ga0496124_0000975 3300048927 Bacteria 45532
505 Ga0496124_0002433 3300048927 Bacteria 24399
506 Ga0496124_0008394 3300048927 Bacteria 10804
507 Ga0496124_0013234 3300048927 Bacteria 8068
508 Ga0496124_0020768 3300048927 Bacteria 6061
509 Ga0496124_0031787 3300048927 Bacteria 4668
510 Ga0496125_0000134 3300048928 Bacteria 161449
511 Ga0496125_0004107 3300048928 Bacteria 17013
512 Ga0496125_0184911 3300048928 Bacteria 1383
513 Ga0496126_0000437 3300048929 Bacteria 83133
514 Ga0496126_0004530 3300048929 Bacteria 16531
515 Ga0495682_0014188 3300049460 Bacteria 3023
516 Ga0495682_0040269 3300049460 Bacteria 1713
517 Ga0501032_0032032 3300049569 Bacteria 3603
518 Ga0501033_0008913 3300049570 Bacteria 7750
519 Ga0501034_0101754 3300049571 Bacteria 2867
520 Ga0501034_0274170 3300049571 Bacteria 1627
521 Ga0501036_0053018 3300049572 Bacteria 3435
522 Ga0501037_0103702 3300049573 Bacteria 2051
523 Ga0501043_0045098 3300049579 Bacteria 3467
524 Ga0501046_0132894 3300049580 Bacteria 1887
525 Ga0501047_0219729 3300049581 Bacteria 1756
526 Ga0501070_0002495 3300049586 Bacteria 16123
527 Ga0501035_0042064 3300049822 Bacteria 4122
528 Ga0501044_0018501 3300049823 Bacteria 7464
529 Ga0501044_0074950 3300049823 Bacteria 3436
530 nmdc:mga06z11_285_c1 3300050494 Bacteria 19690
531 nmdc:mga04h51_154_c1 3300050495 Bacteria 19692
532 nmdc:mga07m45_6578_c1 3300050496 Bacteria 5886
533 nmdc:mga05p37_758099_c1 3300050507 Bacteria 1069
534 nmdc:mga09592_13505_c1 3300050508 Bacteria 6671
535 nmdc:mga06r32_661698_c1 3300050510 Bacteria 1012
536 nmdc:mga08y16_320188_c1 3300050511 Bacteria 1597
537 nmdc:mga0n895_172095_c1 3300050512 Bacteria 2198
538 nmdc:mga0rr50_35710_c1 3300050513 Bacteria 3572
539 nmdc:mga0sz30_12905_c2 3300050516 Bacteria 2165
540 nmdc:mga0sz30_50831_c1 3300050516 Bacteria 1758
541 Ga0500578_0050899 3300053086 Bacteria 2655
542 Ga0500572_027281 3300053111 Bacteria 1563
543 Ga0500595_026370 3300053119 Bacteria 2003
544 Ga0500618_001244 3300053125 Bacteria 11923
545 Ga0500586_004733 3300053145 Bacteria 3374
546 Ga0500636_0001314 3300053177 Bacteria 13489
547 Ga0500645_002253 3300053730 Bacteria 8771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237086 2513585153 282
2 iso_pu_bacteria 2551306084 2551679139 282
3 iso_pu_bacteria 2551306084 2551680993 282
4 iso_pu_bacteria 2551306085 2551686042 282
5 iso_pu_bacteria 2551306087 2551701967 282
6 iso_pu_bacteria 2551306090 2551717048 282
7 iso_pu_bacteria 2551306093 2551740515 282
8 iso_pu_bacteria 2916068649 2916071071 282
9 iso_pu_bacteria 2921289301 2921292502 282
10 iso_pu_bacteria 2924165586 2924168975 282
11 iso_pu_bacteria 2924186466 2924189311 282
12 iso_pu_bacteria 2957505466 2957508371 282
13 iso_pu_bacteria 2960645483 2960651719 282
14 iso_pu_bacteria 2970191845 2970193192 282
15 3300025294 Ga0209025_1000532 Ga0209025_100053284 283
16 iso_pu_bacteria 2903748898 2903751148 287
17 3300048927 Ga0496124_0000975 Ga0496124_0000975_22364_23230 288
18 3300049571 Ga0501034_0101754 Ga0501034_0101754_347_1315 288
19 iso_pu_bacteria 2515154107 2515610142 288
20 3300001915 JGI24741J21665_1000455 JGI24741J21665_10004556 291
21 3300005564 Ga0070664_100071128 Ga0070664_1000711282 291
22 3300005577 Ga0068857_100008434 Ga0068857_1000084347 291
23 3300005578 Ga0068854_100026841 Ga0068854_1000268412 291
24 3300005614 Ga0068856_100039442 Ga0068856_1000394422 291
25 3300005616 Ga0068852_100031887 Ga0068852_1000318873 291
26 3300005834 Ga0068851_10006262 Ga0068851_100062627 291
27 3300013105 Ga0157369_10049609 Ga0157369_100496095 291
28 3300013307 Ga0157372_10034277 Ga0157372_100342772 291
29 3300025321 Ga0207656_10011110 Ga0207656_100111102 291
30 3300025904 Ga0207647_10025332 Ga0207647_100253322 291
31 3300025945 Ga0207679_10037205 Ga0207679_100372053 291
32 3300025981 Ga0207640_10037170 Ga0207640_100371702 291
33 3300026067 Ga0207678_10014630 Ga0207678_100146302 291
34 3300026078 Ga0207702_10000439 Ga0207702_1000043948 291
35 3300026116 Ga0207674_10029135 Ga0207674_100291352 291
36 3300026142 Ga0207698_10013551 Ga0207698_100135517 291
37 3300049573 Ga0501037_0103702 Ga0501037_0103702_34_1020 291
38 3300001904 JGI24736J21556_1000213 JGI24736J21556_10002135 292
39 3300001979 JGI24740J21852_10007624 JGI24740J21852_100076244 292
40 3300013104 Ga0157370_10027359 Ga0157370_100273592 292
41 3300048919 Ga0496116_0081761 Ga0496116_0081761_1081_1959 292
42 3300047446 Ga0495679_065268 Ga0495679_065268_36_929 293
43 3300010375 Ga0105239_10099021 Ga0105239_100990212 294
44 3300005455 Ga0070663_100019034 Ga0070663_1000190342 296
45 3300047469 Ga0495673_0037313 Ga0495673_0037313_860_1828 296
46 3300047472 Ga0495686_0000670 Ga0495686_0000670_21497_22465 296
47 3300009093 Ga0105240_10462938 Ga0105240_104629381 299
48 3300050496 nmdc:mga07m45_6578_c1 nmdc:mga07m45_6578_c1_2276_3235 299
49 3300049569 Ga0501032_0032032 Ga0501032_0032032_1990_2958 300
50 3300049570 Ga0501033_0008913 Ga0501033_0008913_653_1621 300
51 3300049571 Ga0501034_0274170 Ga0501034_0274170_619_1587 300
52 3300049572 Ga0501036_0053018 Ga0501036_0053018_653_1621 300
53 3300049580 Ga0501046_0132894 Ga0501046_0132894_279_1247 300
54 3300049581 Ga0501047_0219729 Ga0501047_0219729_757_1725 300
55 3300049822 Ga0501035_0042064 Ga0501035_0042064_2501_3469 300
56 3300049823 Ga0501044_0074950 Ga0501044_0074950_1816_2784 300
57 3300048925 Ga0496122_0009990 Ga0496122_0009990_5212_6183 301
58 3300048926 Ga0496123_0000934 Ga0496123_0000934_3682_4653 301
59 3300048927 Ga0496124_0020768 Ga0496124_0020768_2111_3082 301
60 3300049579 Ga0501043_0045098 Ga0501043_0045098_768_1736 301
61 3300027111 Ga0209281_1002977 Ga0209281_10029775 302
62 3300005543 Ga0070672_100089292 Ga0070672_1000892922 303
63 3300013100 Ga0157373_10054488 Ga0157373_100544884 303
64 3300015261 Ga0182006_1041758 Ga0182006_10417581 303
65 3300025940 Ga0207691_10040363 Ga0207691_100403632 303
66 3300042016 Ga0439463_026951 Ga0439463_026951_398_1381 303
67 3300046492 Ga0495585_0070074 Ga0495585_0070074_120_1088 303
68 3300006353 Ga0075370_10012925 Ga0075370_100129252 304
69 3300046506 Ga0495583_0001097 Ga0495583_0001097_15751_16677 304
70 3300048925 Ga0496122_0039135 Ga0496122_0039135_23_964 304
71 3300049586 Ga0501070_0002495 Ga0501070_0002495_2899_3825 304
72 3300046500 Ga0495596_0004811 Ga0495596_0004811_711_1682 305
73 3300048091 Ga0495626_0001187 Ga0495626_0001187_8560_9531 305
74 3300009093 Ga0105240_10110082 Ga0105240_101100823 306
75 3300025304 Ga0209257_1004056 Ga0209257_10040566 306
76 3300046452 Ga0495617_001586 Ga0495617_001586_1289_2242 306
77 3300046520 Ga0495637_0083274 Ga0495637_0083274_87_1040 306
78 3300046519 Ga0495632_0000307 Ga0495632_0000307_28457_29428 307
79 3300046507 Ga0495606_0000563 Ga0495606_0000563_29728_30693 308
80 iso_pu_bacteria 2900577576 2900582656 308
81 3300050510 nmdc:mga06r32_661698_c1 nmdc:mga06r32_661698_c1_15_983 309
82 iso_pu_bacteria 2582581299 2585228253 309
83 iso_pu_bacteria 2881853255 2881853737 309
84 iso_pu_bacteria 2885350715 2885351180 309
85 iso_pu_bacteria 2928157003 2928157187 309
86 2162886007 SwRhRL2b_contig_516673 SwRhRL2b_0687.00000420 310
87 3300050508 nmdc:mga09592_13505_c1 nmdc:mga09592_13505_c1_3496_4467 310
88 3300050512 nmdc:mga0n895_172095_c1 nmdc:mga0n895_172095_c1_257_1228 310
89 3300050513 nmdc:mga0rr50_35710_c1 nmdc:mga0rr50_35710_c1_39_1010 310
90 3300013250 Ga0171462_1014 Ga0171462_101431 311
91 3300046460 Ga0495638_0081549 Ga0495638_0081549_108_1106 311
92 3300046524 Ga0495648_0006525 Ga0495648_0006525_1743_2711 311
93 3300003792 Ga0055540_1018085 Ga0055540_10180851 312
94 3300025303 Ga0209051_1005027 Ga0209051_10050275 312
95 3300044650 Ga0466986_0066415 Ga0466986_0066415_1141_2091 312
96 iso_pu_bacteria 2643221562 2643831443 312
97 iso_pu_bacteria 2643221563 2643833291 312
98 iso_pu_bacteria 2643221608 2644054218 312
99 3300005289 Ga0065704_10005660 Ga0065704_100056602 313
100 3300005345 Ga0070692_10016432 Ga0070692_100164323 313
101 3300005440 Ga0070705_100030004 Ga0070705_1000300041 313
102 3300005444 Ga0070694_100263337 Ga0070694_1002633371 313
103 3300005445 Ga0070708_100068424 Ga0070708_1000684241 313
104 3300005545 Ga0070695_100038041 Ga0070695_1000380412 313
105 3300005549 Ga0070704_100195611 Ga0070704_1001956113 313
106 3300005843 Ga0068860_100180103 Ga0068860_1001801032 313
107 3300005844 Ga0068862_100073999 Ga0068862_1000739993 313
108 3300006194 Ga0075427_10001542 Ga0075427_100015422 313
109 3300006852 Ga0075433_10009609 Ga0075433_100096094 313
110 3300006871 Ga0075434_100061326 Ga0075434_1000613263 313
111 3300007076 Ga0075435_100036306 Ga0075435_1000363063 313
112 3300007788 Ga0099795_10027883 Ga0099795_100278831 313
113 3300009094 Ga0111539_10356136 Ga0111539_103561362 313
114 3300009098 Ga0105245_10000820 Ga0105245_1000082014 313
115 3300009101 Ga0105247_10000364 Ga0105247_1000036440 313
116 3300009148 Ga0105243_10001527 Ga0105243_100015273 313
117 3300009148 Ga0105243_10048632 Ga0105243_100486322 313
118 3300009174 Ga0105241_10067469 Ga0105241_100674693 313
119 3300009176 Ga0105242_10001735 Ga0105242_100017354 313
120 3300009177 Ga0105248_10004023 Ga0105248_1000402317 313
121 3300009545 Ga0105237_10014594 Ga0105237_100145944 313
122 3300010375 Ga0105239_10001995 Ga0105239_1000199522 313
123 3300011119 Ga0105246_10080551 Ga0105246_100805512 313
124 3300013296 Ga0157374_10217605 Ga0157374_102176052 313
125 3300013297 Ga0157378_10004085 Ga0157378_1000408512 313
126 3300013306 Ga0163162_10080786 Ga0163162_100807864 313
127 3300013307 Ga0157372_10011854 Ga0157372_1001185412 313
128 3300013308 Ga0157375_10044185 Ga0157375_100441853 313
129 3300014326 Ga0157380_10000424 Ga0157380_1000042417 313
130 3300014968 Ga0157379_10002302 Ga0157379_1000230216 313
131 3300014969 Ga0157376_10043868 Ga0157376_100438681 313
132 3300025923 Ga0207681_10049963 Ga0207681_100499633 313
133 3300028381 Ga0268264_10193344 Ga0268264_101933443 313
134 3300039447 Ga0436361_0660576 Ga0436361_0660576_980_1933 313
135 3300039447 Ga0436361_0886293 Ga0436361_0886293_4801_5754 313
136 3300039447 Ga0436361_1045937 Ga0436361_1045937_1198_2151 313
137 3300046492 Ga0495585_0048142 Ga0495585_0048142_287_1240 313
138 3300046492 Ga0495585_0100835 Ga0495585_0100835_474_1427 313
139 3300046507 Ga0495606_0031533 Ga0495606_0031533_15_977 313
140 3300046558 Ga0495633_0081558 Ga0495633_0081558_390_1343 313
141 3300047318 Ga0495636_0006196 Ga0495636_0006196_1695_2648 313
142 3300047319 Ga0495674_0463725 Ga0495674_0463725_35_988 313
143 3300048914 Ga0496111_0378899 Ga0496111_0378899_75_1028 313
144 3300048919 Ga0496116_0041604 Ga0496116_0041604_1365_2318 313
145 3300048921 Ga0496118_0072534 Ga0496118_0072534_933_1886 313
146 3300048928 Ga0496125_0184911 Ga0496125_0184911_91_1044 313
147 3300050516 nmdc:mga0sz30_12905_c2 nmdc:mga0sz30_12905_c2_58_1011 313
148 iso_pu_bacteria 2599185354 2600203498 313
149 iso_pu_bacteria 2643221687 2644485576 313
150 iso_pu_bacteria 2937848649 2937853840 313
151 iso_pu_bacteria 2977922695 2977929002 313
152 iso_pu_bacteria 3004211236 3004213143 313
153 iso_pu_bacteria 3004218560 3004221514 313
154 3300046515 Ga0495620_0012841 Ga0495620_0012841_2783_3748 314
155 3300047472 Ga0495686_0166823 Ga0495686_0166823_222_1190 314
156 iso_pu_bacteria 2511231052 2511499207 314
157 iso_pu_bacteria 2512875026 2512975052 314
158 iso_pu_bacteria 2513237156 2513986996 314
159 iso_pu_bacteria 2513237160 2514007879 314
160 iso_pu_bacteria 2513237164 2514039729 314
161 iso_pu_bacteria 2517487022 2517567695 314
162 iso_pu_bacteria 2551306091 2551725766 314
163 iso_pu_bacteria 2562617112 2563063406 314
164 iso_pu_bacteria 2582581308 2585278342 314
165 iso_pu_bacteria 2582581315 2585328620 314
166 iso_pu_bacteria 2582581316 2585332249 314
167 iso_pu_bacteria 2585427527 2585532001 314
168 iso_pu_bacteria 2585427530 2585552361 314
169 iso_pu_bacteria 2585428057 2587728156 314
170 iso_pu_bacteria 2615840626 2616307860 314
171 iso_pu_bacteria 2643221557 2643805119 314
172 iso_pu_bacteria 2643221610 2644065644 314
173 iso_pu_bacteria 2643221618 2644104905 314
174 iso_pu_bacteria 2643221626 2644150206 314
175 iso_pu_bacteria 2643221634 2644193849 314
176 iso_pu_bacteria 2643221643 2644238079 314
177 iso_pu_bacteria 2643221655 2644307447 314
178 iso_pu_bacteria 2643221659 2644335163 314
179 iso_pu_bacteria 2643221668 2644375383 314
180 iso_pu_bacteria 2643221675 2644417936 314
181 iso_pu_bacteria 2643221680 2644451108 314
182 iso_pu_bacteria 2643221698 2644541444 314
183 iso_pu_bacteria 2643221712 2644613531 314
184 iso_pu_bacteria 2643221723 2644673637 314
185 iso_pu_bacteria 2643221726 2644687456 314
186 iso_pu_bacteria 2711768613 2713474281 314
187 iso_pu_bacteria 2738541277 2738722351 314
188 iso_pu_bacteria 2738541297 2738830347 314
189 iso_pu_bacteria 2738541300 2738845433 314
190 iso_pu_bacteria 2738541357 2739154143 314
191 iso_pu_bacteria 2738543003 2739196063 314
192 iso_pu_bacteria 2738543018 2739276486 314
193 iso_pu_bacteria 2738543019 2739282715 314
194 iso_pu_bacteria 2738543026 2739322539 314
195 iso_pu_bacteria 2738543029 2739340780 314
196 iso_pu_bacteria 2738543030 2739345530 314
197 iso_pu_bacteria 2751185821 2753463446 314
198 iso_pu_bacteria 2765235802 2765464509 314
199 iso_pu_bacteria 2802428858 2802721088 314
200 iso_pu_bacteria 2802428859 2802728177 314
201 iso_pu_bacteria 2802428860 2802733642 314
202 iso_pu_bacteria 2802428861 2802736615 314
203 iso_pu_bacteria 2802428862 2802746681 314
204 iso_pu_bacteria 2802428863 2802749820 314
205 iso_pu_bacteria 2818991438 2819554830 314
206 iso_pu_bacteria 2818991453 2819640246 314
207 iso_pu_bacteria 2821131069 2821133431 314
208 iso_pu_bacteria 2844163670 2844169895 314
209 iso_pu_bacteria 2857558681 2857559674 314
210 iso_pu_bacteria 2857564685 2857568209 314
211 iso_pu_bacteria 2858800743 2858804802 314
212 iso_pu_bacteria 2874123672 2874126892 314
213 iso_pu_bacteria 2885326080 2885327892 314
214 iso_pu_bacteria 2889010040 2889014905 314
215 iso_pu_bacteria 2902837492 2902843373 314
216 iso_pu_bacteria 2909042592 2909045400 314
217 iso_pu_bacteria 2915980308 2915986767 314
218 iso_pu_bacteria 2916028427 2916032354 314
219 iso_pu_bacteria 2916055098 2916056490 314
220 iso_pu_bacteria 2916061851 2916064109 314
221 iso_pu_bacteria 2919527303 2919533566 314
222 iso_pu_bacteria 2921201388 2921206498 314
223 iso_pu_bacteria 2921250672 2921254026 314
224 iso_pu_bacteria 2921263974 2921265519 314
225 iso_pu_bacteria 2921643360 2921655653 314
226 iso_pu_bacteria 2924158325 2924162722 314
227 iso_pu_bacteria 2924172951 2924174035 314
228 iso_pu_bacteria 2924193448 2924198706 314
229 iso_pu_bacteria 2924207177 2924208609 314
230 iso_pu_bacteria 2928163908 2928169016 314
231 iso_pu_bacteria 2929520902 2929525084 314
232 iso_pu_bacteria 2937029754 2937035437 314
233 iso_pu_bacteria 2937036028 2937039975 314
234 iso_pu_bacteria 2937042894 2937047125 314
235 iso_pu_bacteria 2937063883 2937068121 314
236 iso_pu_bacteria 2937071275 2937075524 314
237 iso_pu_bacteria 2937078374 2937078997 314
238 iso_pu_bacteria 2937084907 2937084915 314
239 iso_pu_bacteria 2937098957 2937103243 314
240 iso_pu_bacteria 2937106411 2937110636 314
241 iso_pu_bacteria 2937126314 2937126406 314
242 iso_pu_bacteria 2937822353 2937825510 314
243 iso_pu_bacteria 2939582691 2939585324 314
244 iso_pu_bacteria 2941499720 2941505448 314
245 iso_pu_bacteria 2945934425 2945939691 314
246 iso_pu_bacteria 2945972063 2945972208 314
247 iso_pu_bacteria 2957375807 2957376278 314
248 iso_pu_bacteria 2957388812 2957390967 314
249 iso_pu_bacteria 2957415311 2957415854 314
250 iso_pu_bacteria 2957437181 2957441001 314
251 iso_pu_bacteria 2957443900 2957448162 314
252 iso_pu_bacteria 2957457609 2957462342 314
253 iso_pu_bacteria 2957478035 2957478086 314
254 iso_pu_bacteria 2960591022 2960597426 314
255 iso_pu_bacteria 2960603979 2960606094 314
256 iso_pu_bacteria 2960617483 2960620644 314
257 iso_pu_bacteria 2960624210 2960629478 314
258 iso_pu_bacteria 2960631154 2960636618 314
259 iso_pu_bacteria 2960660292 2960665954 314
260 iso_pu_bacteria 2960680706 2960686128 314
261 iso_pu_bacteria 2960693952 2960695762 314
262 iso_pu_bacteria 2964643177 2964644685 314
263 iso_pu_bacteria 2964663802 2964664568 314
264 iso_pu_bacteria 2964670856 2964674661 314
265 iso_pu_bacteria 2964691889 2964694474 314
266 iso_pu_bacteria 2964705432 2964705525 314
267 iso_pu_bacteria 2967664464 2967665025 314
268 iso_pu_bacteria 2967678726 2967682825 314
269 iso_pu_bacteria 2967686174 2967690932 314
270 iso_pu_bacteria 2967693043 2967693902 314
271 iso_pu_bacteria 2967699805 2967706325 314
272 iso_pu_bacteria 2967728569 2967733145 314
273 iso_pu_bacteria 2967735183 2967738037 314
274 iso_pu_bacteria 2967762386 2967765611 314
275 iso_pu_bacteria 2967775926 2967780993 314
276 iso_pu_bacteria 2970019648 2970025435 314
277 iso_pu_bacteria 2970026789 2970029090 314
278 iso_pu_bacteria 2970033650 2970036582 314
279 iso_pu_bacteria 2970068827 2970072206 314
280 iso_pu_bacteria 2970122695 2970125183 314
281 iso_pu_bacteria 2970129317 2970130677 314
282 iso_pu_bacteria 2970143518 2970148022 314
283 iso_pu_bacteria 2970164137 2970164234 314
284 iso_pu_bacteria 2977523885 2977529633 314
285 iso_pu_bacteria 2977530762 2977533431 314
286 iso_pu_bacteria 2977544691 2977548814 314
287 iso_pu_bacteria 2977551784 2977555159 314
288 iso_pu_bacteria 2981990288 2981995036 314
289 iso_pu_bacteria 2987652177 2987655767 314
290 iso_pu_bacteria 3000135777 3000140996 314
291 iso_pu_bacteria 641736154 642419695 314
292 iso_pu_bacteria 648276728 648736291 314
293 iso_pu_bacteria 8001845381 8001850034 314
294 iso_pu_bacteria 8003999396 8004005240 314
295 3300015261 Ga0182006_1008274 Ga0182006_10082742 315
296 3300050511 nmdc:mga08y16_320188_c1 nmdc:mga08y16_320188_c1_215_1186 315
297 3300003794 Ga0055531_10001400 Ga0055531_100014008 316
298 3300009545 Ga0105237_10002001 Ga0105237_100020016 316
299 3300009551 Ga0105238_10074767 Ga0105238_100747673 316
300 3300025292 Ga0209676_1028981 Ga0209676_10289812 316
301 3300025304 Ga0209257_1000155 Ga0209257_100015548 316
302 3300025914 Ga0207671_10017603 Ga0207671_100176031 316
303 3300025924 Ga0207694_10206026 Ga0207694_102060261 316
304 3300031911 Ga0307412_10120330 Ga0307412_101203302 316
305 3300032004 Ga0307414_10137534 Ga0307414_101375342 316
306 3300046616 Ga0495668_0000014 Ga0495668_0000014_240821_241789 316
307 3300047443 Ga0495687_007896 Ga0495687_007896_1889_2851 316
308 3300053119 Ga0500595_026370 Ga0500595_026370_473_1438 316
309 3300025250 Ga0209026_1002111 Ga0209026_100211110 317
310 3300028794 Ga0307515_10006952 Ga0307515_1000695216 317
311 3300031456 Ga0307513_10002296 Ga0307513_100022969 317
312 3300046452 Ga0495617_000004 Ga0495617_000004_438831_439808 317
313 3300046691 Ga0495670_0002745 Ga0495670_0002745_4926_5891 317
314 3300048904 Ga0496101_0074867 Ga0496101_0074867_1126_2100 317
315 3300048904 Ga0496101_0137564 Ga0496101_0137564_341_1306 317
316 3300048919 Ga0496116_0000582 Ga0496116_0000582_8758_9765 317
317 3300048919 Ga0496116_0001025 Ga0496116_0001025_30584_31549 317
318 3300048919 Ga0496116_0004319 Ga0496116_0004319_1545_2549 317
319 3300048919 Ga0496116_0006396 Ga0496116_0006396_2288_3253 317
320 3300048924 Ga0496121_0025282 Ga0496121_0025282_2496_3461 317
321 3300048924 Ga0496121_0030699 Ga0496121_0030699_1572_2576 317
322 3300048927 Ga0496124_0008394 Ga0496124_0008394_7187_8194 317
323 3300048927 Ga0496124_0031787 Ga0496124_0031787_2365_3330 317
324 3300050507 nmdc:mga05p37_758099_c1 nmdc:mga05p37_758099_c1_70_1035 317
325 3300002077 JGI24744J21845_10002140 JGI24744J21845_100021403 318
326 3300002244 JGI24742J22300_10004073 JGI24742J22300_100040732 318
327 3300002773 JGI25152J39213_1005325 JGI25152J39213_10053254 318
328 3300002987 JGI25159J45721_1000115 JGI25159J45721_100011528 318
329 3300003214 JGI25165J46597_1006826 JGI25165J46597_10068262 318
330 3300003215 JGI25153J46596_10002065 JGI25153J46596_1000206510 318
331 3300003323 rootH1_10150699 rootH1_101506993 318
332 3300003323 rootH1_10154766 rootH1_101547662 318
333 3300003374 JGI25161J50226_1000067 JGI25161J50226_100006726 318
334 3300003771 Ga0055526_1014931 Ga0055526_10149314 318
335 3300003775 Ga0055524_1004369 Ga0055524_100436910 318
336 3300003775 Ga0055524_1014809 Ga0055524_10148094 318
337 3300003781 Ga0055536_1021076 Ga0055536_10210762 318
338 3300003790 Ga0055528_1008026 Ga0055528_10080262 318
339 3300003792 Ga0055540_1005088 Ga0055540_10050881 318
340 3300004625 Ga0055543_1001588 Ga0055543_100158813 318
341 3300005262 Ga0065165_1001176 Ga0065165_10011764 318
342 3300005262 Ga0065165_1033096 Ga0065165_10330961 318
343 3300005327 Ga0070658_10044332 Ga0070658_100443324 318
344 3300005328 Ga0070676_10035179 Ga0070676_100351793 318
345 3300005335 Ga0070666_10123109 Ga0070666_101231093 318
346 3300005337 Ga0070682_100007990 Ga0070682_1000079907 318
347 3300005338 Ga0068868_100005286 Ga0068868_1000052863 318
348 3300005339 Ga0070660_100000002 Ga0070660_1000000024 318
349 3300005339 Ga0070660_100054533 Ga0070660_1000545334 318
350 3300005341 Ga0070691_10013764 Ga0070691_100137644 318
351 3300005341 Ga0070691_10068275 Ga0070691_100682752 318
352 3300005344 Ga0070661_100148012 Ga0070661_1001480122 318
353 3300005345 Ga0070692_10032529 Ga0070692_100325292 318
354 3300005347 Ga0070668_100016138 Ga0070668_1000161383 318
355 3300005347 Ga0070668_100437121 Ga0070668_1004371211 318
356 3300005353 Ga0070669_100009003 Ga0070669_1000090032 318
357 3300005355 Ga0070671_100103535 Ga0070671_1001035352 318
358 3300005356 Ga0070674_100009523 Ga0070674_1000095237 318
359 3300005364 Ga0070673_100206423 Ga0070673_1002064231 318
360 3300005365 Ga0070688_100025484 Ga0070688_1000254843 318
361 3300005366 Ga0070659_100000658 Ga0070659_10000065822 318
362 3300005366 Ga0070659_100011982 Ga0070659_1000119827 318
363 3300005366 Ga0070659_100019469 Ga0070659_1000194695 318
364 3300005367 Ga0070667_100010119 Ga0070667_1000101194 318
365 3300005434 Ga0070709_10005359 Ga0070709_100053592 318
366 3300005438 Ga0070701_10005450 Ga0070701_100054502 318
367 3300005439 Ga0070711_100000357 Ga0070711_1000003571 318
368 3300005440 Ga0070705_100010866 Ga0070705_1000108663 318
369 3300005441 Ga0070700_100028169 Ga0070700_1000281694 318
370 3300005441 Ga0070700_100105023 Ga0070700_1001050233 318
371 3300005444 Ga0070694_100067271 Ga0070694_1000672712 318
372 3300005445 Ga0070708_100381146 Ga0070708_1003811461 318
373 3300005455 Ga0070663_100000708 Ga0070663_10000070815 318
374 3300005455 Ga0070663_100007992 Ga0070663_1000079926 318
375 3300005456 Ga0070678_100006197 Ga0070678_1000061978 318
376 3300005457 Ga0070662_100056981 Ga0070662_1000569812 318
377 3300005457 Ga0070662_100202907 Ga0070662_1002029072 318
378 3300005459 Ga0068867_100005115 Ga0068867_1000051156 318
379 3300005467 Ga0070706_100439763 Ga0070706_1004397631 318
380 3300005539 Ga0068853_100000661 Ga0068853_10000066122 318
381 3300005539 Ga0068853_100226710 Ga0068853_1002267102 318
382 3300005543 Ga0070672_100144674 Ga0070672_1001446742 318
383 3300005545 Ga0070695_100091765 Ga0070695_1000917652 318
384 3300005546 Ga0070696_100002146 Ga0070696_1000021467 318
385 3300005547 Ga0070693_100005441 Ga0070693_1000054417 318
386 3300005548 Ga0070665_100003169 Ga0070665_1000031697 318
387 3300005548 Ga0070665_100028279 Ga0070665_1000282794 318
388 3300005548 Ga0070665_100057718 Ga0070665_1000577183 318
389 3300005549 Ga0070704_100002326 Ga0070704_1000023262 318
390 3300005563 Ga0068855_100020734 Ga0068855_1000207347 318
391 3300005563 Ga0068855_100183594 Ga0068855_1001835941 318
392 3300005563 Ga0068855_100400003 Ga0068855_1004000032 318
393 3300005578 Ga0068854_100056149 Ga0068854_1000561492 318
394 3300005614 Ga0068856_100476536 Ga0068856_1004765362 318
395 3300005615 Ga0070702_100002008 Ga0070702_10000200812 318
396 3300005616 Ga0068852_100006285 Ga0068852_1000062855 318
397 3300005616 Ga0068852_100015186 Ga0068852_1000151862 318
398 3300005617 Ga0068859_100041225 Ga0068859_1000412256 318
399 3300005718 Ga0068866_10001662 Ga0068866_100016622 318
400 3300005719 Ga0068861_100000260 Ga0068861_10000026022 318
401 3300005843 Ga0068860_100442281 Ga0068860_1004422811 318
402 3300005844 Ga0068862_100001680 Ga0068862_1000016805 318
403 3300005844 Ga0068862_100392526 Ga0068862_1003925262 318
404 3300006028 Ga0070717_10190266 Ga0070717_101902662 318
405 3300006048 Ga0075363_100031360 Ga0075363_1000313602 318
406 3300006163 Ga0070715_10011439 Ga0070715_100114394 318
407 3300006173 Ga0070716_100001699 Ga0070716_10000169915 318
408 3300006175 Ga0070712_100057460 Ga0070712_1000574602 318
409 3300006178 Ga0075367_10136570 Ga0075367_101365702 318
410 3300006237 Ga0097621_100035792 Ga0097621_1000357923 318
411 3300006358 Ga0068871_100159711 Ga0068871_1001597112 318
412 3300006871 Ga0075434_100389480 Ga0075434_1003894802 318
413 3300006880 Ga0075429_100062276 Ga0075429_1000622762 318
414 3300006880 Ga0075429_100360383 Ga0075429_1003603831 318
415 3300006881 Ga0068865_100030463 Ga0068865_1000304635 318
416 3300006931 Ga0097620_100041226 Ga0097620_1000412266 318
417 3300007788 Ga0099795_10018112 Ga0099795_100181124 318
418 3300009093 Ga0105240_10000012 Ga0105240_10000012155 318
419 3300009093 Ga0105240_10028333 Ga0105240_100283335 318
420 3300009093 Ga0105240_10075158 Ga0105240_100751583 318
421 3300009093 Ga0105240_10113529 Ga0105240_101135292 318
422 3300009093 Ga0105240_10293499 Ga0105240_102934993 318
423 3300009147 Ga0114129_10138269 Ga0114129_101382692 318
424 3300009148 Ga0105243_10223723 Ga0105243_102237232 318
425 3300009545 Ga0105237_10002890 Ga0105237_100028907 318
426 3300009551 Ga0105238_10006379 Ga0105238_100063798 318
427 3300009551 Ga0105238_10111793 Ga0105238_101117933 318
428 3300009763 Ga0123340_1000005 Ga0123340_100000556 318
429 3300009765 Ga0123341_1003152 Ga0123341_10031528 318
430 3300010159 Ga0099796_10005037 Ga0099796_100050373 318
431 3300010159 Ga0099796_10016118 Ga0099796_100161182 318
432 3300010375 Ga0105239_10007763 Ga0105239_100077634 318
433 3300010375 Ga0105239_10172017 Ga0105239_101720173 318
434 3300010375 Ga0105239_10204641 Ga0105239_102046412 318
435 3300011119 Ga0105246_10066636 Ga0105246_100666363 318
436 3300013100 Ga0157373_10014631 Ga0157373_100146313 318
437 3300013104 Ga0157370_10004553 Ga0157370_100045533 318
438 3300013104 Ga0157370_10071625 Ga0157370_100716254 318
439 3300013297 Ga0157378_10178673 Ga0157378_101786732 318
440 3300013308 Ga0157375_10148690 Ga0157375_101486903 318
441 3300014325 Ga0163163_10116210 Ga0163163_101162102 318
442 3300014497 Ga0182008_10008979 Ga0182008_100089793 318
443 3300014497 Ga0182008_10106787 Ga0182008_101067872 318
444 3300015261 Ga0182006_1003998 Ga0182006_10039986 318
445 3300015261 Ga0182006_1026708 Ga0182006_10267083 318
446 3300015262 Ga0182007_10002632 Ga0182007_100026324 318
447 3300015265 Ga0182005_1004268 Ga0182005_10042685 318
448 3300017792 Ga0163161_10002117 Ga0163161_100021177 318
449 3300017792 Ga0163161_10134076 Ga0163161_101340763 318
450 3300021361 Ga0213872_10000400 Ga0213872_1000040022 318
451 3300021361 Ga0213872_10006612 Ga0213872_100066125 318
452 3300022740 Ga0228710_1000227 Ga0228710_100022741 318
453 3300025208 Ga0209436_100019 Ga0209436_10001994 318
454 3300025233 Ga0209437_104460 Ga0209437_1044602 318
455 3300025246 Ga0209646_1000126 Ga0209646_1000126121 318
456 3300025253 Ga0209677_102574 Ga0209677_1025744 318
457 3300025261 Ga0209233_1000146 Ga0209233_100014659 318
458 3300025284 Ga0209130_1000066 Ga0209130_100006644 318
459 3300025292 Ga0209676_1008431 Ga0209676_10084314 318
460 3300025292 Ga0209676_1019575 Ga0209676_10195752 318
461 3300025294 Ga0209025_1037718 Ga0209025_10377182 318
462 3300025295 Ga0209564_1001143 Ga0209564_100114320 318
463 3300025295 Ga0209564_1001513 Ga0209564_100151314 318
464 3300025295 Ga0209564_1002896 Ga0209564_100289614 318
465 3300025295 Ga0209564_1019821 Ga0209564_10198212 318
466 3300025297 Ga0209758_1003019 Ga0209758_100301919 318
467 3300025298 Ga0209050_1000289 Ga0209050_100028917 318
468 3300025299 Ga0209256_1002761 Ga0209256_100276114 318
469 3300025299 Ga0209256_1010139 Ga0209256_10101398 318
470 3300025302 Ga0207426_1000008 Ga0207426_1000008839 318
471 3300025302 Ga0207426_1000395 Ga0207426_100039533 318
472 3300025303 Ga0209051_1032810 Ga0209051_10328102 318
473 3300025304 Ga0209257_1001088 Ga0209257_100108815 318
474 3300025304 Ga0209257_1003944 Ga0209257_10039445 318
475 3300025900 Ga0207710_10014502 Ga0207710_100145023 318
476 3300025901 Ga0207688_10026009 Ga0207688_100260092 318
477 3300025903 Ga0207680_10008650 Ga0207680_100086503 318
478 3300025907 Ga0207645_10054584 Ga0207645_100545842 318
479 3300025909 Ga0207705_10055207 Ga0207705_100552072 318
480 3300025913 Ga0207695_10000120 Ga0207695_1000012059 318
481 3300025913 Ga0207695_10002449 Ga0207695_100024497 318
482 3300025913 Ga0207695_10056348 Ga0207695_100563484 318
483 3300025913 Ga0207695_10329694 Ga0207695_103296941 318
484 3300025914 Ga0207671_10000023 Ga0207671_1000002327 318
485 3300025915 Ga0207693_10000826 Ga0207693_1000082627 318
486 3300025916 Ga0207663_10062541 Ga0207663_100625412 318
487 3300025919 Ga0207657_10000012 Ga0207657_10000012152 318
488 3300025919 Ga0207657_10044654 Ga0207657_100446544 318
489 3300025923 Ga0207681_10302154 Ga0207681_103021541 318
490 3300025924 Ga0207694_10386827 Ga0207694_103868272 318
491 3300025927 Ga0207687_10123241 Ga0207687_101232411 318
492 3300025931 Ga0207644_10317690 Ga0207644_103176902 318
493 3300025932 Ga0207690_10000008 Ga0207690_10000008322 318
494 3300025934 Ga0207686_10011269 Ga0207686_100112695 318
495 3300025935 Ga0207709_10014307 Ga0207709_100143073 318
496 3300025936 Ga0207670_10022471 Ga0207670_100224711 318
497 3300025937 Ga0207669_10066263 Ga0207669_100662633 318
498 3300025938 Ga0207704_10015476 Ga0207704_100154762 318
499 3300025939 Ga0207665_10004131 Ga0207665_1000413114 318
500 3300025940 Ga0207691_10155009 Ga0207691_101550091 318
501 3300025941 Ga0207711_10094695 Ga0207711_100946954 318
502 3300025949 Ga0207667_10003504 Ga0207667_1000350415 318
503 3300025972 Ga0207668_10162751 Ga0207668_101627512 318
504 3300025972 Ga0207668_10268450 Ga0207668_102684501 318
505 3300025986 Ga0207658_10122008 Ga0207658_101220083 318
506 3300026023 Ga0207677_10061878 Ga0207677_100618783 318
507 3300026035 Ga0207703_10011619 Ga0207703_100116192 318
508 3300026067 Ga0207678_10001018 Ga0207678_100010184 318
509 3300026075 Ga0207708_10001860 Ga0207708_1000186010 318
510 3300026075 Ga0207708_10084771 Ga0207708_100847711 318
511 3300026088 Ga0207641_10573222 Ga0207641_105732221 318
512 3300026089 Ga0207648_10014364 Ga0207648_100143643 318
513 3300026116 Ga0207674_10515918 Ga0207674_105159181 318
514 3300026118 Ga0207675_100000781 Ga0207675_10000078119 318
515 3300026118 Ga0207675_100227666 Ga0207675_1002276663 318
516 3300026121 Ga0207683_10000591 Ga0207683_1000059125 318
517 3300026142 Ga0207698_10027221 Ga0207698_100272214 318
518 3300026142 Ga0207698_10031154 Ga0207698_100311546 318
519 3300027111 Ga0209281_1000348 Ga0209281_100034815 318
520 3300027111 Ga0209281_1001492 Ga0209281_10014925 318
521 3300027666 Ga0209282_1000070 Ga0209282_100007060 318
522 3300027671 Ga0209588_1023155 Ga0209588_10231552 318
523 3300027866 Ga0209813_10000187 Ga0209813_100001873 318
524 3300028379 Ga0268266_10002913 Ga0268266_100029137 318
525 3300028379 Ga0268266_10031259 Ga0268266_100312591 318
526 3300028379 Ga0268266_10070116 Ga0268266_100701162 318
527 3300028381 Ga0268264_10092396 Ga0268264_100923964 318
528 3300028786 Ga0307517_10041405 Ga0307517_100414057 318
529 3300028786 Ga0307517_10164914 Ga0307517_101649141 318
530 3300028794 Ga0307515_10286332 Ga0307515_102863322 318
531 3300031456 Ga0307513_10000703 Ga0307513_1000070336 318
532 3300031456 Ga0307513_10000984 Ga0307513_1000098434 318
533 3300031456 Ga0307513_10019533 Ga0307513_100195334 318
534 3300031456 Ga0307513_10052970 Ga0307513_100529703 318
535 3300031507 Ga0307509_10120587 Ga0307509_101205872 318
536 3300031548 Ga0307408_100116162 Ga0307408_1001161622 318
537 3300031548 Ga0307408_100121579 Ga0307408_1001215792 318
538 3300031616 Ga0307508_10026330 Ga0307508_100263307 318
539 3300031649 Ga0307514_10010993 Ga0307514_100109932 318
540 3300031901 Ga0307406_10004554 Ga0307406_100045546 318
541 3300031911 Ga0307412_10090085 Ga0307412_100900852 318
542 3300031967 Ga0315914_1000082 Ga0315914_100008262 318
543 3300033180 Ga0307510_10010889 Ga0307510_100108898 318
544 3300033430 Ga0315913_1000028 Ga0315913_100002861 318
545 3300033464 Ga0315915_1000004 Ga0315915_100000462 318
546 3300035242 Ga0373962_0008811 Ga0373962_0008811_358_1326 318
547 3300035691 Ga0373931_0015831 Ga0373931_0015831_1194_2162 318
548 3300037312 Ga0395899_0111611 Ga0395899_0111611_964_1932 318
549 3300037418 Ga0395900_0085036 Ga0395900_0085036_1380_2348 318
550 3300037471 Ga0395905_0000057 Ga0395905_0000057_135245_136213 318
551 3300037471 Ga0395905_0000388 Ga0395905_0000388_29073_30041 318
552 3300037471 Ga0395905_0040901 Ga0395905_0040901_852_1820 318
553 3300038443 Ga0395901_0156877 Ga0395901_0156877_1155_2123 318
554 3300041404 Ga0439436_0003496 Ga0439436_0003496_732_1700 318
555 3300041404 Ga0439436_0055417 Ga0439436_0055417_74_1048 318
556 3300041411 Ga0439466_0000817 Ga0439466_0000817_10211_11179 318
557 3300041413 Ga0439465_0000099 Ga0439465_0000099_15937_16905 318
558 3300041997 Ga0439431_0002493 Ga0439431_0002493_2861_3829 318
559 3300041999 Ga0439433_0001261 Ga0439433_0001261_3449_4417 318
560 3300042002 Ga0439442_003511 Ga0439442_003511_863_1831 318
561 3300042006 Ga0439432_000645 Ga0439432_000645_4085_5053 318
562 3300042007 Ga0439449_0001392 Ga0439449_0001392_2124_3092 318
563 3300042007 Ga0439449_0002167 Ga0439449_0002167_6416_7390 318
564 3300042010 Ga0439452_001701 Ga0439452_001701_6117_7085 318
565 3300042435 Ga0439434_0014254 Ga0439434_0014254_717_1685 318
566 3300046452 Ga0495617_007423 Ga0495617_007423_1722_2690 318
567 3300046455 Ga0495603_0018666 Ga0495603_0018666_855_1823 318
568 3300046455 Ga0495603_0035994 Ga0495603_0035994_1747_2715 318
569 3300046457 Ga0495590_0013437 Ga0495590_0013437_227_1195 318
570 3300046460 Ga0495638_0001529 Ga0495638_0001529_4242_5219 318
571 3300046460 Ga0495638_0001906 Ga0495638_0001906_4143_5111 318
572 3300046460 Ga0495638_0002495 Ga0495638_0002495_6648_7616 318
573 3300046463 Ga0495653_0000044 Ga0495653_0000044_65597_66565 318
574 3300046471 Ga0495650_0002214 Ga0495650_0002214_8275_9255 318
575 3300046472 Ga0495580_0003570 Ga0495580_0003570_2155_3123 318
576 3300046472 Ga0495580_0004911 Ga0495580_0004911_1035_2003 318
577 3300046474 Ga0495605_0015262 Ga0495605_0015262_894_1862 318
578 3300046491 Ga0495584_0000005 Ga0495584_0000005_274514_275482 318
579 3300046491 Ga0495584_0000901 Ga0495584_0000901_7716_8684 318
580 3300046491 Ga0495584_0128443 Ga0495584_0128443_211_1179 318
581 3300046492 Ga0495585_0000023 Ga0495585_0000023_124720_125688 318
582 3300046492 Ga0495585_0000264 Ga0495585_0000264_30503_31471 318
583 3300046492 Ga0495585_0001274 Ga0495585_0001274_4599_5579 318
584 3300046492 Ga0495585_0032064 Ga0495585_0032064_1160_2128 318
585 3300046500 Ga0495596_0005439 Ga0495596_0005439_4008_4976 318
586 3300046501 Ga0495607_0037877 Ga0495607_0037877_1633_2601 318
587 3300046501 Ga0495607_0053035 Ga0495607_0053035_929_1912 318
588 3300046506 Ga0495583_0010635 Ga0495583_0010635_4170_5138 318
589 3300046506 Ga0495583_0053430 Ga0495583_0053430_536_1504 318
590 3300046507 Ga0495606_0000080 Ga0495606_0000080_73113_74081 318
591 3300046507 Ga0495606_0000175 Ga0495606_0000175_53189_54244 318
592 3300046507 Ga0495606_0000883 Ga0495606_0000883_43368_44345 318
593 3300046507 Ga0495606_0034156 Ga0495606_0034156_1998_2966 318
594 3300046507 Ga0495606_0071289 Ga0495606_0071289_1200_2177 318
595 3300046512 Ga0495610_0000010 Ga0495610_0000010_26872_27852 318
596 3300046513 Ga0495616_0000355 Ga0495616_0000355_8031_8999 318
597 3300046513 Ga0495616_0003675 Ga0495616_0003675_1784_2752 318
598 3300046513 Ga0495616_0022692 Ga0495616_0022692_1460_2428 318
599 3300046513 Ga0495616_0028641 Ga0495616_0028641_92_1060 318
600 3300046519 Ga0495632_0015169 Ga0495632_0015169_1914_2891 318
601 3300046520 Ga0495637_0009128 Ga0495637_0009128_2746_3723 318
602 3300046522 Ga0495643_0020268 Ga0495643_0020268_1248_2216 318
603 3300046524 Ga0495648_0000048 Ga0495648_0000048_134_1102 318
604 3300046524 Ga0495648_0002921 Ga0495648_0002921_1837_2817 318
605 3300046524 Ga0495648_0030044 Ga0495648_0030044_1798_2766 318
606 3300046530 Ga0495654_0006501 Ga0495654_0006501_921_1901 318
607 3300046530 Ga0495654_0115277 Ga0495654_0115277_70_1047 318
608 3300046531 Ga0495665_0040085 Ga0495665_0040085_327_1295 318
609 3300046538 Ga0495609_0011325 Ga0495609_0011325_1855_2832 318
610 3300046538 Ga0495609_0057703 Ga0495609_0057703_599_1567 318
611 3300046542 Ga0495597_0006248 Ga0495597_0006248_4031_4999 318
612 3300046542 Ga0495597_0044826 Ga0495597_0044826_677_1645 318
613 3300046557 Ga0495622_0000055 Ga0495622_0000055_68471_69439 318
614 3300046557 Ga0495622_0104393 Ga0495622_0104393_230_1198 318
615 3300046558 Ga0495633_0000702 Ga0495633_0000702_7420_8388 318
616 3300046558 Ga0495633_0001317 Ga0495633_0001317_8021_8989 318
617 3300046558 Ga0495633_0136575 Ga0495633_0136575_10_990 318
618 3300046615 Ga0495656_0000897 Ga0495656_0000897_7006_7974 318
619 3300046616 Ga0495668_0001721 Ga0495668_0001721_7852_8832 318
620 3300046648 Ga0495611_0013856 Ga0495611_0013856_2147_3115 318
621 3300046648 Ga0495611_0084941 Ga0495611_0084941_353_1321 318
622 3300046660 Ga0495625_0004405 Ga0495625_0004405_1723_2691 318
623 3300046660 Ga0495625_0005069 Ga0495625_0005069_4316_5299 318
624 3300046660 Ga0495625_0063847 Ga0495625_0063847_852_1829 318
625 3300046664 Ga0495659_0014756 Ga0495659_0014756_1422_2390 318
626 3300046665 Ga0495661_0039227 Ga0495661_0039227_1434_2402 318
627 3300046665 Ga0495661_0126691 Ga0495661_0126691_195_1163 318
628 3300046691 Ga0495670_0000835 Ga0495670_0000835_4121_5089 318
629 3300046691 Ga0495670_0051150 Ga0495670_0051150_561_1529 318
630 3300046692 Ga0495671_0006445 Ga0495671_0006445_3524_4543 318
631 3300046692 Ga0495671_0008669 Ga0495671_0008669_1975_2955 318
632 3300046810 Ga0495660_0002139 Ga0495660_0002139_6131_7108 318
633 3300046810 Ga0495660_0011379 Ga0495660_0011379_1156_2124 318
634 3300046810 Ga0495660_0070282 Ga0495660_0070282_837_1805 318
635 3300046810 Ga0495660_0105958 Ga0495660_0105958_392_1372 318
636 3300047319 Ga0495674_0013307 Ga0495674_0013307_4747_5715 318
637 3300047320 Ga0495672_0019850 Ga0495672_0019850_1203_2171 318
638 3300047323 Ga0495683_0000083 Ga0495683_0000083_88102_89070 318
639 3300047323 Ga0495683_0011803 Ga0495683_0011803_3011_3979 318
640 3300047323 Ga0495683_0042323 Ga0495683_0042323_430_1398 318
641 3300047443 Ga0495687_023756 Ga0495687_023756_1748_2716 318
642 3300047469 Ga0495673_0000027 Ga0495673_0000027_39729_40700 318
643 3300047469 Ga0495673_0000028 Ga0495673_0000028_408549_409517 318
644 3300047469 Ga0495673_0000207 Ga0495673_0000207_80809_81789 318
645 3300047469 Ga0495673_0020080 Ga0495673_0020080_1911_2879 318
646 3300047470 Ga0495681_0002701 Ga0495681_0002701_8077_9054 318
647 3300047470 Ga0495681_0131258 Ga0495681_0131258_23_991 318
648 3300047472 Ga0495686_0002926 Ga0495686_0002926_10827_11864 318
649 3300047472 Ga0495686_0076116 Ga0495686_0076116_122_1099 318
650 3300048091 Ga0495626_0014465 Ga0495626_0014465_1690_2658 318
651 3300048903 Ga0496100_0001141 Ga0496100_0001141_3223_4191 318
652 3300048903 Ga0496100_0015722 Ga0496100_0015722_2365_3339 318
653 3300048903 Ga0496100_0018264 Ga0496100_0018264_1742_2710 318
654 3300048904 Ga0496101_0000393 Ga0496101_0000393_2852_3820 318
655 3300048904 Ga0496101_0021531 Ga0496101_0021531_1195_2163 318
656 3300048904 Ga0496101_0033024 Ga0496101_0033024_2210_3178 318
657 3300048905 Ga0496102_0000874 Ga0496102_0000874_24956_25924 318
658 3300048905 Ga0496102_0001639 Ga0496102_0001639_17083_18231 318
659 3300048906 Ga0496103_0001138 Ga0496103_0001138_457_1425 318
660 3300048906 Ga0496103_0008266 Ga0496103_0008266_1063_2037 318
661 3300048906 Ga0496103_0013514 Ga0496103_0013514_1522_2490 318
662 3300048908 Ga0496105_0120515 Ga0496105_0120515_717_1685 318
663 3300048908 Ga0496105_0214923 Ga0496105_0214923_236_1204 318
664 3300048909 Ga0496106_0000126 Ga0496106_0000126_5152_6120 318
665 3300048909 Ga0496106_0044584 Ga0496106_0044584_2335_3303 318
666 3300048909 Ga0496106_0179716 Ga0496106_0179716_698_1666 318
667 3300048910 Ga0496107_0007043 Ga0496107_0007043_6013_6981 318
668 3300048915 Ga0496112_0249491 Ga0496112_0249491_349_1317 318
669 3300048916 Ga0496113_0005655 Ga0496113_0005655_2753_3721 318
670 3300048917 Ga0496114_0019735 Ga0496114_0019735_4172_5140 318
671 3300048918 Ga0496115_0054324 Ga0496115_0054324_1804_2772 318
672 3300048919 Ga0496116_0000465 Ga0496116_0000465_37674_38645 318
673 3300048920 Ga0496117_0001748 Ga0496117_0001748_2374_3342 318
674 3300048920 Ga0496117_0010105 Ga0496117_0010105_6331_7305 318
675 3300048920 Ga0496117_0039802 Ga0496117_0039802_617_1588 318
676 3300048921 Ga0496118_0000563 Ga0496118_0000563_24786_25754 318
677 3300048921 Ga0496118_0015531 Ga0496118_0015531_1359_2333 318
678 3300048922 Ga0496119_0054098 Ga0496119_0054098_1014_1988 318
679 3300048923 Ga0496120_0009021 Ga0496120_0009021_3330_4313 318
680 3300048923 Ga0496120_0034733 Ga0496120_0034733_621_1589 318
681 3300048924 Ga0496121_0000872 Ga0496121_0000872_1407_2390 318
682 3300048924 Ga0496121_0002797 Ga0496121_0002797_1630_2598 318
683 3300048924 Ga0496121_0003047 Ga0496121_0003047_21668_22639 318
684 3300048924 Ga0496121_0003612 Ga0496121_0003612_7203_8171 318
685 3300048924 Ga0496121_0077364 Ga0496121_0077364_389_1357 318
686 3300048925 Ga0496122_0036208 Ga0496122_0036208_1461_2486 318
687 3300048925 Ga0496122_0128803 Ga0496122_0128803_229_1203 318
688 3300048926 Ga0496123_0001228 Ga0496123_0001228_31860_32855 318
689 3300048926 Ga0496123_0085754 Ga0496123_0085754_738_1763 318
690 3300048927 Ga0496124_0002433 Ga0496124_0002433_4938_5912 318
691 3300048927 Ga0496124_0013234 Ga0496124_0013234_231_1202 318
692 3300048928 Ga0496125_0000134 Ga0496125_0000134_121815_122798 318
693 3300048928 Ga0496125_0004107 Ga0496125_0004107_11284_12258 318
694 3300048929 Ga0496126_0000437 Ga0496126_0000437_25830_26801 318
695 3300048929 Ga0496126_0004530 Ga0496126_0004530_13455_14441 318
696 3300049460 Ga0495682_0014188 Ga0495682_0014188_76_1044 318
697 3300049460 Ga0495682_0040269 Ga0495682_0040269_296_1264 318
698 3300049823 Ga0501044_0018501 Ga0501044_0018501_3234_4235 318
699 3300050494 nmdc:mga06z11_285_c1 nmdc:mga06z11_285_c1_15782_16750 318
700 3300050495 nmdc:mga04h51_154_c1 nmdc:mga04h51_154_c1_15782_16750 318
701 3300050516 nmdc:mga0sz30_50831_c1 nmdc:mga0sz30_50831_c1_190_1170 318
702 3300053086 Ga0500578_0050899 Ga0500578_0050899_422_1390 318
703 3300053111 Ga0500572_027281 Ga0500572_027281_91_1065 318
704 3300053125 Ga0500618_001244 Ga0500618_001244_4274_5242 318
705 3300053145 Ga0500586_004733 Ga0500586_004733_2113_3093 318
706 3300053177 Ga0500636_0001314 Ga0500636_0001314_4165_5133 318
707 3300053730 Ga0500645_002253 Ga0500645_002253_2525_3493 318
708 iso_pu_bacteria 2818991457 2819663155 318
709 2162886007 SwRhRL2b_contig_2558692 SwRhRL2b_0840.00006700 322
710 3300005289 Ga0065704_10070250 Ga0065704_1007025019 322
711 3300042531 Ga0450918_011755 Ga0450918_011755_493_1461 322
712 3300048920 Ga0496117_0000237 Ga0496117_0000237_93154_94125 322
713 3300048921 Ga0496118_0000280 Ga0496118_0000280_86414_87385 322
714 3300048922 Ga0496119_0000107 Ga0496119_0000107_21903_22874 322
715 3300048923 Ga0496120_0000011 Ga0496120_0000011_93953_94924 322
716 3300048925 Ga0496122_0000253 Ga0496122_0000253_3576_4544 322
717 3300048926 Ga0496123_0000206 Ga0496123_0000206_115991_116959 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

57

141

0.93

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

182

309

0.89

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

214

351

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.9521 1 322
1qor-assembly1.cif.gz_B crystal structure of escherichia coli quinone oxidoreductase complexed with nadph 0.9492 1 322
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9473 1 322
3jyl-assembly1.cif.gz_A crystal structures of pseudomonas syringae pv. tomato dc3000 quinone oxidoreductase 0.9469 2 322
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.9445 1 322
ID Description Score Start End Superfamily
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9592 1 114 3.90.180.10
af_Q336S6_1_326_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9564 1 321 3.90.180.10
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 123 265 3.40.50.720
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9519 2 118 3.90.180.10
af_A0A0R0I1N1_1_153_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9512 2 134 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A530C0Q4-F1-model_v4 Quinone oxidoreductase 0.9852 89 318 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A4U2ZS59-F1-model_v4 Zinc-binding dehydrogenase 0.9704 1 190 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402
AF-A0A0A8YLD7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9665 2 321 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A7J7CDV1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9647 2 229 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A160T4B0-F1-model_v4 Quinone oxidoreductase (EC 1.6.5.5) 0.9646 1 322 GO:0003960
GO:0005829
GO:0008270
GO:0035925
GO:0070402

Feature Viewer

pLDDT pTM Quality
94.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map