F477053
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 716 | 269 | 712 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300026142|Ga0207698_10120706|Ga0207698_101207062 |
| Length | 221 |
| Sequence | MAFLAFQNDIGKVFARLLDRVMASHPAGPEIERLIQLLAKLPGLGPRSARRAALALLKKREALLEPLGMAMREASAAIKVCETCGNLDTTNPCALCRDPQRDSHLLCVVEDVADLWALERAGIFRGKYHVLGGALSALDGVTPERLNVASLVRRAGEGVDEVILAVNATVEGQTTAHYLMDVLTPSGVKVTRLAHGVPVGGELDYLDEGTLSAAFKARRGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 2 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 3 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 4 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 93 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 97 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 168 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 169 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 172 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 194 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 195 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 222 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 223 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 224 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 256 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 257 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 258 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 259 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 260 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 261 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 262 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 263 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 264 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 266 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.44 |
| Metatranscriptomes | 0 |
| Isolates | 0.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.07 |
| Nodule | 0.42 |
| Rhizoplane | 0.14 |
| Rhizosphere | 92.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000080 | 3300003214 | Bacteria | 176649 |
| 2 | JGI25153J46596_10000812 | 3300003215 | Bacteria | 19097 |
| 3 | Ga0070658_10002534 | 3300005327 | Bacteria | 15249 |
| 4 | Ga0070658_10300450 | 3300005327 | Bacteria | 1369 |
| 5 | Ga0070658_10413174 | 3300005327 | Bacteria | 1160 |
| 6 | Ga0070658_10489405 | 3300005327 | Bacteria | 1062 |
| 7 | Ga0070658_10819072 | 3300005327 | Bacteria | 809 |
| 8 | Ga0070676_10089400 | 3300005328 | Bacteria | 1884 |
| 9 | Ga0070683_100208029 | 3300005329 | Bacteria | 1858 |
| 10 | Ga0070690_100146593 | 3300005330 | Bacteria | 1607 |
| 11 | Ga0068869_100176857 | 3300005334 | Bacteria | 1671 |
| 12 | Ga0068869_100187227 | 3300005334 | Bacteria | 1626 |
| 13 | Ga0070680_100000332 | 3300005336 | Bacteria | 31618 |
| 14 | Ga0070680_100062010 | 3300005336 | Bacteria | 3061 |
| 15 | Ga0070680_100136542 | 3300005336 | Bacteria | 2055 |
| 16 | Ga0070680_100401604 | 3300005336 | Bacteria | 1168 |
| 17 | Ga0068868_100556110 | 3300005338 | Bacteria | 1012 |
| 18 | Ga0068868_100962811 | 3300005338 | Bacteria | 779 |
| 19 | Ga0070660_100086353 | 3300005339 | Bacteria | 2468 |
| 20 | Ga0070689_101072836 | 3300005340 | Bacteria | 719 |
| 21 | Ga0070691_10137849 | 3300005341 | Bacteria | 1241 |
| 22 | Ga0070661_100000135 | 3300005344 | Bacteria | 61669 |
| 23 | Ga0070661_100022011 | 3300005344 | Bacteria | 4560 |
| 24 | Ga0070661_100292728 | 3300005344 | Bacteria | 1265 |
| 25 | Ga0070675_100087059 | 3300005354 | Bacteria | 2612 |
| 26 | Ga0070675_100223448 | 3300005354 | Bacteria | 1641 |
| 27 | Ga0070671_100217559 | 3300005355 | Bacteria | 1621 |
| 28 | Ga0070671_100802032 | 3300005355 | Bacteria | 820 |
| 29 | Ga0070674_100181571 | 3300005356 | Bacteria | 1612 |
| 30 | Ga0070674_100446990 | 3300005356 | Bacteria | 1066 |
| 31 | Ga0070674_100897353 | 3300005356 | Bacteria | 772 |
| 32 | Ga0070673_100109977 | 3300005364 | Bacteria | 2284 |
| 33 | Ga0070673_100116003 | 3300005364 | Bacteria | 2227 |
| 34 | Ga0070673_100253767 | 3300005364 | Bacteria | 1534 |
| 35 | Ga0070667_100047937 | 3300005367 | Bacteria | 3596 |
| 36 | Ga0070667_100083406 | 3300005367 | Bacteria | 2738 |
| 37 | Ga0070714_100078148 | 3300005435 | Bacteria | 2876 |
| 38 | Ga0070714_100098978 | 3300005435 | Bacteria | 2566 |
| 39 | Ga0070714_100571097 | 3300005435 | Bacteria | 1084 |
| 40 | Ga0070713_100025897 | 3300005436 | Bacteria | 4595 |
| 41 | Ga0070713_100289753 | 3300005436 | Bacteria | 1504 |
| 42 | Ga0070710_10006054 | 3300005437 | Bacteria | 5782 |
| 43 | Ga0070711_100036579 | 3300005439 | Bacteria | 3289 |
| 44 | Ga0070711_100204462 | 3300005439 | Bacteria | 1526 |
| 45 | Ga0070711_100444418 | 3300005439 | Bacteria | 1060 |
| 46 | Ga0070678_100002862 | 3300005456 | Bacteria | 9557 |
| 47 | Ga0070678_100016293 | 3300005456 | Bacteria | 4751 |
| 48 | Ga0070678_100019805 | 3300005456 | Bacteria | 4398 |
| 49 | Ga0070678_100079469 | 3300005456 | Bacteria | 2481 |
| 50 | Ga0070678_100141932 | 3300005456 | Bacteria | 1923 |
| 51 | Ga0070681_10000123 | 3300005458 | Bacteria | 57938 |
| 52 | Ga0070681_10055003 | 3300005458 | Bacteria | 3965 |
| 53 | Ga0070681_10227662 | 3300005458 | Bacteria | 1779 |
| 54 | Ga0070681_10249613 | 3300005458 | Bacteria | 1687 |
| 55 | Ga0070681_10279598 | 3300005458 | Bacteria | 1580 |
| 56 | Ga0070681_10746889 | 3300005458 | Bacteria | 895 |
| 57 | Ga0070707_100062475 | 3300005468 | Bacteria | 3573 |
| 58 | Ga0070698_100005421 | 3300005471 | Bacteria | 13939 |
| 59 | Ga0070698_100137307 | 3300005471 | Bacteria | 2398 |
| 60 | Ga0070699_100037090 | 3300005518 | Bacteria | 4218 |
| 61 | Ga0070699_100337014 | 3300005518 | Bacteria | 1357 |
| 62 | Ga0070699_100364519 | 3300005518 | Bacteria | 1303 |
| 63 | Ga0070679_100000490 | 3300005530 | Bacteria | 33743 |
| 64 | Ga0070679_100005993 | 3300005530 | Bacteria | 11303 |
| 65 | Ga0070679_100024189 | 3300005530 | Bacteria | 5951 |
| 66 | Ga0070679_100267901 | 3300005530 | Bacteria | 1663 |
| 67 | Ga0070679_100431881 | 3300005530 | Bacteria | 1262 |
| 68 | Ga0070684_100199581 | 3300005535 | Bacteria | 1822 |
| 69 | Ga0070684_100611340 | 3300005535 | Bacteria | 1014 |
| 70 | Ga0068853_100005091 | 3300005539 | Bacteria | 10262 |
| 71 | Ga0068853_100016798 | 3300005539 | Bacteria | 6029 |
| 72 | Ga0068853_100073378 | 3300005539 | Bacteria | 2984 |
| 73 | Ga0068853_101049883 | 3300005539 | Bacteria | 785 |
| 74 | Ga0070672_100429844 | 3300005543 | Bacteria | 1135 |
| 75 | Ga0070672_101053026 | 3300005543 | Bacteria | 722 |
| 76 | Ga0070695_100274511 | 3300005545 | Bacteria | 1236 |
| 77 | Ga0070693_100069882 | 3300005547 | Bacteria | 2065 |
| 78 | Ga0070665_100002457 | 3300005548 | Bacteria | 20427 |
| 79 | Ga0070665_100089174 | 3300005548 | Bacteria | 3090 |
| 80 | Ga0070665_100099565 | 3300005548 | Bacteria | 2911 |
| 81 | Ga0070665_100127884 | 3300005548 | Bacteria | 2543 |
| 82 | Ga0070665_100134188 | 3300005548 | Bacteria | 2477 |
| 83 | Ga0070665_100169252 | 3300005548 | Bacteria | 2186 |
| 84 | Ga0070665_100187834 | 3300005548 | Bacteria | 2067 |
| 85 | Ga0070665_100213620 | 3300005548 | Bacteria | 1930 |
| 86 | Ga0070665_100395431 | 3300005548 | Bacteria | 1390 |
| 87 | Ga0068855_100000529 | 3300005563 | Bacteria | 46748 |
| 88 | Ga0068855_100030598 | 3300005563 | Bacteria | 6435 |
| 89 | Ga0068855_100148589 | 3300005563 | Bacteria | 2666 |
| 90 | Ga0068855_100307750 | 3300005563 | Bacteria | 1754 |
| 91 | Ga0068855_100870463 | 3300005563 | Bacteria | 953 |
| 92 | Ga0068857_100100352 | 3300005577 | Bacteria | 2597 |
| 93 | Ga0068857_100103816 | 3300005577 | Bacteria | 2552 |
| 94 | Ga0068857_100192559 | 3300005577 | Bacteria | 1857 |
| 95 | Ga0068854_100294821 | 3300005578 | Bacteria | 1310 |
| 96 | Ga0068856_100103164 | 3300005614 | Bacteria | 2846 |
| 97 | Ga0068856_100467004 | 3300005614 | Bacteria | 1283 |
| 98 | Ga0070702_100157769 | 3300005615 | Bacteria | 1463 |
| 99 | Ga0068852_100090814 | 3300005616 | Bacteria | 2732 |
| 100 | Ga0068852_100174582 | 3300005616 | Bacteria | 2017 |
| 101 | Ga0068852_100600280 | 3300005616 | Bacteria | 1105 |
| 102 | Ga0068859_100388566 | 3300005617 | Bacteria | 1491 |
| 103 | Ga0068859_100825594 | 3300005617 | Bacteria | 1014 |
| 104 | Ga0068864_100602615 | 3300005618 | Bacteria | 1066 |
| 105 | Ga0068861_100101094 | 3300005719 | Bacteria | 2293 |
| 106 | Ga0068870_10081587 | 3300005840 | Bacteria | 1789 |
| 107 | Ga0068863_100248827 | 3300005841 | Bacteria | 1717 |
| 108 | Ga0068858_100007195 | 3300005842 | Bacteria | 10791 |
| 109 | Ga0068858_100100353 | 3300005842 | Bacteria | 2700 |
| 110 | Ga0068860_100037804 | 3300005843 | Bacteria | 4619 |
| 111 | Ga0068860_100269766 | 3300005843 | Bacteria | 1661 |
| 112 | Ga0068860_101041327 | 3300005843 | Bacteria | 837 |
| 113 | Ga0081455_10215516 | 3300005937 | Bacteria | 1427 |
| 114 | Ga0081538_10028741 | 3300005981 | Bacteria | 3815 |
| 115 | Ga0070717_10002736 | 3300006028 | Bacteria | 12453 |
| 116 | Ga0070717_10004979 | 3300006028 | Bacteria | 9665 |
| 117 | Ga0070717_10749084 | 3300006028 | Bacteria | 888 |
| 118 | Ga0075362_10019412 | 3300006177 | Bacteria | 2826 |
| 119 | Ga0097621_100000267 | 3300006237 | Bacteria | 35345 |
| 120 | Ga0097621_100025424 | 3300006237 | Bacteria | 4633 |
| 121 | Ga0097621_100045626 | 3300006237 | Bacteria | 3541 |
| 122 | Ga0097621_100084595 | 3300006237 | Bacteria | 2645 |
| 123 | Ga0097621_100169682 | 3300006237 | Bacteria | 1880 |
| 124 | Ga0097621_100237065 | 3300006237 | Bacteria | 1594 |
| 125 | Ga0068871_100002164 | 3300006358 | Bacteria | 13334 |
| 126 | Ga0068871_100003594 | 3300006358 | Bacteria | 10654 |
| 127 | Ga0068871_100180019 | 3300006358 | Bacteria | 1816 |
| 128 | Ga0068871_100202798 | 3300006358 | Bacteria | 1713 |
| 129 | Ga0068871_100548626 | 3300006358 | Bacteria | 1047 |
| 130 | Ga0075428_100511987 | 3300006844 | Bacteria | 1284 |
| 131 | Ga0075430_100194453 | 3300006846 | Bacteria | 1685 |
| 132 | Ga0075431_100196176 | 3300006847 | Bacteria | 2067 |
| 133 | Ga0075434_100196301 | 3300006871 | Bacteria | 2038 |
| 134 | Ga0068865_100005263 | 3300006881 | Bacteria | 7824 |
| 135 | Ga0097620_100388579 | 3300006931 | Bacteria | 1491 |
| 136 | Ga0097620_100825590 | 3300006931 | Bacteria | 1014 |
| 137 | Ga0099795_10003494 | 3300007788 | Bacteria | 3898 |
| 138 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 139 | Ga0105240_10021384 | 3300009093 | Bacteria | 8605 |
| 140 | Ga0105240_10029678 | 3300009093 | Bacteria | 7117 |
| 141 | Ga0105240_10042935 | 3300009093 | Bacteria | 5759 |
| 142 | Ga0105240_10081334 | 3300009093 | Bacteria | 3981 |
| 143 | Ga0105240_10116517 | 3300009093 | Bacteria | 3223 |
| 144 | Ga0105240_10153807 | 3300009093 | Bacteria | 2737 |
| 145 | Ga0105240_10362552 | 3300009093 | Bacteria | 1641 |
| 146 | Ga0105240_10455168 | 3300009093 | Bacteria | 1431 |
| 147 | Ga0105240_10783049 | 3300009093 | Bacteria | 1034 |
| 148 | Ga0105240_11055795 | 3300009093 | Bacteria | 866 |
| 149 | Ga0111539_10159125 | 3300009094 | Bacteria | 2642 |
| 150 | Ga0111539_10801479 | 3300009094 | Bacteria | 1096 |
| 151 | Ga0105245_10001742 | 3300009098 | Bacteria | 19846 |
| 152 | Ga0105245_10376812 | 3300009098 | Bacteria | 1412 |
| 153 | Ga0105245_10444974 | 3300009098 | Bacteria | 1303 |
| 154 | Ga0105245_10506287 | 3300009098 | Bacteria | 1224 |
| 155 | Ga0105245_10537001 | 3300009098 | Bacteria | 1190 |
| 156 | Ga0105247_10052153 | 3300009101 | Bacteria | 2521 |
| 157 | Ga0105243_10042358 | 3300009148 | Bacteria | 3565 |
| 158 | Ga0105243_10299509 | 3300009148 | Bacteria | 1457 |
| 159 | Ga0105241_10105447 | 3300009174 | Bacteria | 2248 |
| 160 | Ga0105241_10167246 | 3300009174 | Bacteria | 1813 |
| 161 | Ga0105241_10642923 | 3300009174 | Bacteria | 963 |
| 162 | Ga0105241_11008583 | 3300009174 | Bacteria | 779 |
| 163 | Ga0105242_10017460 | 3300009176 | Bacteria | 5594 |
| 164 | Ga0105242_10037486 | 3300009176 | Bacteria | 3894 |
| 165 | Ga0105242_10084700 | 3300009176 | Bacteria | 2657 |
| 166 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 167 | Ga0105248_10049054 | 3300009177 | Bacteria | 4736 |
| 168 | Ga0105248_10128292 | 3300009177 | Bacteria | 2861 |
| 169 | Ga0105237_10070835 | 3300009545 | Bacteria | 3482 |
| 170 | Ga0105237_10159778 | 3300009545 | Bacteria | 2252 |
| 171 | Ga0105237_10320893 | 3300009545 | Bacteria | 1552 |
| 172 | Ga0105237_10395432 | 3300009545 | Bacteria | 1387 |
| 173 | Ga0105237_10746619 | 3300009545 | Bacteria | 985 |
| 174 | Ga0105237_10765380 | 3300009545 | Bacteria | 972 |
| 175 | Ga0105238_10042693 | 3300009551 | Bacteria | 4591 |
| 176 | Ga0105238_10083039 | 3300009551 | Bacteria | 3193 |
| 177 | Ga0105238_10283127 | 3300009551 | Bacteria | 1639 |
| 178 | Ga0105238_10560908 | 3300009551 | Bacteria | 1147 |
| 179 | Ga0105238_10858050 | 3300009551 | Bacteria | 925 |
| 180 | Ga0105238_11060011 | 3300009551 | Bacteria | 832 |
| 181 | Ga0105238_11426975 | 3300009551 | Bacteria | 720 |
| 182 | Ga0105249_10004983 | 3300009553 | Bacteria | 11454 |
| 183 | Ga0105249_10180275 | 3300009553 | Bacteria | 2055 |
| 184 | Ga0105239_10003373 | 3300010375 | Bacteria | 19598 |
| 185 | Ga0105239_10009872 | 3300010375 | Bacteria | 10724 |
| 186 | Ga0105239_10012800 | 3300010375 | Bacteria | 9333 |
| 187 | Ga0105239_10274120 | 3300010375 | Bacteria | 1898 |
| 188 | Ga0105239_10456918 | 3300010375 | Bacteria | 1449 |
| 189 | Ga0105239_10594920 | 3300010375 | Bacteria | 1261 |
| 190 | Ga0105239_11878927 | 3300010375 | Bacteria | 694 |
| 191 | Ga0105246_10093243 | 3300011119 | Bacteria | 2175 |
| 192 | Ga0157373_10455590 | 3300013100 | Bacteria | 921 |
| 193 | Ga0157373_10491860 | 3300013100 | Bacteria | 886 |
| 194 | Ga0157370_10038939 | 3300013104 | Bacteria | 4598 |
| 195 | Ga0157370_10046667 | 3300013104 | Bacteria | 4153 |
| 196 | Ga0157370_10182100 | 3300013104 | Bacteria | 1952 |
| 197 | Ga0157370_10298056 | 3300013104 | Bacteria | 1489 |
| 198 | Ga0157370_10450650 | 3300013104 | Bacteria | 1183 |
| 199 | Ga0157369_10012565 | 3300013105 | Bacteria | 9606 |
| 200 | Ga0157369_10118610 | 3300013105 | Bacteria | 2809 |
| 201 | Ga0157369_10604210 | 3300013105 | Bacteria | 1132 |
| 202 | Ga0157374_10051271 | 3300013296 | Bacteria | 3839 |
| 203 | Ga0157374_10220212 | 3300013296 | Bacteria | 1862 |
| 204 | Ga0157378_10088182 | 3300013297 | Bacteria | 2815 |
| 205 | Ga0157378_10097732 | 3300013297 | Bacteria | 2677 |
| 206 | Ga0157378_10287625 | 3300013297 | Bacteria | 1586 |
| 207 | Ga0157378_10745418 | 3300013297 | Bacteria | 1002 |
| 208 | Ga0163162_10008334 | 3300013306 | Bacteria | 10111 |
| 209 | Ga0163162_10093293 | 3300013306 | Bacteria | 3095 |
| 210 | Ga0163162_10566639 | 3300013306 | Bacteria | 1263 |
| 211 | Ga0157372_10064258 | 3300013307 | Bacteria | 4118 |
| 212 | Ga0157372_10159582 | 3300013307 | Bacteria | 2606 |
| 213 | Ga0157372_10226351 | 3300013307 | Bacteria | 2168 |
| 214 | Ga0157375_10173971 | 3300013308 | Bacteria | 2302 |
| 215 | Ga0157375_10174265 | 3300013308 | Bacteria | 2300 |
| 216 | Ga0157375_10893451 | 3300013308 | Bacteria | 1033 |
| 217 | Ga0157375_11072178 | 3300013308 | Bacteria | 942 |
| 218 | Ga0163163_10000021 | 3300014325 | Bacteria | 191799 |
| 219 | Ga0163163_10048632 | 3300014325 | Bacteria | 4171 |
| 220 | Ga0163163_10077632 | 3300014325 | Bacteria | 3316 |
| 221 | Ga0163163_10301609 | 3300014325 | Bacteria | 1654 |
| 222 | Ga0163163_10439617 | 3300014325 | Bacteria | 1364 |
| 223 | Ga0157380_10757972 | 3300014326 | Bacteria | 983 |
| 224 | Ga0157377_10144416 | 3300014745 | Bacteria | 1465 |
| 225 | Ga0157379_10000304 | 3300014968 | Bacteria | 38893 |
| 226 | Ga0157379_10003277 | 3300014968 | Bacteria | 13713 |
| 227 | Ga0157379_10162175 | 3300014968 | Bacteria | 2018 |
| 228 | Ga0157379_10241593 | 3300014968 | Bacteria | 1638 |
| 229 | Ga0157379_11038885 | 3300014968 | Bacteria | 783 |
| 230 | Ga0157376_10340468 | 3300014969 | Bacteria | 1432 |
| 231 | Ga0157376_11148654 | 3300014969 | Bacteria | 804 |
| 232 | Ga0163161_10325510 | 3300017792 | Bacteria | 1216 |
| 233 | Ga0213872_10098369 | 3300021361 | Bacteria | 1306 |
| 234 | Ga0213874_10001161 | 3300021377 | Bacteria | 5402 |
| 235 | Ga0213874_10038817 | 3300021377 | Bacteria | 1415 |
| 236 | Ga0213876_10000167 | 3300021384 | Bacteria | 69385 |
| 237 | Ga0213876_10000322 | 3300021384 | Bacteria | 41914 |
| 238 | Ga0213876_10011629 | 3300021384 | Bacteria | 4699 |
| 239 | Ga0213876_10141117 | 3300021384 | Bacteria | 1281 |
| 240 | Ga0213876_10222275 | 3300021384 | Bacteria | 1004 |
| 241 | Ga0213875_10000911 | 3300021388 | Bacteria | 21434 |
| 242 | Ga0213871_10079436 | 3300021441 | Bacteria | 938 |
| 243 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 244 | Ga0209233_1043971 | 3300025261 | Bacteria | 949 |
| 245 | Ga0209676_1000269 | 3300025292 | Bacteria | 108375 |
| 246 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 247 | Ga0209050_1014548 | 3300025298 | Bacteria | 3380 |
| 248 | Ga0207710_10026810 | 3300025900 | Bacteria | 2491 |
| 249 | Ga0207688_10261151 | 3300025901 | Bacteria | 1051 |
| 250 | Ga0207705_10004807 | 3300025909 | Bacteria | 10169 |
| 251 | Ga0207705_10029374 | 3300025909 | Bacteria | 3919 |
| 252 | Ga0207705_10246891 | 3300025909 | Bacteria | 1361 |
| 253 | Ga0207654_10017205 | 3300025911 | Bacteria | 3776 |
| 254 | Ga0207654_10025054 | 3300025911 | Bacteria | 3213 |
| 255 | Ga0207654_10100203 | 3300025911 | Bacteria | 1783 |
| 256 | Ga0207654_10116673 | 3300025911 | Bacteria | 1670 |
| 257 | Ga0207654_10135096 | 3300025911 | Bacteria | 1566 |
| 258 | Ga0207654_10232511 | 3300025911 | Bacteria | 1228 |
| 259 | Ga0207654_10281859 | 3300025911 | Bacteria | 1124 |
| 260 | Ga0207707_10000002 | 3300025912 | Bacteria | 1142054 |
| 261 | Ga0207707_10024954 | 3300025912 | Bacteria | 5230 |
| 262 | Ga0207707_10036197 | 3300025912 | Bacteria | 4317 |
| 263 | Ga0207707_10188997 | 3300025912 | Bacteria | 1797 |
| 264 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 265 | Ga0207695_10018410 | 3300025913 | Bacteria | 8078 |
| 266 | Ga0207695_10021214 | 3300025913 | Bacteria | 7418 |
| 267 | Ga0207695_10039690 | 3300025913 | Bacteria | 5057 |
| 268 | Ga0207695_10072969 | 3300025913 | Bacteria | 3499 |
| 269 | Ga0207695_10106427 | 3300025913 | Bacteria | 2791 |
| 270 | Ga0207695_10136383 | 3300025913 | Bacteria | 2407 |
| 271 | Ga0207695_10178394 | 3300025913 | Bacteria | 2046 |
| 272 | Ga0207695_10263480 | 3300025913 | Bacteria | 1621 |
| 273 | Ga0207695_10267290 | 3300025913 | Bacteria | 1606 |
| 274 | Ga0207693_10000809 | 3300025915 | Bacteria | 27963 |
| 275 | Ga0207693_10178561 | 3300025915 | Bacteria | 1670 |
| 276 | Ga0207663_10143965 | 3300025916 | Bacteria | 1664 |
| 277 | Ga0207660_10001154 | 3300025917 | Bacteria | 17638 |
| 278 | Ga0207660_10022576 | 3300025917 | Bacteria | 4241 |
| 279 | Ga0207660_10051588 | 3300025917 | Bacteria | 2925 |
| 280 | Ga0207660_10300920 | 3300025917 | Bacteria | 1277 |
| 281 | Ga0207657_10006097 | 3300025919 | Bacteria | 12535 |
| 282 | Ga0207657_10051133 | 3300025919 | Bacteria | 3592 |
| 283 | Ga0207657_10261848 | 3300025919 | Bacteria | 1376 |
| 284 | Ga0207657_10628821 | 3300025919 | Bacteria | 836 |
| 285 | Ga0207649_10000060 | 3300025920 | Bacteria | 99202 |
| 286 | Ga0207649_10241976 | 3300025920 | Bacteria | 1296 |
| 287 | Ga0207649_10960649 | 3300025920 | Bacteria | 671 |
| 288 | Ga0207652_10000197 | 3300025921 | Bacteria | 63525 |
| 289 | Ga0207652_10023428 | 3300025921 | Bacteria | 5115 |
| 290 | Ga0207652_10086100 | 3300025921 | Bacteria | 2755 |
| 291 | Ga0207652_10276272 | 3300025921 | Bacteria | 1515 |
| 292 | Ga0207646_10076216 | 3300025922 | Bacteria | 2997 |
| 293 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 294 | Ga0207694_10176022 | 3300025924 | Bacteria | 1734 |
| 295 | Ga0207694_10280954 | 3300025924 | Bacteria | 1367 |
| 296 | Ga0207694_10552388 | 3300025924 | Bacteria | 967 |
| 297 | Ga0207659_11264604 | 3300025926 | Bacteria | 634 |
| 298 | Ga0207687_10005839 | 3300025927 | Bacteria | 8142 |
| 299 | Ga0207687_10106730 | 3300025927 | Bacteria | 2071 |
| 300 | Ga0207700_10098889 | 3300025928 | Bacteria | 2322 |
| 301 | Ga0207700_10190330 | 3300025928 | Bacteria | 1724 |
| 302 | Ga0207664_10143490 | 3300025929 | Bacteria | 2023 |
| 303 | Ga0207664_10300089 | 3300025929 | Bacteria | 1413 |
| 304 | Ga0207690_10006072 | 3300025932 | Bacteria | 7155 |
| 305 | Ga0207690_10272772 | 3300025932 | Bacteria | 1315 |
| 306 | Ga0207686_10001631 | 3300025934 | Bacteria | 12536 |
| 307 | Ga0207686_10024090 | 3300025934 | Bacteria | 3522 |
| 308 | Ga0207686_10097491 | 3300025934 | Bacteria | 1956 |
| 309 | Ga0207709_10152238 | 3300025935 | Bacteria | 1603 |
| 310 | Ga0207670_10498436 | 3300025936 | Bacteria | 988 |
| 311 | Ga0207669_10483504 | 3300025937 | Bacteria | 987 |
| 312 | Ga0207704_10073711 | 3300025938 | Bacteria | 2175 |
| 313 | Ga0207704_10629487 | 3300025938 | Bacteria | 881 |
| 314 | Ga0207704_10642640 | 3300025938 | Bacteria | 873 |
| 315 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 316 | Ga0207711_10134983 | 3300025941 | Bacteria | 2216 |
| 317 | Ga0207689_10078008 | 3300025942 | Bacteria | 2722 |
| 318 | Ga0207689_10083601 | 3300025942 | Bacteria | 2624 |
| 319 | Ga0207689_10187325 | 3300025942 | Bacteria | 1707 |
| 320 | Ga0207679_10349273 | 3300025945 | Bacteria | 1289 |
| 321 | Ga0207679_10936697 | 3300025945 | Bacteria | 793 |
| 322 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 323 | Ga0207667_10089940 | 3300025949 | Bacteria | 3172 |
| 324 | Ga0207667_10183552 | 3300025949 | Bacteria | 2148 |
| 325 | Ga0207667_10271040 | 3300025949 | Bacteria | 1735 |
| 326 | Ga0207651_10040945 | 3300025960 | Bacteria | 3071 |
| 327 | Ga0207712_10084372 | 3300025961 | Bacteria | 2321 |
| 328 | Ga0207712_10162925 | 3300025961 | Bacteria | 1735 |
| 329 | Ga0207712_10730874 | 3300025961 | Bacteria | 866 |
| 330 | Ga0207668_11066121 | 3300025972 | Bacteria | 724 |
| 331 | Ga0207668_11094377 | 3300025972 | Bacteria | 714 |
| 332 | Ga0207677_10066545 | 3300026023 | Bacteria | 2520 |
| 333 | Ga0207677_10327066 | 3300026023 | Bacteria | 1276 |
| 334 | Ga0207677_10609319 | 3300026023 | Bacteria | 959 |
| 335 | Ga0207703_10029882 | 3300026035 | Bacteria | 4303 |
| 336 | Ga0207703_10069710 | 3300026035 | Bacteria | 2900 |
| 337 | Ga0207703_10527624 | 3300026035 | Bacteria | 1111 |
| 338 | Ga0207639_10028153 | 3300026041 | Bacteria | 4101 |
| 339 | Ga0207639_10078708 | 3300026041 | Bacteria | 2603 |
| 340 | Ga0207639_10157725 | 3300026041 | Bacteria | 1909 |
| 341 | Ga0207678_10418493 | 3300026067 | Bacteria | 1162 |
| 342 | Ga0207702_10277503 | 3300026078 | Bacteria | 1583 |
| 343 | Ga0207702_10419543 | 3300026078 | Bacteria | 1294 |
| 344 | Ga0207641_10101756 | 3300026088 | Bacteria | 2532 |
| 345 | Ga0207641_10509611 | 3300026088 | Bacteria | 1169 |
| 346 | Ga0207648_10002996 | 3300026089 | Bacteria | 17849 |
| 347 | Ga0207648_11230552 | 3300026089 | Bacteria | 703 |
| 348 | Ga0207676_10029076 | 3300026095 | Bacteria | 4134 |
| 349 | Ga0207676_10260840 | 3300026095 | Bacteria | 1565 |
| 350 | Ga0207674_10116115 | 3300026116 | Bacteria | 2648 |
| 351 | Ga0207674_10243964 | 3300026116 | Bacteria | 1743 |
| 352 | Ga0207674_10641198 | 3300026116 | Bacteria | 1026 |
| 353 | Ga0207674_10902591 | 3300026116 | Bacteria | 852 |
| 354 | Ga0207675_100102346 | 3300026118 | Bacteria | 2699 |
| 355 | Ga0207675_100143644 | 3300026118 | Bacteria | 2268 |
| 356 | Ga0207675_100702832 | 3300026118 | Bacteria | 1020 |
| 357 | Ga0207675_100730070 | 3300026118 | Bacteria | 1001 |
| 358 | Ga0207683_10004248 | 3300026121 | Bacteria | 12363 |
| 359 | Ga0207683_10018865 | 3300026121 | Bacteria | 5885 |
| 360 | Ga0207683_10021537 | 3300026121 | Bacteria | 5521 |
| 361 | Ga0207683_10258480 | 3300026121 | Bacteria | 1590 |
| 362 | Ga0207683_10871480 | 3300026121 | Bacteria | 836 |
| 363 | Ga0207698_10063956 | 3300026142 | Bacteria | 2882 |
| 364 | Ga0207698_10120706 | 3300026142 | Bacteria | 2218 |
| 365 | Ga0207698_10360026 | 3300026142 | Bacteria | 1377 |
| 366 | Ga0207698_11009920 | 3300026142 | Bacteria | 843 |
| 367 | Ga0207428_10191342 | 3300027907 | Bacteria | 1542 |
| 368 | Ga0268266_10001271 | 3300028379 | Bacteria | 30810 |
| 369 | Ga0268266_10072563 | 3300028379 | Bacteria | 2985 |
| 370 | Ga0268266_10100739 | 3300028379 | Bacteria | 2545 |
| 371 | Ga0268266_10101684 | 3300028379 | Bacteria | 2534 |
| 372 | Ga0268266_10184980 | 3300028379 | Bacteria | 1899 |
| 373 | Ga0268264_10038901 | 3300028381 | Bacteria | 3928 |
| 374 | Ga0268264_10136500 | 3300028381 | Bacteria | 2181 |
| 375 | Ga0265334_10000673 | 3300028573 | Bacteria | 17152 |
| 376 | Ga0265334_10032497 | 3300028573 | Bacteria | 2081 |
| 377 | Ga0265318_10000388 | 3300028577 | Bacteria | 34328 |
| 378 | Ga0265318_10028719 | 3300028577 | Bacteria | 2173 |
| 379 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 380 | Ga0265338_10004398 | 3300028800 | Bacteria | 19064 |
| 381 | Ga0265338_10033971 | 3300028800 | Bacteria | 4940 |
| 382 | Ga0265330_10041620 | 3300031235 | Bacteria | 2036 |
| 383 | Ga0265330_10054655 | 3300031235 | Bacteria | 1745 |
| 384 | Ga0265330_10061366 | 3300031235 | Bacteria | 1635 |
| 385 | Ga0265330_10081018 | 3300031235 | Bacteria | 1399 |
| 386 | Ga0265330_10131524 | 3300031235 | Bacteria | 1065 |
| 387 | Ga0265330_10215028 | 3300031235 | Bacteria | 811 |
| 388 | Ga0265332_10004596 | 3300031238 | Bacteria | 6457 |
| 389 | Ga0265332_10037781 | 3300031238 | Bacteria | 2094 |
| 390 | Ga0265328_10225315 | 3300031239 | Bacteria | 714 |
| 391 | Ga0265320_10000123 | 3300031240 | Bacteria | 67449 |
| 392 | Ga0265320_10022145 | 3300031240 | Bacteria | 3404 |
| 393 | Ga0265325_10000002 | 3300031241 | Bacteria | 396758 |
| 394 | Ga0265325_10016521 | 3300031241 | Bacteria | 4126 |
| 395 | Ga0265325_10017178 | 3300031241 | Bacteria | 4024 |
| 396 | Ga0265325_10023835 | 3300031241 | Bacteria | 3335 |
| 397 | Ga0265325_10040167 | 3300031241 | Bacteria | 2458 |
| 398 | Ga0265325_10088185 | 3300031241 | Bacteria | 1533 |
| 399 | Ga0265325_10186837 | 3300031241 | Bacteria | 962 |
| 400 | Ga0265325_10251623 | 3300031241 | Bacteria | 800 |
| 401 | Ga0265329_10014355 | 3300031242 | Bacteria | 2798 |
| 402 | Ga0265329_10131959 | 3300031242 | Bacteria | 804 |
| 403 | Ga0265340_10000356 | 3300031247 | Bacteria | 24392 |
| 404 | Ga0265340_10001813 | 3300031247 | Bacteria | 12205 |
| 405 | Ga0265340_10026657 | 3300031247 | Bacteria | 2920 |
| 406 | Ga0265340_10030321 | 3300031247 | Bacteria | 2710 |
| 407 | Ga0265340_10060346 | 3300031247 | Bacteria | 1817 |
| 408 | Ga0265340_10069521 | 3300031247 | Bacteria | 1671 |
| 409 | Ga0265340_10133856 | 3300031247 | Bacteria | 1136 |
| 410 | Ga0265340_10134292 | 3300031247 | Bacteria | 1134 |
| 411 | Ga0265339_10002449 | 3300031249 | Bacteria | 13290 |
| 412 | Ga0265339_10006481 | 3300031249 | Bacteria | 7675 |
| 413 | Ga0265339_10013056 | 3300031249 | Bacteria | 5046 |
| 414 | Ga0265339_10020986 | 3300031249 | Bacteria | 3809 |
| 415 | Ga0265339_10041153 | 3300031249 | Bacteria | 2566 |
| 416 | Ga0265339_10170076 | 3300031249 | Bacteria | 1091 |
| 417 | Ga0265339_10352548 | 3300031249 | Bacteria | 693 |
| 418 | Ga0265331_10000049 | 3300031250 | Bacteria | 182618 |
| 419 | Ga0265331_10000303 | 3300031250 | Bacteria | 53811 |
| 420 | Ga0265331_10001113 | 3300031250 | Bacteria | 20686 |
| 421 | Ga0265331_10006811 | 3300031250 | Bacteria | 6694 |
| 422 | Ga0265331_10011826 | 3300031250 | Bacteria | 4764 |
| 423 | Ga0265331_10017858 | 3300031250 | Bacteria | 3692 |
| 424 | Ga0265331_10025616 | 3300031250 | Bacteria | 2975 |
| 425 | Ga0265327_10000007 | 3300031251 | Bacteria | 678515 |
| 426 | Ga0265316_10003516 | 3300031344 | Bacteria | 15817 |
| 427 | Ga0265316_10021855 | 3300031344 | Bacteria | 5409 |
| 428 | Ga0265316_10176558 | 3300031344 | Bacteria | 1591 |
| 429 | Ga0265316_10305331 | 3300031344 | Bacteria | 1158 |
| 430 | Ga0307513_10272958 | 3300031456 | Bacteria | 1473 |
| 431 | Ga0265313_10000689 | 3300031595 | Bacteria | 34784 |
| 432 | Ga0265313_10001836 | 3300031595 | Bacteria | 19363 |
| 433 | Ga0265313_10004096 | 3300031595 | Bacteria | 11352 |
| 434 | Ga0265313_10028353 | 3300031595 | Bacteria | 2912 |
| 435 | Ga0265313_10060491 | 3300031595 | Bacteria | 1776 |
| 436 | Ga0265313_10075295 | 3300031595 | Bacteria | 1545 |
| 437 | Ga0265313_10142954 | 3300031595 | Bacteria | 1028 |
| 438 | Ga0265313_10144845 | 3300031595 | Bacteria | 1019 |
| 439 | Ga0265314_10001319 | 3300031711 | Bacteria | 28119 |
| 440 | Ga0265314_10002354 | 3300031711 | Bacteria | 19492 |
| 441 | Ga0265314_10008314 | 3300031711 | Bacteria | 8901 |
| 442 | Ga0265314_10024900 | 3300031711 | Bacteria | 4527 |
| 443 | Ga0265314_10035726 | 3300031711 | Bacteria | 3620 |
| 444 | Ga0265314_10039342 | 3300031711 | Bacteria | 3407 |
| 445 | Ga0265314_10049983 | 3300031711 | Bacteria | 2924 |
| 446 | Ga0265314_10050108 | 3300031711 | Bacteria | 2919 |
| 447 | Ga0265314_10071816 | 3300031711 | Bacteria | 2314 |
| 448 | Ga0265314_10079446 | 3300031711 | Bacteria | 2168 |
| 449 | Ga0265314_10100146 | 3300031711 | Bacteria | 1865 |
| 450 | Ga0265342_10007269 | 3300031712 | Bacteria | 8132 |
| 451 | Ga0265342_10018188 | 3300031712 | Bacteria | 4558 |
| 452 | Ga0265342_10020762 | 3300031712 | Bacteria | 4204 |
| 453 | Ga0265342_10138377 | 3300031712 | Bacteria | 1360 |
| 454 | Ga0265342_10230315 | 3300031712 | Bacteria | 995 |
| 455 | Ga0265342_10252024 | 3300031712 | Bacteria | 942 |
| 456 | Ga0265342_10269151 | 3300031712 | Bacteria | 904 |
| 457 | Ga0307516_10015652 | 3300031730 | Bacteria | 7973 |
| 458 | Ga0307516_10101357 | 3300031730 | Bacteria | 2694 |
| 459 | Ga0307407_10238747 | 3300031903 | Bacteria | 1239 |
| 460 | Ga0307407_10425956 | 3300031903 | Bacteria | 958 |
| 461 | Ga0307414_10425634 | 3300032004 | Bacteria | 1159 |
| 462 | Ga0307411_10522838 | 3300032005 | Bacteria | 1007 |
| 463 | Ga0373923_0208784 | 3300035111 | Bacteria | 905 |
| 464 | Ga0373936_0032915 | 3300035113 | Bacteria | 2053 |
| 465 | Ga0373939_0008087 | 3300035114 | Bacteria | 2571 |
| 466 | Ga0373956_0215427 | 3300035119 | Bacteria | 911 |
| 467 | Ga0373946_0034867 | 3300035171 | Bacteria | 2034 |
| 468 | Ga0373955_0072854 | 3300035172 | Bacteria | 1925 |
| 469 | Ga0373935_0073481 | 3300035692 | Bacteria | 2209 |
| 470 | Ga0373927_0016671 | 3300035695 | Bacteria | 4847 |
| 471 | Ga0373927_0038435 | 3300035695 | Bacteria | 3107 |
| 472 | Ga0373927_0656051 | 3300035695 | Bacteria | 693 |
| 473 | Ga0373933_0486823 | 3300035724 | Bacteria | 808 |
| 474 | Ga0373947_0009096 | 3300035725 | Bacteria | 5709 |
| 475 | Ga0373937_0000338 | 3300036401 | Bacteria | 44355 |
| 476 | Ga0373937_0187274 | 3300036401 | Bacteria | 1944 |
| 477 | Ga0373937_0365600 | 3300036401 | Bacteria | 1368 |
| 478 | Ga0373937_0635489 | 3300036401 | Bacteria | 1013 |
| 479 | Ga0316582_0246670 | 3300036647 | Bacteria | 1224 |
| 480 | Ga0373925_0029717 | 3300037068 | Bacteria | 4009 |
| 481 | Ga0373925_0124627 | 3300037068 | Bacteria | 2003 |
| 482 | Ga0395899_0446136 | 3300037312 | Bacteria | 848 |
| 483 | Ga0395900_0064337 | 3300037418 | Bacteria | 3770 |
| 484 | Ga0395900_0095814 | 3300037418 | Bacteria | 3049 |
| 485 | Ga0395900_0854836 | 3300037418 | Bacteria | 835 |
| 486 | Ga0395898_0009675 | 3300037466 | Bacteria | 10111 |
| 487 | Ga0395898_0054844 | 3300037466 | Bacteria | 3888 |
| 488 | Ga0436364_0220830 | 3300037853 | Bacteria | 2633 |
| 489 | Ga0436364_0259249 | 3300037853 | Bacteria | 81192 |
| 490 | Ga0395901_0017833 | 3300038443 | Bacteria | 7246 |
| 491 | Ga0395901_0029255 | 3300038443 | Bacteria | 5670 |
| 492 | Ga0400483_018790 | 3300039062 | Bacteria | 1194 |
| 493 | Ga0400483_085364 | 3300039062 | Bacteria | 2445 |
| 494 | Ga0400483_211285 | 3300039062 | Bacteria | 2496 |
| 495 | Ga0436365_0072725 | 3300039437 | Bacteria | 1109 |
| 496 | Ga0436365_0173471 | 3300039437 | Bacteria | 110650 |
| 497 | Ga0436365_0193778 | 3300039437 | Bacteria | 999 |
| 498 | Ga0436365_0308916 | 3300039437 | Bacteria | 9769 |
| 499 | Ga0436365_0606497 | 3300039437 | Bacteria | 1373 |
| 500 | Ga0436365_0982785 | 3300039437 | Bacteria | 28509 |
| 501 | Ga0436365_1291084 | 3300039437 | Bacteria | 167262 |
| 502 | Ga0436360_0385609 | 3300039438 | Bacteria | 1035 |
| 503 | Ga0436360_0553989 | 3300039438 | Bacteria | 1239 |
| 504 | Ga0436360_0906325 | 3300039438 | Bacteria | 1572 |
| 505 | Ga0436361_0018378 | 3300039447 | Bacteria | 535 |
| 506 | Ga0436361_0106800 | 3300039447 | Bacteria | 664 |
| 507 | Ga0436361_0157546 | 3300039447 | Bacteria | 1408 |
| 508 | Ga0436361_0647200 | 3300039447 | Bacteria | 1041 |
| 509 | Ga0436361_0687573 | 3300039447 | Bacteria | 896 |
| 510 | Ga0436361_0764950 | 3300039447 | Bacteria | 2443 |
| 511 | Ga0436361_0829388 | 3300039447 | Bacteria | 8428 |
| 512 | Ga0436361_0950603 | 3300039447 | Bacteria | 2977 |
| 513 | Ga0436363_1184338 | 3300039450 | Bacteria | 22162 |
| 514 | Ga0436363_1287632 | 3300039450 | Bacteria | 1511 |
| 515 | Ga0436362_0031048 | 3300039453 | Bacteria | 2067 |
| 516 | Ga0436362_0076139 | 3300039453 | Bacteria | 958 |
| 517 | Ga0436362_1154232 | 3300039453 | Bacteria | 698 |
| 518 | Ga0439446_0098379 | 3300042156 | Bacteria | 923 |
| 519 | Ga0439464_0063777 | 3300042439 | Bacteria | 1082 |
| 520 | Ga0453684_0000006 | 3300044712 | Bacteria | 1364191 |
| 521 | Ga0453684_0000410 | 3300044712 | Bacteria | 175627 |
| 522 | Ga0466957_0327983 | 3300044842 | Bacteria | 1034 |
| 523 | Ga0466958_0145466 | 3300045836 | Bacteria | 1494 |
| 524 | Ga0466967_0254369 | 3300045976 | Bacteria | 1679 |
| 525 | Ga0466967_0653669 | 3300045976 | Bacteria | 1040 |
| 526 | Ga0495592_0356207 | 3300046454 | Bacteria | 937 |
| 527 | Ga0495580_0022060 | 3300046472 | Bacteria | 4692 |
| 528 | Ga0495580_0362947 | 3300046472 | Bacteria | 980 |
| 529 | Ga0495580_0496426 | 3300046472 | Bacteria | 815 |
| 530 | Ga0495582_0005935 | 3300046473 | Bacteria | 6809 |
| 531 | Ga0495582_0401121 | 3300046473 | Bacteria | 791 |
| 532 | Ga0495662_0330768 | 3300046476 | Bacteria | 749 |
| 533 | Ga0495664_0112737 | 3300046477 | Bacteria | 1642 |
| 534 | Ga0495664_0212227 | 3300046477 | Bacteria | 1172 |
| 535 | Ga0495664_0284403 | 3300046477 | Bacteria | 999 |
| 536 | Ga0495628_0210658 | 3300046516 | Bacteria | 1462 |
| 537 | Ga0495630_0469358 | 3300046517 | Bacteria | 965 |
| 538 | Ga0495652_0153912 | 3300046529 | Bacteria | 1793 |
| 539 | Ga0495652_0173490 | 3300046529 | Bacteria | 1662 |
| 540 | Ga0495665_0069877 | 3300046531 | Bacteria | 1851 |
| 541 | Ga0495621_0085484 | 3300046539 | Bacteria | 1182 |
| 542 | Ga0495645_0044951 | 3300046543 | Bacteria | 3221 |
| 543 | Ga0495645_0118450 | 3300046543 | Bacteria | 1867 |
| 544 | Ga0495622_0002990 | 3300046557 | Bacteria | 8035 |
| 545 | Ga0495647_0177328 | 3300046681 | Bacteria | 926 |
| 546 | Ga0495658_0000415 | 3300046683 | Bacteria | 23946 |
| 547 | Ga0495669_0188591 | 3300046684 | Bacteria | 984 |
| 548 | Ga0495613_0203206 | 3300046689 | Bacteria | 1396 |
| 549 | Ga0495671_0176808 | 3300046692 | Bacteria | 1037 |
| 550 | Ga0495600_0403655 | 3300046809 | Bacteria | 850 |
| 551 | Ga0495600_0412797 | 3300046809 | Bacteria | 839 |
| 552 | Ga0495672_0271063 | 3300047320 | Bacteria | 815 |
| 553 | Ga0495675_0072141 | 3300047444 | Bacteria | 2179 |
| 554 | Ga0495602_0024171 | 3300048088 | Bacteria | 5899 |
| 555 | Ga0496106_0294308 | 3300048909 | Bacteria | 1302 |
| 556 | Ga0496120_0136847 | 3300048923 | Bacteria | 1248 |
| 557 | Ga0496121_0000154 | 3300048924 | Bacteria | 150013 |
| 558 | Ga0496126_0001104 | 3300048929 | Bacteria | 45291 |
| 559 | Ga0496126_0057975 | 3300048929 | Bacteria | 3493 |
| 560 | Ga0495682_0038380 | 3300049460 | Bacteria | 1760 |
| 561 | Ga0501031_0003581 | 3300049568 | Bacteria | 9989 |
| 562 | Ga0501032_0011974 | 3300049569 | Bacteria | 6211 |
| 563 | Ga0501032_0055900 | 3300049569 | Bacteria | 2654 |
| 564 | Ga0501032_0150963 | 3300049569 | Bacteria | 1528 |
| 565 | Ga0501032_0258564 | 3300049569 | Bacteria | 1129 |
| 566 | Ga0501033_0019688 | 3300049570 | Bacteria | 5100 |
| 567 | Ga0501033_0024361 | 3300049570 | Bacteria | 4566 |
| 568 | Ga0501033_0024604 | 3300049570 | Bacteria | 4541 |
| 569 | Ga0501033_0045401 | 3300049570 | Bacteria | 3270 |
| 570 | Ga0501033_0074198 | 3300049570 | Bacteria | 2497 |
| 571 | Ga0501033_0089680 | 3300049570 | Bacteria | 2249 |
| 572 | Ga0501033_0093553 | 3300049570 | Bacteria | 2198 |
| 573 | Ga0501033_0121976 | 3300049570 | Bacteria | 1891 |
| 574 | Ga0501033_0169487 | 3300049570 | Bacteria | 1568 |
| 575 | Ga0501034_0019438 | 3300049571 | Bacteria | 6948 |
| 576 | Ga0501034_0067469 | 3300049571 | Bacteria | 3590 |
| 577 | Ga0501034_0117501 | 3300049571 | Bacteria | 2647 |
| 578 | Ga0501034_0227400 | 3300049571 | Bacteria | 1816 |
| 579 | Ga0501034_0325872 | 3300049571 | Bacteria | 1468 |
| 580 | Ga0501034_0333949 | 3300049571 | Bacteria | 1447 |
| 581 | Ga0501034_0392461 | 3300049571 | Bacteria | 1312 |
| 582 | Ga0501036_0013630 | 3300049572 | Bacteria | 6758 |
| 583 | Ga0501036_0046458 | 3300049572 | Bacteria | 3677 |
| 584 | Ga0501037_0024061 | 3300049573 | Bacteria | 4503 |
| 585 | Ga0501037_0038370 | 3300049573 | Bacteria | 3529 |
| 586 | Ga0501037_0275275 | 3300049573 | Bacteria | 1174 |
| 587 | Ga0501037_0310201 | 3300049573 | Bacteria | 1094 |
| 588 | Ga0501037_0312012 | 3300049573 | Bacteria | 1090 |
| 589 | Ga0501037_0399467 | 3300049573 | Bacteria | 943 |
| 590 | Ga0501037_0561452 | 3300049573 | Bacteria | 769 |
| 591 | Ga0501038_0119239 | 3300049574 | Bacteria | 2178 |
| 592 | Ga0501038_0124114 | 3300049574 | Bacteria | 2126 |
| 593 | Ga0501038_0130457 | 3300049574 | Bacteria | 2064 |
| 594 | Ga0501038_0206322 | 3300049574 | Bacteria | 1575 |
| 595 | Ga0501039_0012551 | 3300049575 | Bacteria | 6471 |
| 596 | Ga0501039_0210885 | 3300049575 | Bacteria | 1528 |
| 597 | Ga0501039_0793787 | 3300049575 | Bacteria | 739 |
| 598 | Ga0501042_0032711 | 3300049578 | Bacteria | 3683 |
| 599 | Ga0501042_0397908 | 3300049578 | Bacteria | 998 |
| 600 | Ga0501043_0028653 | 3300049579 | Bacteria | 4371 |
| 601 | Ga0501043_0037134 | 3300049579 | Bacteria | 3832 |
| 602 | Ga0501043_0045214 | 3300049579 | Bacteria | 3463 |
| 603 | Ga0501043_0111974 | 3300049579 | Bacteria | 2143 |
| 604 | Ga0501043_0121004 | 3300049579 | Bacteria | 2053 |
| 605 | Ga0501043_0141740 | 3300049579 | Bacteria | 1882 |
| 606 | Ga0501043_0143809 | 3300049579 | Bacteria | 1867 |
| 607 | Ga0501046_0002562 | 3300049580 | Bacteria | 17013 |
| 608 | Ga0501046_0014573 | 3300049580 | Bacteria | 6627 |
| 609 | Ga0501046_0040290 | 3300049580 | Bacteria | 3734 |
| 610 | Ga0501046_0044234 | 3300049580 | Bacteria | 3542 |
| 611 | Ga0501046_0179595 | 3300049580 | Bacteria | 1583 |
| 612 | Ga0501047_0002943 | 3300049581 | Bacteria | 16145 |
| 613 | Ga0501047_0004907 | 3300049581 | Bacteria | 12563 |
| 614 | Ga0501047_0009478 | 3300049581 | Bacteria | 9199 |
| 615 | Ga0501047_0009629 | 3300049581 | Bacteria | 9135 |
| 616 | Ga0501047_0032360 | 3300049581 | Bacteria | 5048 |
| 617 | Ga0501047_0037093 | 3300049581 | Bacteria | 4712 |
| 618 | Ga0501047_0089165 | 3300049581 | Bacteria | 2962 |
| 619 | Ga0501047_0170499 | 3300049581 | Bacteria | 2045 |
| 620 | Ga0501047_0252181 | 3300049581 | Bacteria | 1613 |
| 621 | Ga0501047_0258296 | 3300049581 | Bacteria | 1590 |
| 622 | Ga0501047_0286784 | 3300049581 | Bacteria | 1490 |
| 623 | Ga0501047_0314612 | 3300049581 | Bacteria | 1406 |
| 624 | Ga0501047_0584876 | 3300049581 | Bacteria | 939 |
| 625 | Ga0501048_0023710 | 3300049582 | Bacteria | 4481 |
| 626 | Ga0501048_0397940 | 3300049582 | Bacteria | 984 |
| 627 | Ga0501048_0575269 | 3300049582 | Bacteria | 808 |
| 628 | Ga0501067_0001612 | 3300049583 | Bacteria | 12353 |
| 629 | Ga0501067_0011618 | 3300049583 | Bacteria | 4876 |
| 630 | Ga0501067_0015267 | 3300049583 | Bacteria | 4251 |
| 631 | Ga0501069_0015193 | 3300049585 | Bacteria | 4126 |
| 632 | Ga0501069_0016664 | 3300049585 | Bacteria | 3949 |
| 633 | Ga0501070_0002763 | 3300049586 | Bacteria | 15316 |
| 634 | Ga0501070_0039926 | 3300049586 | Bacteria | 3914 |
| 635 | Ga0501070_0075317 | 3300049586 | Bacteria | 2794 |
| 636 | Ga0501070_0120164 | 3300049586 | Bacteria | 2171 |
| 637 | Ga0501070_0166774 | 3300049586 | Bacteria | 1815 |
| 638 | Ga0501070_0221410 | 3300049586 | Bacteria | 1552 |
| 639 | Ga0501071_0066497 | 3300049587 | Bacteria | 2620 |
| 640 | Ga0501071_0196002 | 3300049587 | Bacteria | 1516 |
| 641 | Ga0501072_0020816 | 3300049588 | Bacteria | 5083 |
| 642 | Ga0501072_0029107 | 3300049588 | Bacteria | 4312 |
| 643 | Ga0501072_0231434 | 3300049588 | Bacteria | 1472 |
| 644 | Ga0501073_0002197 | 3300049589 | Bacteria | 14601 |
| 645 | Ga0501073_0006683 | 3300049589 | Bacteria | 8587 |
| 646 | Ga0501073_0263526 | 3300049589 | Bacteria | 1189 |
| 647 | Ga0501073_0264951 | 3300049589 | Bacteria | 1186 |
| 648 | Ga0501073_0472860 | 3300049589 | Bacteria | 866 |
| 649 | Ga0501074_0003734 | 3300049590 | Bacteria | 10812 |
| 650 | Ga0501075_0116205 | 3300049591 | Bacteria | 2034 |
| 651 | Ga0501076_0064285 | 3300049592 | Bacteria | 2924 |
| 652 | Ga0501076_0209089 | 3300049592 | Bacteria | 1594 |
| 653 | Ga0501076_0669512 | 3300049592 | Bacteria | 857 |
| 654 | Ga0501079_0010441 | 3300049741 | Bacteria | 7059 |
| 655 | Ga0501079_0041411 | 3300049741 | Bacteria | 3555 |
| 656 | Ga0501080_0002883 | 3300049742 | Bacteria | 15123 |
| 657 | Ga0501080_0033031 | 3300049742 | Bacteria | 4828 |
| 658 | Ga0501080_0076339 | 3300049742 | Bacteria | 3117 |
| 659 | Ga0501080_0292540 | 3300049742 | Bacteria | 1479 |
| 660 | Ga0501080_0491288 | 3300049742 | Bacteria | 1098 |
| 661 | Ga0501080_0737252 | 3300049742 | Bacteria | 867 |
| 662 | Ga0501080_0773936 | 3300049742 | Bacteria | 843 |
| 663 | Ga0501080_0969471 | 3300049742 | Bacteria | 738 |
| 664 | Ga0501083_0005960 | 3300049744 | Bacteria | 8628 |
| 665 | Ga0501083_0157494 | 3300049744 | Bacteria | 1486 |
| 666 | Ga0501035_0030048 | 3300049822 | Bacteria | 4955 |
| 667 | Ga0501035_0044913 | 3300049822 | Bacteria | 3976 |
| 668 | Ga0501035_0065312 | 3300049822 | Bacteria | 3232 |
| 669 | Ga0501035_0066136 | 3300049822 | Bacteria | 3208 |
| 670 | Ga0501035_0089875 | 3300049822 | Bacteria | 2704 |
| 671 | Ga0501035_0141930 | 3300049822 | Bacteria | 2088 |
| 672 | Ga0501035_0169065 | 3300049822 | Bacteria | 1889 |
| 673 | Ga0501035_0185270 | 3300049822 | Bacteria | 1792 |
| 674 | Ga0501035_0255660 | 3300049822 | Bacteria | 1486 |
| 675 | Ga0501035_0500650 | 3300049822 | Bacteria | 1000 |
| 676 | Ga0501044_0003661 | 3300049823 | Bacteria | 17289 |
| 677 | Ga0501044_0025682 | 3300049823 | Bacteria | 6244 |
| 678 | Ga0501044_0045945 | 3300049823 | Bacteria | 4523 |
| 679 | Ga0501044_0057848 | 3300049823 | Bacteria | 3977 |
| 680 | Ga0501044_0127704 | 3300049823 | Bacteria | 2539 |
| 681 | Ga0501044_0149757 | 3300049823 | Bacteria | 2316 |
| 682 | Ga0501044_0154106 | 3300049823 | Bacteria | 2278 |
| 683 | Ga0501044_0190249 | 3300049823 | Bacteria | 2015 |
| 684 | Ga0501044_0285031 | 3300049823 | Bacteria | 1584 |
| 685 | Ga0501044_0404448 | 3300049823 | Bacteria | 1277 |
| 686 | Ga0501044_0956262 | 3300049823 | Bacteria | 730 |
| 687 | nmdc:mga0qj67_212823_c1 | 3300050509 | Bacteria | 1569 |
| 688 | nmdc:mga08y16_312326_c1 | 3300050511 | Bacteria | 1619 |
| 689 | Ga0495619_0254768 | 3300053085 | Bacteria | 1216 |
| 690 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 691 | Ga0500595_004900 | 3300053119 | Bacteria | 5921 |
| 692 | Ga0500595_048945 | 3300053119 | Bacteria | 1318 |
| 693 | Ga0500614_078905 | 3300053123 | Bacteria | 918 |
| 694 | Ga0500642_0037868 | 3300053130 | Bacteria | 2064 |
| 695 | Ga0500655_001037 | 3300053133 | Bacteria | 5364 |
| 696 | Ga0500559_0006453 | 3300053136 | Bacteria | 5298 |
| 697 | Ga0500559_0054652 | 3300053136 | Bacteria | 1769 |
| 698 | Ga0500568_0037697 | 3300053139 | Bacteria | 1960 |
| 699 | Ga0500573_0000032 | 3300053140 | Bacteria | 131098 |
| 700 | Ga0500577_0076821 | 3300053142 | Bacteria | 1323 |
| 701 | Ga0500619_005322 | 3300053154 | Bacteria | 2859 |
| 702 | Ga0500639_154325 | 3300053163 | Bacteria | 1054 |
| 703 | Ga0500645_047516 | 3300053730 | Bacteria | 1258 |
| 704 | Ga0501084_0000971 | 3300054114 | Bacteria | 22218 |
| 705 | Ga0501084_0008855 | 3300054114 | Bacteria | 8331 |
| 706 | Ga0501084_0012790 | 3300054114 | Bacteria | 6953 |
| 707 | Ga0501084_0015332 | 3300054114 | Bacteria | 6355 |
| 708 | Ga0501082_0004104 | 3300060353 | Bacteria | 12719 |
| 709 | Ga0501082_0050277 | 3300060353 | Bacteria | 3595 |
| 710 | Ga0501082_0132765 | 3300060353 | Bacteria | 2160 |
| 711 | Ga0501082_0841200 | 3300060353 | Bacteria | 803 |
| 712 | Ga0530510_0203973 | 3300061734 | Bacteria | 1469 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039062 | Ga0400483_018790 | Ga0400483_018790_31_534 | 157 |
| 2 | 3300031903 | Ga0307407_10238747 | Ga0307407_102387473 | 163 |
| 3 | 3300039447 | Ga0436361_0018378 | Ga0436361_0018378_17_520 | 164 |
| 4 | 3300046476 | Ga0495662_0330768 | Ga0495662_0330768_95_601 | 165 |
| 5 | 3300005327 | Ga0070658_10300450 | Ga0070658_103004502 | 166 |
| 6 | 3300025909 | Ga0207705_10246891 | Ga0207705_102468912 | 166 |
| 7 | 3300005937 | Ga0081455_10215516 | Ga0081455_102155162 | 172 |
| 8 | 3300025919 | Ga0207657_10261848 | Ga0207657_102618482 | 174 |
| 9 | 3300036647 | Ga0316582_0246670 | Ga0316582_0246670_174_767 | 174 |
| 10 | 3300005436 | Ga0070713_100289753 | Ga0070713_1002897531 | 175 |
| 11 | 3300005471 | Ga0070698_100005421 | Ga0070698_1000054219 | 175 |
| 12 | 3300005518 | Ga0070699_100364519 | Ga0070699_1003645191 | 175 |
| 13 | 3300006028 | Ga0070717_10004979 | Ga0070717_100049793 | 175 |
| 14 | 3300025928 | Ga0207700_10190330 | Ga0207700_101903303 | 175 |
| 15 | 3300005327 | Ga0070658_10819072 | Ga0070658_108190721 | 176 |
| 16 | 3300009545 | Ga0105237_10159778 | Ga0105237_101597782 | 176 |
| 17 | 3300009551 | Ga0105238_10083039 | Ga0105238_100830392 | 176 |
| 18 | 3300025292 | Ga0209676_1000269 | Ga0209676_1000269106 | 176 |
| 19 | 3300025298 | Ga0209050_1014548 | Ga0209050_10145483 | 176 |
| 20 | 3300025911 | Ga0207654_10232511 | Ga0207654_102325112 | 176 |
| 21 | 3300025924 | Ga0207694_10176022 | Ga0207694_101760222 | 176 |
| 22 | 3300026041 | Ga0207639_10078708 | Ga0207639_100787082 | 176 |
| 23 | 3300026116 | Ga0207674_10641198 | Ga0207674_106411982 | 176 |
| 24 | 3300031249 | Ga0265339_10013056 | Ga0265339_100130564 | 176 |
| 25 | 3300031250 | Ga0265331_10011826 | Ga0265331_100118262 | 176 |
| 26 | 3300037312 | Ga0395899_0446136 | Ga0395899_0446136_189_779 | 176 |
| 27 | 3300037418 | Ga0395900_0064337 | Ga0395900_0064337_1070_1660 | 176 |
| 28 | 3300037466 | Ga0395898_0054844 | Ga0395898_0054844_2765_3355 | 176 |
| 29 | 3300038443 | Ga0395901_0029255 | Ga0395901_0029255_2480_3070 | 176 |
| 30 | 3300048088 | Ga0495602_0024171 | Ga0495602_0024171_1952_2542 | 176 |
| 31 | 3300006177 | Ga0075362_10019412 | Ga0075362_100194122 | 177 |
| 32 | 3300013100 | Ga0157373_10491860 | Ga0157373_104918601 | 177 |
| 33 | 3300026118 | Ga0207675_100730070 | Ga0207675_1007300702 | 177 |
| 34 | 3300005458 | Ga0070681_10227662 | Ga0070681_102276622 | 178 |
| 35 | 3300005530 | Ga0070679_100431881 | Ga0070679_1004318812 | 178 |
| 36 | 3300025912 | Ga0207707_10188997 | Ga0207707_101889972 | 178 |
| 37 | 3300025917 | Ga0207660_10300920 | Ga0207660_103009201 | 178 |
| 38 | 3300005436 | Ga0070713_100025897 | Ga0070713_1000258975 | 179 |
| 39 | 3300005437 | Ga0070710_10006054 | Ga0070710_100060543 | 179 |
| 40 | 3300005439 | Ga0070711_100444418 | Ga0070711_1004444182 | 179 |
| 41 | 3300006028 | Ga0070717_10002736 | Ga0070717_100027363 | 179 |
| 42 | 3300021361 | Ga0213872_10098369 | Ga0213872_100983693 | 179 |
| 43 | 3300021384 | Ga0213876_10222275 | Ga0213876_102222751 | 179 |
| 44 | 3300025915 | Ga0207693_10000809 | Ga0207693_1000080927 | 179 |
| 45 | 3300039437 | Ga0436365_0072725 | Ga0436365_0072725_12_593 | 179 |
| 46 | 3300039437 | Ga0436365_0606497 | Ga0436365_0606497_15_605 | 179 |
| 47 | 3300039438 | Ga0436360_0906325 | Ga0436360_0906325_131_712 | 179 |
| 48 | 3300039447 | Ga0436361_0106800 | Ga0436361_0106800_51_632 | 179 |
| 49 | 3300039447 | Ga0436361_0764950 | Ga0436361_0764950_1193_1774 | 179 |
| 50 | 3300039447 | Ga0436361_0950603 | Ga0436361_0950603_1810_2391 | 179 |
| 51 | 3300039453 | Ga0436362_0076139 | Ga0436362_0076139_322_903 | 179 |
| 52 | 3300039453 | Ga0436362_1154232 | Ga0436362_1154232_40_621 | 179 |
| 53 | 3300021441 | Ga0213871_10079436 | Ga0213871_100794362 | 180 |
| 54 | 3300039438 | Ga0436360_0553989 | Ga0436360_0553989_240_821 | 180 |
| 55 | 3300039447 | Ga0436361_0687573 | Ga0436361_0687573_147_728 | 180 |
| 56 | 3300007788 | Ga0099795_10003494 | Ga0099795_100034943 | 181 |
| 57 | 3300039437 | Ga0436365_0193778 | Ga0436365_0193778_343_924 | 181 |
| 58 | 3300039447 | Ga0436361_0157546 | Ga0436361_0157546_485_1066 | 181 |
| 59 | 3300039447 | Ga0436361_0647200 | Ga0436361_0647200_290_871 | 181 |
| 60 | 3300049570 | Ga0501033_0024361 | Ga0501033_0024361_706_1302 | 181 |
| 61 | 3300049571 | Ga0501034_0333949 | Ga0501034_0333949_471_1067 | 181 |
| 62 | 3300021384 | Ga0213876_10011629 | Ga0213876_100116292 | 182 |
| 63 | 3300039437 | Ga0436365_0308916 | Ga0436365_0308916_3102_3683 | 182 |
| 64 | 3300039453 | Ga0436362_0031048 | Ga0436362_0031048_1392_1973 | 182 |
| 65 | 3300014325 | Ga0163163_10048632 | Ga0163163_100486323 | 185 |
| 66 | 3300028573 | Ga0265334_10000673 | Ga0265334_100006736 | 185 |
| 67 | 3300028800 | Ga0265338_10033971 | Ga0265338_100339713 | 185 |
| 68 | 3300031241 | Ga0265325_10251623 | Ga0265325_102516231 | 185 |
| 69 | 3300031344 | Ga0265316_10305331 | Ga0265316_103053312 | 185 |
| 70 | 3300031595 | Ga0265313_10060491 | Ga0265313_100604913 | 185 |
| 71 | 3300039447 | Ga0436361_0829388 | Ga0436361_0829388_6205_6798 | 185 |
| 72 | 3300005458 | Ga0070681_10746889 | Ga0070681_107468892 | 186 |
| 73 | 3300035695 | Ga0373927_0016671 | Ga0373927_0016671_301_894 | 186 |
| 74 | 3300037068 | Ga0373925_0124627 | Ga0373925_0124627_1307_1900 | 186 |
| 75 | 3300046681 | Ga0495647_0177328 | Ga0495647_0177328_19_612 | 186 |
| 76 | 3300025949 | Ga0207667_10089940 | Ga0207667_100899402 | 187 |
| 77 | 3300035695 | Ga0373927_0656051 | Ga0373927_0656051_52_639 | 187 |
| 78 | 3300005327 | Ga0070658_10489405 | Ga0070658_104894051 | 188 |
| 79 | 3300005336 | Ga0070680_100062010 | Ga0070680_1000620103 | 188 |
| 80 | 3300005458 | Ga0070681_10249613 | Ga0070681_102496132 | 188 |
| 81 | 3300005458 | Ga0070681_10279598 | Ga0070681_102795982 | 188 |
| 82 | 3300005530 | Ga0070679_100024189 | Ga0070679_1000241894 | 188 |
| 83 | 3300005563 | Ga0068855_100030598 | Ga0068855_1000305987 | 188 |
| 84 | 3300005577 | Ga0068857_100103816 | Ga0068857_1001038162 | 188 |
| 85 | 3300005578 | Ga0068854_100294821 | Ga0068854_1002948211 | 188 |
| 86 | 3300009093 | Ga0105240_10021384 | Ga0105240_100213849 | 188 |
| 87 | 3300009093 | Ga0105240_10362552 | Ga0105240_103625522 | 188 |
| 88 | 3300013104 | Ga0157370_10046667 | Ga0157370_100466674 | 188 |
| 89 | 3300025912 | Ga0207707_10024954 | Ga0207707_100249544 | 188 |
| 90 | 3300025913 | Ga0207695_10178394 | Ga0207695_101783942 | 188 |
| 91 | 3300025913 | Ga0207695_10267290 | Ga0207695_102672902 | 188 |
| 92 | 3300025917 | Ga0207660_10051588 | Ga0207660_100515882 | 188 |
| 93 | 3300025921 | Ga0207652_10276272 | Ga0207652_102762722 | 188 |
| 94 | 3300025932 | Ga0207690_10006072 | Ga0207690_100060726 | 188 |
| 95 | 3300025949 | Ga0207667_10183552 | Ga0207667_101835523 | 188 |
| 96 | 3300026088 | Ga0207641_10509611 | Ga0207641_105096111 | 188 |
| 97 | 3300026116 | Ga0207674_10243964 | Ga0207674_102439642 | 188 |
| 98 | 3300049568 | Ga0501031_0003581 | Ga0501031_0003581_6043_6636 | 188 |
| 99 | 3300049569 | Ga0501032_0011974 | Ga0501032_0011974_3794_4387 | 188 |
| 100 | 3300049570 | Ga0501033_0024604 | Ga0501033_0024604_1235_1828 | 188 |
| 101 | 3300049571 | Ga0501034_0019438 | Ga0501034_0019438_1990_2583 | 188 |
| 102 | 3300049572 | Ga0501036_0013630 | Ga0501036_0013630_3374_3967 | 188 |
| 103 | 3300049573 | Ga0501037_0024061 | Ga0501037_0024061_1825_2418 | 188 |
| 104 | 3300049574 | Ga0501038_0124114 | Ga0501038_0124114_615_1208 | 188 |
| 105 | 3300049575 | Ga0501039_0012551 | Ga0501039_0012551_3088_3681 | 188 |
| 106 | 3300049578 | Ga0501042_0032711 | Ga0501042_0032711_1938_2531 | 188 |
| 107 | 3300049579 | Ga0501043_0037134 | Ga0501043_0037134_2638_3231 | 188 |
| 108 | 3300049580 | Ga0501046_0002562 | Ga0501046_0002562_10796_11389 | 188 |
| 109 | 3300049581 | Ga0501047_0009478 | Ga0501047_0009478_6072_6665 | 188 |
| 110 | 3300049582 | Ga0501048_0023710 | Ga0501048_0023710_2526_3119 | 188 |
| 111 | 3300049583 | Ga0501067_0001612 | Ga0501067_0001612_8983_9576 | 188 |
| 112 | 3300049585 | Ga0501069_0015193 | Ga0501069_0015193_1687_2280 | 188 |
| 113 | 3300049586 | Ga0501070_0002763 | Ga0501070_0002763_13014_13607 | 188 |
| 114 | 3300049587 | Ga0501071_0066497 | Ga0501071_0066497_1056_1649 | 188 |
| 115 | 3300049588 | Ga0501072_0029107 | Ga0501072_0029107_2255_2848 | 188 |
| 116 | 3300049589 | Ga0501073_0002197 | Ga0501073_0002197_4731_5324 | 188 |
| 117 | 3300049590 | Ga0501074_0003734 | Ga0501074_0003734_5407_6000 | 188 |
| 118 | 3300049592 | Ga0501076_0064285 | Ga0501076_0064285_745_1338 | 188 |
| 119 | 3300049741 | Ga0501079_0010441 | Ga0501079_0010441_3377_3970 | 188 |
| 120 | 3300049742 | Ga0501080_0033031 | Ga0501080_0033031_2334_2927 | 188 |
| 121 | 3300049744 | Ga0501083_0005960 | Ga0501083_0005960_6244_6837 | 188 |
| 122 | 3300049822 | Ga0501035_0066136 | Ga0501035_0066136_1825_2418 | 188 |
| 123 | 3300049823 | Ga0501044_0057848 | Ga0501044_0057848_1560_2153 | 188 |
| 124 | 3300054114 | Ga0501084_0008855 | Ga0501084_0008855_5314_5907 | 188 |
| 125 | 3300060353 | Ga0501082_0004104 | Ga0501082_0004104_3036_3629 | 188 |
| 126 | 3300025929 | Ga0207664_10300089 | Ga0207664_103000892 | 189 |
| 127 | 3300046543 | Ga0495645_0118450 | Ga0495645_0118450_476_1057 | 189 |
| 128 | 3300005327 | Ga0070658_10413174 | Ga0070658_104131742 | 190 |
| 129 | 3300005577 | Ga0068857_100192559 | Ga0068857_1001925592 | 190 |
| 130 | 3300013105 | Ga0157369_10118610 | Ga0157369_101186102 | 190 |
| 131 | 3300014968 | Ga0157379_11038885 | Ga0157379_110388852 | 190 |
| 132 | 3300025919 | Ga0207657_10628821 | Ga0207657_106288212 | 190 |
| 133 | 3300025932 | Ga0207690_10272772 | Ga0207690_102727723 | 190 |
| 134 | 3300026116 | Ga0207674_10116115 | Ga0207674_101161154 | 190 |
| 135 | 3300037418 | Ga0395900_0854836 | Ga0395900_0854836_84_695 | 190 |
| 136 | 3300049581 | Ga0501047_0286784 | Ga0501047_0286784_260_847 | 190 |
| 137 | 3300049823 | Ga0501044_0285031 | Ga0501044_0285031_640_1227 | 190 |
| 138 | iso_pu_bacteria | 2840878972 | 2840881304 | 190 |
| 139 | 3300005435 | Ga0070714_100078148 | Ga0070714_1000781482 | 191 |
| 140 | 3300021388 | Ga0213875_10000911 | Ga0213875_100009116 | 191 |
| 141 | 3300037853 | Ga0436364_0220830 | Ga0436364_0220830_1203_1784 | 191 |
| 142 | 3300037853 | Ga0436364_0259249 | Ga0436364_0259249_48691_49272 | 191 |
| 143 | 3300045836 | Ga0466958_0145466 | Ga0466958_0145466_358_966 | 191 |
| 144 | 3300049573 | Ga0501037_0561452 | Ga0501037_0561452_58_648 | 191 |
| 145 | 3300049744 | Ga0501083_0157494 | Ga0501083_0157494_872_1453 | 191 |
| 146 | 3300049822 | Ga0501035_0185270 | Ga0501035_0185270_543_1133 | 191 |
| 147 | 3300005336 | Ga0070680_100401604 | Ga0070680_1004016041 | 192 |
| 148 | 3300005518 | Ga0070699_100337014 | Ga0070699_1003370143 | 192 |
| 149 | 3300005530 | Ga0070679_100005993 | Ga0070679_1000059934 | 192 |
| 150 | 3300013104 | Ga0157370_10038939 | Ga0157370_100389392 | 192 |
| 151 | 3300021384 | Ga0213876_10000322 | Ga0213876_1000032239 | 193 |
| 152 | 3300028577 | Ga0265318_10028719 | Ga0265318_100287193 | 193 |
| 153 | 3300031235 | Ga0265330_10054655 | Ga0265330_100546551 | 193 |
| 154 | 3300031235 | Ga0265330_10061366 | Ga0265330_100613663 | 193 |
| 155 | 3300031235 | Ga0265330_10131524 | Ga0265330_101315241 | 193 |
| 156 | 3300031235 | Ga0265330_10215028 | Ga0265330_102150282 | 193 |
| 157 | 3300031240 | Ga0265320_10022145 | Ga0265320_100221453 | 193 |
| 158 | 3300031241 | Ga0265325_10023835 | Ga0265325_100238352 | 193 |
| 159 | 3300031241 | Ga0265325_10186837 | Ga0265325_101868371 | 193 |
| 160 | 3300031247 | Ga0265340_10000356 | Ga0265340_1000035629 | 193 |
| 161 | 3300031247 | Ga0265340_10001813 | Ga0265340_1000181313 | 193 |
| 162 | 3300031247 | Ga0265340_10060346 | Ga0265340_100603463 | 193 |
| 163 | 3300031247 | Ga0265340_10133856 | Ga0265340_101338561 | 193 |
| 164 | 3300031249 | Ga0265339_10006481 | Ga0265339_100064817 | 193 |
| 165 | 3300031249 | Ga0265339_10170076 | Ga0265339_101700762 | 193 |
| 166 | 3300031344 | Ga0265316_10003516 | Ga0265316_1000351618 | 193 |
| 167 | 3300031344 | Ga0265316_10176558 | Ga0265316_101765582 | 193 |
| 168 | 3300031595 | Ga0265313_10001836 | Ga0265313_1000183618 | 193 |
| 169 | 3300031595 | Ga0265313_10142954 | Ga0265313_101429542 | 193 |
| 170 | 3300031711 | Ga0265314_10001319 | Ga0265314_1000131912 | 193 |
| 171 | 3300031711 | Ga0265314_10002354 | Ga0265314_1000235414 | 193 |
| 172 | 3300031711 | Ga0265314_10039342 | Ga0265314_100393425 | 193 |
| 173 | 3300031711 | Ga0265314_10100146 | Ga0265314_101001462 | 193 |
| 174 | 3300031712 | Ga0265342_10007269 | Ga0265342_100072693 | 193 |
| 175 | 3300031712 | Ga0265342_10018188 | Ga0265342_100181882 | 193 |
| 176 | 3300031712 | Ga0265342_10230315 | Ga0265342_102303151 | 193 |
| 177 | 3300031712 | Ga0265342_10252024 | Ga0265342_102520242 | 193 |
| 178 | 3300032004 | Ga0307414_10425634 | Ga0307414_104256343 | 193 |
| 179 | 3300032005 | Ga0307411_10522838 | Ga0307411_105228382 | 193 |
| 180 | 3300039437 | Ga0436365_0173471 | Ga0436365_0173471_99812_100402 | 193 |
| 181 | 3300046473 | Ga0495582_0401121 | Ga0495582_0401121_169_762 | 193 |
| 182 | 3300046531 | Ga0495665_0069877 | Ga0495665_0069877_1147_1740 | 193 |
| 183 | 3300049570 | Ga0501033_0045401 | Ga0501033_0045401_2017_2598 | 193 |
| 184 | 3300049573 | Ga0501037_0275275 | Ga0501037_0275275_327_992 | 193 |
| 185 | 3300049573 | Ga0501037_0312012 | Ga0501037_0312012_420_1013 | 193 |
| 186 | iso_pu_bacteria | 2838029111 | 2838034324 | 193 |
| 187 | iso_pu_bacteria | 2842475841 | 2842481070 | 193 |
| 188 | iso_pu_bacteria | 2842502639 | 2842507798 | 193 |
| 189 | 3300005548 | Ga0070665_100134188 | Ga0070665_1001341882 | 194 |
| 190 | 3300005614 | Ga0068856_100467004 | Ga0068856_1004670042 | 194 |
| 191 | 3300005981 | Ga0081538_10028741 | Ga0081538_100287413 | 194 |
| 192 | 3300009551 | Ga0105238_11060011 | Ga0105238_110600112 | 194 |
| 193 | 3300039062 | Ga0400483_211285 | Ga0400483_211285_1013_1606 | 194 |
| 194 | 3300044712 | Ga0453684_0000006 | Ga0453684_0000006_58694_59287 | 194 |
| 195 | 3300044712 | Ga0453684_0000410 | Ga0453684_0000410_34616_35209 | 194 |
| 196 | 3300049579 | Ga0501043_0121004 | Ga0501043_0121004_24_617 | 194 |
| 197 | 3300049582 | Ga0501048_0397940 | Ga0501048_0397940_259_873 | 194 |
| 198 | 3300049587 | Ga0501071_0196002 | Ga0501071_0196002_606_1220 | 194 |
| 199 | 3300049588 | Ga0501072_0231434 | Ga0501072_0231434_494_1108 | 194 |
| 200 | 3300049591 | Ga0501075_0116205 | Ga0501075_0116205_775_1389 | 194 |
| 201 | 3300049592 | Ga0501076_0209089 | Ga0501076_0209089_844_1458 | 194 |
| 202 | 3300049742 | Ga0501080_0292540 | Ga0501080_0292540_25_618 | 194 |
| 203 | 3300049823 | Ga0501044_0404448 | Ga0501044_0404448_664_1251 | 194 |
| 204 | 3300061734 | Ga0530510_0203973 | Ga0530510_0203973_211_825 | 194 |
| 205 | 3300005336 | Ga0070680_100136542 | Ga0070680_1001365422 | 195 |
| 206 | 3300005344 | Ga0070661_100000135 | Ga0070661_10000013555 | 195 |
| 207 | 3300005439 | Ga0070711_100036579 | Ga0070711_1000365791 | 195 |
| 208 | 3300005548 | Ga0070665_100099565 | Ga0070665_1000995652 | 195 |
| 209 | 3300009093 | Ga0105240_10042935 | Ga0105240_100429354 | 195 |
| 210 | 3300009093 | Ga0105240_10081334 | Ga0105240_100813343 | 195 |
| 211 | 3300009174 | Ga0105241_11008583 | Ga0105241_110085831 | 195 |
| 212 | 3300009545 | Ga0105237_10765380 | Ga0105237_107653801 | 195 |
| 213 | 3300010375 | Ga0105239_10274120 | Ga0105239_102741202 | 195 |
| 214 | 3300010375 | Ga0105239_10594920 | Ga0105239_105949202 | 195 |
| 215 | 3300010375 | Ga0105239_11878927 | Ga0105239_118789271 | 195 |
| 216 | 3300013104 | Ga0157370_10298056 | Ga0157370_102980562 | 195 |
| 217 | 3300013104 | Ga0157370_10450650 | Ga0157370_104506503 | 195 |
| 218 | 3300014968 | Ga0157379_10241593 | Ga0157379_102415931 | 195 |
| 219 | 3300025909 | Ga0207705_10029374 | Ga0207705_100293743 | 195 |
| 220 | 3300025913 | Ga0207695_10018410 | Ga0207695_100184106 | 195 |
| 221 | 3300025913 | Ga0207695_10039690 | Ga0207695_100396903 | 195 |
| 222 | 3300025913 | Ga0207695_10072969 | Ga0207695_100729694 | 195 |
| 223 | 3300025913 | Ga0207695_10136383 | Ga0207695_101363832 | 195 |
| 224 | 3300025915 | Ga0207693_10178561 | Ga0207693_101785613 | 195 |
| 225 | 3300025917 | Ga0207660_10022576 | Ga0207660_100225762 | 195 |
| 226 | 3300025920 | Ga0207649_10000060 | Ga0207649_1000006066 | 195 |
| 227 | 3300025921 | Ga0207652_10023428 | Ga0207652_100234282 | 195 |
| 228 | 3300025934 | Ga0207686_10024090 | Ga0207686_100240902 | 195 |
| 229 | 3300025938 | Ga0207704_10629487 | Ga0207704_106294872 | 195 |
| 230 | 3300025972 | Ga0207668_11066121 | Ga0207668_110661212 | 195 |
| 231 | 3300026078 | Ga0207702_10419543 | Ga0207702_104195432 | 195 |
| 232 | 3300031235 | Ga0265330_10081018 | Ga0265330_100810182 | 195 |
| 233 | 3300031241 | Ga0265325_10017178 | Ga0265325_100171785 | 195 |
| 234 | 3300031249 | Ga0265339_10041153 | Ga0265339_100411531 | 195 |
| 235 | 3300031250 | Ga0265331_10025616 | Ga0265331_100256162 | 195 |
| 236 | 3300031595 | Ga0265313_10075295 | Ga0265313_100752952 | 195 |
| 237 | 3300031711 | Ga0265314_10035726 | Ga0265314_100357263 | 195 |
| 238 | 3300031711 | Ga0265314_10049983 | Ga0265314_100499833 | 195 |
| 239 | 3300035111 | Ga0373923_0208784 | Ga0373923_0208784_265_864 | 195 |
| 240 | 3300035113 | Ga0373936_0032915 | Ga0373936_0032915_1340_1939 | 195 |
| 241 | 3300035114 | Ga0373939_0008087 | Ga0373939_0008087_411_1028 | 195 |
| 242 | 3300035172 | Ga0373955_0072854 | Ga0373955_0072854_672_1271 | 195 |
| 243 | 3300036401 | Ga0373937_0000338 | Ga0373937_0000338_20334_20933 | 195 |
| 244 | 3300036401 | Ga0373937_0187274 | Ga0373937_0187274_134_733 | 195 |
| 245 | 3300039062 | Ga0400483_085364 | Ga0400483_085364_119_715 | 195 |
| 246 | 3300039438 | Ga0436360_0385609 | Ga0436360_0385609_69_659 | 195 |
| 247 | 3300049569 | Ga0501032_0150963 | Ga0501032_0150963_804_1397 | 195 |
| 248 | 3300049570 | Ga0501033_0019688 | Ga0501033_0019688_2642_3232 | 195 |
| 249 | 3300049570 | Ga0501033_0089680 | Ga0501033_0089680_64_657 | 195 |
| 250 | 3300049570 | Ga0501033_0093553 | Ga0501033_0093553_1220_1813 | 195 |
| 251 | 3300049570 | Ga0501033_0121976 | Ga0501033_0121976_635_1228 | 195 |
| 252 | 3300049571 | Ga0501034_0325872 | Ga0501034_0325872_804_1397 | 195 |
| 253 | 3300049573 | Ga0501037_0310201 | Ga0501037_0310201_56_646 | 195 |
| 254 | 3300049573 | Ga0501037_0399467 | Ga0501037_0399467_280_873 | 195 |
| 255 | 3300049574 | Ga0501038_0130457 | Ga0501038_0130457_907_1500 | 195 |
| 256 | 3300049575 | Ga0501039_0210885 | Ga0501039_0210885_608_1201 | 195 |
| 257 | 3300049579 | Ga0501043_0028653 | Ga0501043_0028653_3757_4350 | 195 |
| 258 | 3300049579 | Ga0501043_0045214 | Ga0501043_0045214_674_1264 | 195 |
| 259 | 3300049580 | Ga0501046_0014573 | Ga0501046_0014573_5335_5934 | 195 |
| 260 | 3300049581 | Ga0501047_0170499 | Ga0501047_0170499_1186_1776 | 195 |
| 261 | 3300049581 | Ga0501047_0314612 | Ga0501047_0314612_80_673 | 195 |
| 262 | 3300049589 | Ga0501073_0264951 | Ga0501073_0264951_554_1147 | 195 |
| 263 | 3300049742 | Ga0501080_0773936 | Ga0501080_0773936_138_731 | 195 |
| 264 | 3300049822 | Ga0501035_0044913 | Ga0501035_0044913_2579_3172 | 195 |
| 265 | 3300049822 | Ga0501035_0089875 | Ga0501035_0089875_828_1418 | 195 |
| 266 | 3300049822 | Ga0501035_0141930 | Ga0501035_0141930_792_1385 | 195 |
| 267 | 3300049823 | Ga0501044_0045945 | Ga0501044_0045945_2814_3407 | 195 |
| 268 | 3300049823 | Ga0501044_0149757 | Ga0501044_0149757_396_986 | 195 |
| 269 | 3300049823 | Ga0501044_0154106 | Ga0501044_0154106_365_958 | 195 |
| 270 | 3300053085 | Ga0495619_0254768 | Ga0495619_0254768_494_1093 | 195 |
| 271 | 3300053163 | Ga0500639_154325 | Ga0500639_154325_63_650 | 195 |
| 272 | 3300003214 | JGI25165J46597_1000080 | JGI25165J46597_100008032 | 196 |
| 273 | 3300003215 | JGI25153J46596_10000812 | JGI25153J46596_1000081218 | 196 |
| 274 | 3300005327 | Ga0070658_10002534 | Ga0070658_1000253413 | 196 |
| 275 | 3300005328 | Ga0070676_10089400 | Ga0070676_100894002 | 196 |
| 276 | 3300005329 | Ga0070683_100208029 | Ga0070683_1002080294 | 196 |
| 277 | 3300005330 | Ga0070690_100146593 | Ga0070690_1001465933 | 196 |
| 278 | 3300005334 | Ga0068869_100176857 | Ga0068869_1001768573 | 196 |
| 279 | 3300005334 | Ga0068869_100187227 | Ga0068869_1001872271 | 196 |
| 280 | 3300005336 | Ga0070680_100000332 | Ga0070680_1000003323 | 196 |
| 281 | 3300005338 | Ga0068868_100556110 | Ga0068868_1005561101 | 196 |
| 282 | 3300005338 | Ga0068868_100962811 | Ga0068868_1009628111 | 196 |
| 283 | 3300005339 | Ga0070660_100086353 | Ga0070660_1000863532 | 196 |
| 284 | 3300005340 | Ga0070689_101072836 | Ga0070689_1010728361 | 196 |
| 285 | 3300005341 | Ga0070691_10137849 | Ga0070691_101378491 | 196 |
| 286 | 3300005344 | Ga0070661_100022011 | Ga0070661_1000220118 | 196 |
| 287 | 3300005344 | Ga0070661_100292728 | Ga0070661_1002927282 | 196 |
| 288 | 3300005354 | Ga0070675_100087059 | Ga0070675_1000870593 | 196 |
| 289 | 3300005354 | Ga0070675_100223448 | Ga0070675_1002234482 | 196 |
| 290 | 3300005355 | Ga0070671_100217559 | Ga0070671_1002175592 | 196 |
| 291 | 3300005355 | Ga0070671_100802032 | Ga0070671_1008020322 | 196 |
| 292 | 3300005356 | Ga0070674_100181571 | Ga0070674_1001815712 | 196 |
| 293 | 3300005356 | Ga0070674_100446990 | Ga0070674_1004469902 | 196 |
| 294 | 3300005356 | Ga0070674_100897353 | Ga0070674_1008973531 | 196 |
| 295 | 3300005364 | Ga0070673_100109977 | Ga0070673_1001099772 | 196 |
| 296 | 3300005364 | Ga0070673_100116003 | Ga0070673_1001160031 | 196 |
| 297 | 3300005364 | Ga0070673_100253767 | Ga0070673_1002537672 | 196 |
| 298 | 3300005367 | Ga0070667_100047937 | Ga0070667_1000479372 | 196 |
| 299 | 3300005367 | Ga0070667_100083406 | Ga0070667_1000834063 | 196 |
| 300 | 3300005435 | Ga0070714_100098978 | Ga0070714_1000989782 | 196 |
| 301 | 3300005435 | Ga0070714_100571097 | Ga0070714_1005710972 | 196 |
| 302 | 3300005439 | Ga0070711_100204462 | Ga0070711_1002044621 | 196 |
| 303 | 3300005456 | Ga0070678_100002862 | Ga0070678_1000028623 | 196 |
| 304 | 3300005456 | Ga0070678_100016293 | Ga0070678_1000162934 | 196 |
| 305 | 3300005456 | Ga0070678_100019805 | Ga0070678_1000198055 | 196 |
| 306 | 3300005456 | Ga0070678_100079469 | Ga0070678_1000794692 | 196 |
| 307 | 3300005456 | Ga0070678_100141932 | Ga0070678_1001419324 | 196 |
| 308 | 3300005458 | Ga0070681_10000123 | Ga0070681_100001233 | 196 |
| 309 | 3300005458 | Ga0070681_10055003 | Ga0070681_100550031 | 196 |
| 310 | 3300005468 | Ga0070707_100062475 | Ga0070707_1000624751 | 196 |
| 311 | 3300005471 | Ga0070698_100137307 | Ga0070698_1001373073 | 196 |
| 312 | 3300005518 | Ga0070699_100037090 | Ga0070699_1000370905 | 196 |
| 313 | 3300005530 | Ga0070679_100000490 | Ga0070679_10000049037 | 196 |
| 314 | 3300005530 | Ga0070679_100267901 | Ga0070679_1002679013 | 196 |
| 315 | 3300005535 | Ga0070684_100199581 | Ga0070684_1001995813 | 196 |
| 316 | 3300005535 | Ga0070684_100611340 | Ga0070684_1006113401 | 196 |
| 317 | 3300005539 | Ga0068853_100005091 | Ga0068853_1000050914 | 196 |
| 318 | 3300005539 | Ga0068853_100016798 | Ga0068853_1000167984 | 196 |
| 319 | 3300005539 | Ga0068853_100073378 | Ga0068853_1000733784 | 196 |
| 320 | 3300005539 | Ga0068853_101049883 | Ga0068853_1010498831 | 196 |
| 321 | 3300005543 | Ga0070672_100429844 | Ga0070672_1004298441 | 196 |
| 322 | 3300005543 | Ga0070672_101053026 | Ga0070672_1010530261 | 196 |
| 323 | 3300005545 | Ga0070695_100274511 | Ga0070695_1002745112 | 196 |
| 324 | 3300005547 | Ga0070693_100069882 | Ga0070693_1000698822 | 196 |
| 325 | 3300005548 | Ga0070665_100002457 | Ga0070665_10000245724 | 196 |
| 326 | 3300005548 | Ga0070665_100089174 | Ga0070665_1000891745 | 196 |
| 327 | 3300005548 | Ga0070665_100127884 | Ga0070665_1001278842 | 196 |
| 328 | 3300005548 | Ga0070665_100169252 | Ga0070665_1001692522 | 196 |
| 329 | 3300005548 | Ga0070665_100187834 | Ga0070665_1001878342 | 196 |
| 330 | 3300005548 | Ga0070665_100213620 | Ga0070665_1002136201 | 196 |
| 331 | 3300005548 | Ga0070665_100395431 | Ga0070665_1003954312 | 196 |
| 332 | 3300005563 | Ga0068855_100000529 | Ga0068855_10000052936 | 196 |
| 333 | 3300005563 | Ga0068855_100148589 | Ga0068855_1001485892 | 196 |
| 334 | 3300005563 | Ga0068855_100307750 | Ga0068855_1003077502 | 196 |
| 335 | 3300005563 | Ga0068855_100870463 | Ga0068855_1008704631 | 196 |
| 336 | 3300005577 | Ga0068857_100100352 | Ga0068857_1001003522 | 196 |
| 337 | 3300005614 | Ga0068856_100103164 | Ga0068856_1001031642 | 196 |
| 338 | 3300005615 | Ga0070702_100157769 | Ga0070702_1001577692 | 196 |
| 339 | 3300005616 | Ga0068852_100090814 | Ga0068852_1000908143 | 196 |
| 340 | 3300005616 | Ga0068852_100174582 | Ga0068852_1001745822 | 196 |
| 341 | 3300005616 | Ga0068852_100600280 | Ga0068852_1006002801 | 196 |
| 342 | 3300005617 | Ga0068859_100388566 | Ga0068859_1003885662 | 196 |
| 343 | 3300005617 | Ga0068859_100825594 | Ga0068859_1008255942 | 196 |
| 344 | 3300005618 | Ga0068864_100602615 | Ga0068864_1006026152 | 196 |
| 345 | 3300005719 | Ga0068861_100101094 | Ga0068861_1001010942 | 196 |
| 346 | 3300005840 | Ga0068870_10081587 | Ga0068870_100815872 | 196 |
| 347 | 3300005841 | Ga0068863_100248827 | Ga0068863_1002488272 | 196 |
| 348 | 3300005842 | Ga0068858_100007195 | Ga0068858_1000071954 | 196 |
| 349 | 3300005842 | Ga0068858_100100353 | Ga0068858_1001003532 | 196 |
| 350 | 3300005843 | Ga0068860_100037804 | Ga0068860_1000378045 | 196 |
| 351 | 3300005843 | Ga0068860_100269766 | Ga0068860_1002697662 | 196 |
| 352 | 3300005843 | Ga0068860_101041327 | Ga0068860_1010413271 | 196 |
| 353 | 3300006028 | Ga0070717_10749084 | Ga0070717_107490841 | 196 |
| 354 | 3300006237 | Ga0097621_100000267 | Ga0097621_10000026717 | 196 |
| 355 | 3300006237 | Ga0097621_100025424 | Ga0097621_1000254244 | 196 |
| 356 | 3300006237 | Ga0097621_100045626 | Ga0097621_1000456262 | 196 |
| 357 | 3300006237 | Ga0097621_100084595 | Ga0097621_1000845952 | 196 |
| 358 | 3300006237 | Ga0097621_100169682 | Ga0097621_1001696822 | 196 |
| 359 | 3300006237 | Ga0097621_100237065 | Ga0097621_1002370652 | 196 |
| 360 | 3300006358 | Ga0068871_100002164 | Ga0068871_10000216416 | 196 |
| 361 | 3300006358 | Ga0068871_100003594 | Ga0068871_1000035945 | 196 |
| 362 | 3300006358 | Ga0068871_100180019 | Ga0068871_1001800192 | 196 |
| 363 | 3300006358 | Ga0068871_100202798 | Ga0068871_1002027982 | 196 |
| 364 | 3300006358 | Ga0068871_100548626 | Ga0068871_1005486262 | 196 |
| 365 | 3300006844 | Ga0075428_100511987 | Ga0075428_1005119872 | 196 |
| 366 | 3300006846 | Ga0075430_100194453 | Ga0075430_1001944532 | 196 |
| 367 | 3300006847 | Ga0075431_100196176 | Ga0075431_1001961763 | 196 |
| 368 | 3300006871 | Ga0075434_100196301 | Ga0075434_1001963011 | 196 |
| 369 | 3300006881 | Ga0068865_100005263 | Ga0068865_10000526310 | 196 |
| 370 | 3300006931 | Ga0097620_100388579 | Ga0097620_1003885792 | 196 |
| 371 | 3300006931 | Ga0097620_100825590 | Ga0097620_1008255902 | 196 |
| 372 | 3300009093 | Ga0105240_10000055 | Ga0105240_10000055228 | 196 |
| 373 | 3300009093 | Ga0105240_10029678 | Ga0105240_100296787 | 196 |
| 374 | 3300009093 | Ga0105240_10116517 | Ga0105240_101165172 | 196 |
| 375 | 3300009093 | Ga0105240_10153807 | Ga0105240_101538072 | 196 |
| 376 | 3300009093 | Ga0105240_10455168 | Ga0105240_104551682 | 196 |
| 377 | 3300009093 | Ga0105240_10783049 | Ga0105240_107830492 | 196 |
| 378 | 3300009093 | Ga0105240_11055795 | Ga0105240_110557952 | 196 |
| 379 | 3300009094 | Ga0111539_10159125 | Ga0111539_101591253 | 196 |
| 380 | 3300009094 | Ga0111539_10801479 | Ga0111539_108014793 | 196 |
| 381 | 3300009098 | Ga0105245_10001742 | Ga0105245_1000174216 | 196 |
| 382 | 3300009098 | Ga0105245_10376812 | Ga0105245_103768122 | 196 |
| 383 | 3300009098 | Ga0105245_10444974 | Ga0105245_104449742 | 196 |
| 384 | 3300009098 | Ga0105245_10506287 | Ga0105245_105062872 | 196 |
| 385 | 3300009098 | Ga0105245_10537001 | Ga0105245_105370012 | 196 |
| 386 | 3300009101 | Ga0105247_10052153 | Ga0105247_100521532 | 196 |
| 387 | 3300009148 | Ga0105243_10042358 | Ga0105243_100423583 | 196 |
| 388 | 3300009148 | Ga0105243_10299509 | Ga0105243_102995092 | 196 |
| 389 | 3300009174 | Ga0105241_10105447 | Ga0105241_101054474 | 196 |
| 390 | 3300009174 | Ga0105241_10167246 | Ga0105241_101672463 | 196 |
| 391 | 3300009174 | Ga0105241_10642923 | Ga0105241_106429232 | 196 |
| 392 | 3300009176 | Ga0105242_10017460 | Ga0105242_100174602 | 196 |
| 393 | 3300009176 | Ga0105242_10037486 | Ga0105242_100374865 | 196 |
| 394 | 3300009176 | Ga0105242_10084700 | Ga0105242_100847005 | 196 |
| 395 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011794 | 196 |
| 396 | 3300009177 | Ga0105248_10049054 | Ga0105248_100490542 | 196 |
| 397 | 3300009177 | Ga0105248_10128292 | Ga0105248_101282922 | 196 |
| 398 | 3300009545 | Ga0105237_10070835 | Ga0105237_100708353 | 196 |
| 399 | 3300009545 | Ga0105237_10320893 | Ga0105237_103208932 | 196 |
| 400 | 3300009545 | Ga0105237_10395432 | Ga0105237_103954322 | 196 |
| 401 | 3300009545 | Ga0105237_10746619 | Ga0105237_107466191 | 196 |
| 402 | 3300009551 | Ga0105238_10042693 | Ga0105238_100426936 | 196 |
| 403 | 3300009551 | Ga0105238_10283127 | Ga0105238_102831272 | 196 |
| 404 | 3300009551 | Ga0105238_10560908 | Ga0105238_105609082 | 196 |
| 405 | 3300009551 | Ga0105238_10858050 | Ga0105238_108580502 | 196 |
| 406 | 3300009551 | Ga0105238_11426975 | Ga0105238_114269751 | 196 |
| 407 | 3300009553 | Ga0105249_10004983 | Ga0105249_100049836 | 196 |
| 408 | 3300009553 | Ga0105249_10180275 | Ga0105249_101802752 | 196 |
| 409 | 3300010375 | Ga0105239_10003373 | Ga0105239_100033739 | 196 |
| 410 | 3300010375 | Ga0105239_10009872 | Ga0105239_100098726 | 196 |
| 411 | 3300010375 | Ga0105239_10012800 | Ga0105239_100128004 | 196 |
| 412 | 3300010375 | Ga0105239_10456918 | Ga0105239_104569182 | 196 |
| 413 | 3300011119 | Ga0105246_10093243 | Ga0105246_100932432 | 196 |
| 414 | 3300013100 | Ga0157373_10455590 | Ga0157373_104555903 | 196 |
| 415 | 3300013104 | Ga0157370_10182100 | Ga0157370_101821003 | 196 |
| 416 | 3300013105 | Ga0157369_10012565 | Ga0157369_100125656 | 196 |
| 417 | 3300013105 | Ga0157369_10604210 | Ga0157369_106042103 | 196 |
| 418 | 3300013296 | Ga0157374_10051271 | Ga0157374_100512712 | 196 |
| 419 | 3300013296 | Ga0157374_10220212 | Ga0157374_102202122 | 196 |
| 420 | 3300013297 | Ga0157378_10088182 | Ga0157378_100881824 | 196 |
| 421 | 3300013297 | Ga0157378_10097732 | Ga0157378_100977322 | 196 |
| 422 | 3300013297 | Ga0157378_10287625 | Ga0157378_102876252 | 196 |
| 423 | 3300013297 | Ga0157378_10745418 | Ga0157378_107454181 | 196 |
| 424 | 3300013306 | Ga0163162_10008334 | Ga0163162_100083345 | 196 |
| 425 | 3300013306 | Ga0163162_10093293 | Ga0163162_100932936 | 196 |
| 426 | 3300013306 | Ga0163162_10566639 | Ga0163162_105666392 | 196 |
| 427 | 3300013307 | Ga0157372_10064258 | Ga0157372_100642585 | 196 |
| 428 | 3300013307 | Ga0157372_10159582 | Ga0157372_101595822 | 196 |
| 429 | 3300013307 | Ga0157372_10226351 | Ga0157372_102263513 | 196 |
| 430 | 3300013308 | Ga0157375_10173971 | Ga0157375_101739711 | 196 |
| 431 | 3300013308 | Ga0157375_10174265 | Ga0157375_101742652 | 196 |
| 432 | 3300013308 | Ga0157375_10893451 | Ga0157375_108934512 | 196 |
| 433 | 3300013308 | Ga0157375_11072178 | Ga0157375_110721782 | 196 |
| 434 | 3300014325 | Ga0163163_10000021 | Ga0163163_10000021134 | 196 |
| 435 | 3300014325 | Ga0163163_10077632 | Ga0163163_100776326 | 196 |
| 436 | 3300014325 | Ga0163163_10301609 | Ga0163163_103016091 | 196 |
| 437 | 3300014325 | Ga0163163_10439617 | Ga0163163_104396172 | 196 |
| 438 | 3300014326 | Ga0157380_10757972 | Ga0157380_107579722 | 196 |
| 439 | 3300014745 | Ga0157377_10144416 | Ga0157377_101444162 | 196 |
| 440 | 3300014968 | Ga0157379_10000304 | Ga0157379_1000030427 | 196 |
| 441 | 3300014968 | Ga0157379_10003277 | Ga0157379_100032775 | 196 |
| 442 | 3300014968 | Ga0157379_10162175 | Ga0157379_101621754 | 196 |
| 443 | 3300014969 | Ga0157376_10340468 | Ga0157376_103404683 | 196 |
| 444 | 3300014969 | Ga0157376_11148654 | Ga0157376_111486541 | 196 |
| 445 | 3300017792 | Ga0163161_10325510 | Ga0163161_103255102 | 196 |
| 446 | 3300021377 | Ga0213874_10001161 | Ga0213874_100011616 | 196 |
| 447 | 3300021377 | Ga0213874_10038817 | Ga0213874_100388172 | 196 |
| 448 | 3300021384 | Ga0213876_10000167 | Ga0213876_1000016761 | 196 |
| 449 | 3300021384 | Ga0213876_10141117 | Ga0213876_101411172 | 196 |
| 450 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006827 | 196 |
| 451 | 3300025261 | Ga0209233_1043971 | Ga0209233_10439712 | 196 |
| 452 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008116 | 196 |
| 453 | 3300025900 | Ga0207710_10026810 | Ga0207710_100268102 | 196 |
| 454 | 3300025901 | Ga0207688_10261151 | Ga0207688_102611512 | 196 |
| 455 | 3300025909 | Ga0207705_10004807 | Ga0207705_100048079 | 196 |
| 456 | 3300025911 | Ga0207654_10017205 | Ga0207654_100172053 | 196 |
| 457 | 3300025911 | Ga0207654_10025054 | Ga0207654_100250542 | 196 |
| 458 | 3300025911 | Ga0207654_10100203 | Ga0207654_101002032 | 196 |
| 459 | 3300025911 | Ga0207654_10116673 | Ga0207654_101166733 | 196 |
| 460 | 3300025911 | Ga0207654_10135096 | Ga0207654_101350962 | 196 |
| 461 | 3300025911 | Ga0207654_10281859 | Ga0207654_102818592 | 196 |
| 462 | 3300025912 | Ga0207707_10000002 | Ga0207707_1000000263 | 196 |
| 463 | 3300025912 | Ga0207707_10036197 | Ga0207707_100361972 | 196 |
| 464 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012109 | 196 |
| 465 | 3300025913 | Ga0207695_10021214 | Ga0207695_100212142 | 196 |
| 466 | 3300025913 | Ga0207695_10106427 | Ga0207695_101064272 | 196 |
| 467 | 3300025913 | Ga0207695_10263480 | Ga0207695_102634802 | 196 |
| 468 | 3300025916 | Ga0207663_10143965 | Ga0207663_101439653 | 196 |
| 469 | 3300025917 | Ga0207660_10001154 | Ga0207660_100011543 | 196 |
| 470 | 3300025919 | Ga0207657_10006097 | Ga0207657_100060979 | 196 |
| 471 | 3300025919 | Ga0207657_10051133 | Ga0207657_100511335 | 196 |
| 472 | 3300025920 | Ga0207649_10241976 | Ga0207649_102419762 | 196 |
| 473 | 3300025920 | Ga0207649_10960649 | Ga0207649_109606491 | 196 |
| 474 | 3300025921 | Ga0207652_10000197 | Ga0207652_1000019741 | 196 |
| 475 | 3300025921 | Ga0207652_10086100 | Ga0207652_100861002 | 196 |
| 476 | 3300025922 | Ga0207646_10076216 | Ga0207646_100762163 | 196 |
| 477 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006554 | 196 |
| 478 | 3300025924 | Ga0207694_10280954 | Ga0207694_102809543 | 196 |
| 479 | 3300025924 | Ga0207694_10552388 | Ga0207694_105523882 | 196 |
| 480 | 3300025926 | Ga0207659_11264604 | Ga0207659_112646041 | 196 |
| 481 | 3300025927 | Ga0207687_10005839 | Ga0207687_100058394 | 196 |
| 482 | 3300025927 | Ga0207687_10106730 | Ga0207687_101067302 | 196 |
| 483 | 3300025928 | Ga0207700_10098889 | Ga0207700_100988892 | 196 |
| 484 | 3300025929 | Ga0207664_10143490 | Ga0207664_101434902 | 196 |
| 485 | 3300025934 | Ga0207686_10001631 | Ga0207686_1000163112 | 196 |
| 486 | 3300025934 | Ga0207686_10097491 | Ga0207686_100974912 | 196 |
| 487 | 3300025935 | Ga0207709_10152238 | Ga0207709_101522382 | 196 |
| 488 | 3300025936 | Ga0207670_10498436 | Ga0207670_104984361 | 196 |
| 489 | 3300025937 | Ga0207669_10483504 | Ga0207669_104835041 | 196 |
| 490 | 3300025938 | Ga0207704_10073711 | Ga0207704_100737112 | 196 |
| 491 | 3300025938 | Ga0207704_10642640 | Ga0207704_106426402 | 196 |
| 492 | 3300025941 | Ga0207711_10000001 | Ga0207711_1000000178 | 196 |
| 493 | 3300025941 | Ga0207711_10134983 | Ga0207711_101349832 | 196 |
| 494 | 3300025942 | Ga0207689_10078008 | Ga0207689_100780082 | 196 |
| 495 | 3300025942 | Ga0207689_10083601 | Ga0207689_100836012 | 196 |
| 496 | 3300025942 | Ga0207689_10187325 | Ga0207689_101873253 | 196 |
| 497 | 3300025945 | Ga0207679_10349273 | Ga0207679_103492732 | 196 |
| 498 | 3300025945 | Ga0207679_10936697 | Ga0207679_109366972 | 196 |
| 499 | 3300025949 | Ga0207667_10000026 | Ga0207667_10000026285 | 196 |
| 500 | 3300025949 | Ga0207667_10271040 | Ga0207667_102710402 | 196 |
| 501 | 3300025960 | Ga0207651_10040945 | Ga0207651_100409454 | 196 |
| 502 | 3300025961 | Ga0207712_10084372 | Ga0207712_100843724 | 196 |
| 503 | 3300025961 | Ga0207712_10162925 | Ga0207712_101629252 | 196 |
| 504 | 3300025961 | Ga0207712_10730874 | Ga0207712_107308742 | 196 |
| 505 | 3300025972 | Ga0207668_11094377 | Ga0207668_110943771 | 196 |
| 506 | 3300026023 | Ga0207677_10066545 | Ga0207677_100665451 | 196 |
| 507 | 3300026023 | Ga0207677_10327066 | Ga0207677_103270663 | 196 |
| 508 | 3300026023 | Ga0207677_10609319 | Ga0207677_106093192 | 196 |
| 509 | 3300026035 | Ga0207703_10029882 | Ga0207703_100298826 | 196 |
| 510 | 3300026035 | Ga0207703_10069710 | Ga0207703_100697104 | 196 |
| 511 | 3300026035 | Ga0207703_10527624 | Ga0207703_105276242 | 196 |
| 512 | 3300026041 | Ga0207639_10028153 | Ga0207639_100281533 | 196 |
| 513 | 3300026041 | Ga0207639_10157725 | Ga0207639_101577252 | 196 |
| 514 | 3300026067 | Ga0207678_10418493 | Ga0207678_104184931 | 196 |
| 515 | 3300026078 | Ga0207702_10277503 | Ga0207702_102775031 | 196 |
| 516 | 3300026088 | Ga0207641_10101756 | Ga0207641_101017562 | 196 |
| 517 | 3300026089 | Ga0207648_10002996 | Ga0207648_100029961 | 196 |
| 518 | 3300026089 | Ga0207648_11230552 | Ga0207648_112305521 | 196 |
| 519 | 3300026095 | Ga0207676_10029076 | Ga0207676_100290763 | 196 |
| 520 | 3300026095 | Ga0207676_10260840 | Ga0207676_102608402 | 196 |
| 521 | 3300026116 | Ga0207674_10902591 | Ga0207674_109025911 | 196 |
| 522 | 3300026118 | Ga0207675_100102346 | Ga0207675_1001023463 | 196 |
| 523 | 3300026118 | Ga0207675_100143644 | Ga0207675_1001436442 | 196 |
| 524 | 3300026118 | Ga0207675_100702832 | Ga0207675_1007028321 | 196 |
| 525 | 3300026121 | Ga0207683_10004248 | Ga0207683_100042482 | 196 |
| 526 | 3300026121 | Ga0207683_10018865 | Ga0207683_100188657 | 196 |
| 527 | 3300026121 | Ga0207683_10021537 | Ga0207683_100215373 | 196 |
| 528 | 3300026121 | Ga0207683_10258480 | Ga0207683_102584802 | 196 |
| 529 | 3300026121 | Ga0207683_10871480 | Ga0207683_108714802 | 196 |
| 530 | 3300026142 | Ga0207698_10063956 | Ga0207698_100639563 | 196 |
| 531 | 3300026142 | Ga0207698_10120706 | Ga0207698_101207062 | 196 |
| 532 | 3300026142 | Ga0207698_10360026 | Ga0207698_103600262 | 196 |
| 533 | 3300026142 | Ga0207698_11009920 | Ga0207698_110099202 | 196 |
| 534 | 3300027907 | Ga0207428_10191342 | Ga0207428_101913422 | 196 |
| 535 | 3300028379 | Ga0268266_10001271 | Ga0268266_100012719 | 196 |
| 536 | 3300028379 | Ga0268266_10072563 | Ga0268266_100725635 | 196 |
| 537 | 3300028379 | Ga0268266_10100739 | Ga0268266_101007392 | 196 |
| 538 | 3300028379 | Ga0268266_10101684 | Ga0268266_101016843 | 196 |
| 539 | 3300028379 | Ga0268266_10184980 | Ga0268266_101849802 | 196 |
| 540 | 3300028381 | Ga0268264_10038901 | Ga0268264_100389012 | 196 |
| 541 | 3300028381 | Ga0268264_10136500 | Ga0268264_101365002 | 196 |
| 542 | 3300028573 | Ga0265334_10032497 | Ga0265334_100324973 | 196 |
| 543 | 3300028577 | Ga0265318_10000388 | Ga0265318_1000038835 | 196 |
| 544 | 3300028800 | Ga0265338_10000011 | Ga0265338_10000011422 | 196 |
| 545 | 3300028800 | Ga0265338_10004398 | Ga0265338_100043989 | 196 |
| 546 | 3300031235 | Ga0265330_10041620 | Ga0265330_100416202 | 196 |
| 547 | 3300031238 | Ga0265332_10004596 | Ga0265332_100045965 | 196 |
| 548 | 3300031238 | Ga0265332_10037781 | Ga0265332_100377812 | 196 |
| 549 | 3300031239 | Ga0265328_10225315 | Ga0265328_102253151 | 196 |
| 550 | 3300031240 | Ga0265320_10000123 | Ga0265320_1000012338 | 196 |
| 551 | 3300031241 | Ga0265325_10000002 | Ga0265325_1000000290 | 196 |
| 552 | 3300031241 | Ga0265325_10016521 | Ga0265325_100165213 | 196 |
| 553 | 3300031241 | Ga0265325_10040167 | Ga0265325_100401673 | 196 |
| 554 | 3300031241 | Ga0265325_10088185 | Ga0265325_100881853 | 196 |
| 555 | 3300031242 | Ga0265329_10014355 | Ga0265329_100143553 | 196 |
| 556 | 3300031242 | Ga0265329_10131959 | Ga0265329_101319592 | 196 |
| 557 | 3300031247 | Ga0265340_10026657 | Ga0265340_100266572 | 196 |
| 558 | 3300031247 | Ga0265340_10030321 | Ga0265340_100303212 | 196 |
| 559 | 3300031247 | Ga0265340_10069521 | Ga0265340_100695211 | 196 |
| 560 | 3300031247 | Ga0265340_10134292 | Ga0265340_101342922 | 196 |
| 561 | 3300031249 | Ga0265339_10002449 | Ga0265339_100024496 | 196 |
| 562 | 3300031249 | Ga0265339_10020986 | Ga0265339_100209862 | 196 |
| 563 | 3300031249 | Ga0265339_10352548 | Ga0265339_103525481 | 196 |
| 564 | 3300031250 | Ga0265331_10000049 | Ga0265331_1000004987 | 196 |
| 565 | 3300031250 | Ga0265331_10000303 | Ga0265331_100003033 | 196 |
| 566 | 3300031250 | Ga0265331_10001113 | Ga0265331_100011138 | 196 |
| 567 | 3300031250 | Ga0265331_10006811 | Ga0265331_100068114 | 196 |
| 568 | 3300031250 | Ga0265331_10017858 | Ga0265331_100178584 | 196 |
| 569 | 3300031251 | Ga0265327_10000007 | Ga0265327_10000007436 | 196 |
| 570 | 3300031344 | Ga0265316_10021855 | Ga0265316_100218557 | 196 |
| 571 | 3300031456 | Ga0307513_10272958 | Ga0307513_102729583 | 196 |
| 572 | 3300031595 | Ga0265313_10000689 | Ga0265313_1000068914 | 196 |
| 573 | 3300031595 | Ga0265313_10004096 | Ga0265313_100040969 | 196 |
| 574 | 3300031595 | Ga0265313_10028353 | Ga0265313_100283532 | 196 |
| 575 | 3300031595 | Ga0265313_10144845 | Ga0265313_101448451 | 196 |
| 576 | 3300031711 | Ga0265314_10008314 | Ga0265314_100083145 | 196 |
| 577 | 3300031711 | Ga0265314_10024900 | Ga0265314_100249003 | 196 |
| 578 | 3300031711 | Ga0265314_10050108 | Ga0265314_100501082 | 196 |
| 579 | 3300031711 | Ga0265314_10071816 | Ga0265314_100718162 | 196 |
| 580 | 3300031711 | Ga0265314_10079446 | Ga0265314_100794463 | 196 |
| 581 | 3300031712 | Ga0265342_10020762 | Ga0265342_100207622 | 196 |
| 582 | 3300031712 | Ga0265342_10138377 | Ga0265342_101383772 | 196 |
| 583 | 3300031712 | Ga0265342_10269151 | Ga0265342_102691512 | 196 |
| 584 | 3300031730 | Ga0307516_10015652 | Ga0307516_100156525 | 196 |
| 585 | 3300031730 | Ga0307516_10101357 | Ga0307516_101013574 | 196 |
| 586 | 3300031903 | Ga0307407_10425956 | Ga0307407_104259562 | 196 |
| 587 | 3300035119 | Ga0373956_0215427 | Ga0373956_0215427_92_694 | 196 |
| 588 | 3300035171 | Ga0373946_0034867 | Ga0373946_0034867_967_1569 | 196 |
| 589 | 3300035692 | Ga0373935_0073481 | Ga0373935_0073481_855_1457 | 196 |
| 590 | 3300035695 | Ga0373927_0038435 | Ga0373927_0038435_2254_2856 | 196 |
| 591 | 3300035724 | Ga0373933_0486823 | Ga0373933_0486823_38_640 | 196 |
| 592 | 3300035725 | Ga0373947_0009096 | Ga0373947_0009096_995_1597 | 196 |
| 593 | 3300036401 | Ga0373937_0365600 | Ga0373937_0365600_632_1234 | 196 |
| 594 | 3300036401 | Ga0373937_0635489 | Ga0373937_0635489_39_641 | 196 |
| 595 | 3300037068 | Ga0373925_0029717 | Ga0373925_0029717_2753_3355 | 196 |
| 596 | 3300037418 | Ga0395900_0095814 | Ga0395900_0095814_1443_2048 | 196 |
| 597 | 3300037466 | Ga0395898_0009675 | Ga0395898_0009675_2410_3015 | 196 |
| 598 | 3300038443 | Ga0395901_0017833 | Ga0395901_0017833_4477_5082 | 196 |
| 599 | 3300039437 | Ga0436365_0982785 | Ga0436365_0982785_27651_28241 | 196 |
| 600 | 3300039437 | Ga0436365_1291084 | Ga0436365_1291084_8851_9459 | 196 |
| 601 | 3300039450 | Ga0436363_1184338 | Ga0436363_1184338_18751_19353 | 196 |
| 602 | 3300039450 | Ga0436363_1287632 | Ga0436363_1287632_396_998 | 196 |
| 603 | 3300042156 | Ga0439446_0098379 | Ga0439446_0098379_246_848 | 196 |
| 604 | 3300042439 | Ga0439464_0063777 | Ga0439464_0063777_182_784 | 196 |
| 605 | 3300044842 | Ga0466957_0327983 | Ga0466957_0327983_204_800 | 196 |
| 606 | 3300045976 | Ga0466967_0254369 | Ga0466967_0254369_727_1323 | 196 |
| 607 | 3300045976 | Ga0466967_0653669 | Ga0466967_0653669_352_960 | 196 |
| 608 | 3300046454 | Ga0495592_0356207 | Ga0495592_0356207_162_764 | 196 |
| 609 | 3300046472 | Ga0495580_0022060 | Ga0495580_0022060_1753_2355 | 196 |
| 610 | 3300046472 | Ga0495580_0362947 | Ga0495580_0362947_327_929 | 196 |
| 611 | 3300046472 | Ga0495580_0496426 | Ga0495580_0496426_96_698 | 196 |
| 612 | 3300046473 | Ga0495582_0005935 | Ga0495582_0005935_2219_2821 | 196 |
| 613 | 3300046477 | Ga0495664_0112737 | Ga0495664_0112737_935_1537 | 196 |
| 614 | 3300046477 | Ga0495664_0212227 | Ga0495664_0212227_456_1058 | 196 |
| 615 | 3300046477 | Ga0495664_0284403 | Ga0495664_0284403_94_696 | 196 |
| 616 | 3300046516 | Ga0495628_0210658 | Ga0495628_0210658_46_648 | 196 |
| 617 | 3300046517 | Ga0495630_0469358 | Ga0495630_0469358_283_897 | 196 |
| 618 | 3300046529 | Ga0495652_0153912 | Ga0495652_0153912_345_947 | 196 |
| 619 | 3300046529 | Ga0495652_0173490 | Ga0495652_0173490_158_760 | 196 |
| 620 | 3300046539 | Ga0495621_0085484 | Ga0495621_0085484_22_627 | 196 |
| 621 | 3300046543 | Ga0495645_0044951 | Ga0495645_0044951_2245_2847 | 196 |
| 622 | 3300046557 | Ga0495622_0002990 | Ga0495622_0002990_3479_4084 | 196 |
| 623 | 3300046683 | Ga0495658_0000415 | Ga0495658_0000415_3725_4327 | 196 |
| 624 | 3300046684 | Ga0495669_0188591 | Ga0495669_0188591_166_768 | 196 |
| 625 | 3300046689 | Ga0495613_0203206 | Ga0495613_0203206_745_1347 | 196 |
| 626 | 3300046692 | Ga0495671_0176808 | Ga0495671_0176808_182_787 | 196 |
| 627 | 3300046809 | Ga0495600_0403655 | Ga0495600_0403655_61_651 | 196 |
| 628 | 3300046809 | Ga0495600_0412797 | Ga0495600_0412797_124_726 | 196 |
| 629 | 3300047320 | Ga0495672_0271063 | Ga0495672_0271063_81_686 | 196 |
| 630 | 3300047444 | Ga0495675_0072141 | Ga0495675_0072141_1289_1891 | 196 |
| 631 | 3300048909 | Ga0496106_0294308 | Ga0496106_0294308_383_985 | 196 |
| 632 | 3300048923 | Ga0496120_0136847 | Ga0496120_0136847_233_823 | 196 |
| 633 | 3300048924 | Ga0496121_0000154 | Ga0496121_0000154_9861_10451 | 196 |
| 634 | 3300048929 | Ga0496126_0001104 | Ga0496126_0001104_31710_32312 | 196 |
| 635 | 3300048929 | Ga0496126_0057975 | Ga0496126_0057975_849_1439 | 196 |
| 636 | 3300049460 | Ga0495682_0038380 | Ga0495682_0038380_83_685 | 196 |
| 637 | 3300049569 | Ga0501032_0055900 | Ga0501032_0055900_898_1500 | 196 |
| 638 | 3300049569 | Ga0501032_0258564 | Ga0501032_0258564_341_931 | 196 |
| 639 | 3300049570 | Ga0501033_0074198 | Ga0501033_0074198_498_1088 | 196 |
| 640 | 3300049570 | Ga0501033_0169487 | Ga0501033_0169487_527_1129 | 196 |
| 641 | 3300049571 | Ga0501034_0067469 | Ga0501034_0067469_2157_2759 | 196 |
| 642 | 3300049571 | Ga0501034_0117501 | Ga0501034_0117501_684_1286 | 196 |
| 643 | 3300049571 | Ga0501034_0227400 | Ga0501034_0227400_310_900 | 196 |
| 644 | 3300049571 | Ga0501034_0392461 | Ga0501034_0392461_588_1178 | 196 |
| 645 | 3300049572 | Ga0501036_0046458 | Ga0501036_0046458_1591_2193 | 196 |
| 646 | 3300049573 | Ga0501037_0038370 | Ga0501037_0038370_302_892 | 196 |
| 647 | 3300049574 | Ga0501038_0119239 | Ga0501038_0119239_1311_1913 | 196 |
| 648 | 3300049574 | Ga0501038_0206322 | Ga0501038_0206322_163_753 | 196 |
| 649 | 3300049575 | Ga0501039_0793787 | Ga0501039_0793787_89_679 | 196 |
| 650 | 3300049578 | Ga0501042_0397908 | Ga0501042_0397908_169_765 | 196 |
| 651 | 3300049579 | Ga0501043_0111974 | Ga0501043_0111974_535_1137 | 196 |
| 652 | 3300049579 | Ga0501043_0141740 | Ga0501043_0141740_1130_1732 | 196 |
| 653 | 3300049579 | Ga0501043_0143809 | Ga0501043_0143809_1163_1765 | 196 |
| 654 | 3300049580 | Ga0501046_0040290 | Ga0501046_0040290_1217_1807 | 196 |
| 655 | 3300049580 | Ga0501046_0044234 | Ga0501046_0044234_1382_1972 | 196 |
| 656 | 3300049580 | Ga0501046_0179595 | Ga0501046_0179595_919_1509 | 196 |
| 657 | 3300049581 | Ga0501047_0002943 | Ga0501047_0002943_14542_15144 | 196 |
| 658 | 3300049581 | Ga0501047_0004907 | Ga0501047_0004907_5707_6297 | 196 |
| 659 | 3300049581 | Ga0501047_0009629 | Ga0501047_0009629_7903_8493 | 196 |
| 660 | 3300049581 | Ga0501047_0032360 | Ga0501047_0032360_3751_4341 | 196 |
| 661 | 3300049581 | Ga0501047_0037093 | Ga0501047_0037093_2977_3579 | 196 |
| 662 | 3300049581 | Ga0501047_0089165 | Ga0501047_0089165_1691_2281 | 196 |
| 663 | 3300049581 | Ga0501047_0252181 | Ga0501047_0252181_700_1290 | 196 |
| 664 | 3300049581 | Ga0501047_0258296 | Ga0501047_0258296_525_1127 | 196 |
| 665 | 3300049581 | Ga0501047_0584876 | Ga0501047_0584876_77_667 | 196 |
| 666 | 3300049582 | Ga0501048_0575269 | Ga0501048_0575269_109_711 | 196 |
| 667 | 3300049583 | Ga0501067_0011618 | Ga0501067_0011618_2198_2800 | 196 |
| 668 | 3300049583 | Ga0501067_0015267 | Ga0501067_0015267_387_989 | 196 |
| 669 | 3300049585 | Ga0501069_0016664 | Ga0501069_0016664_560_1162 | 196 |
| 670 | 3300049586 | Ga0501070_0039926 | Ga0501070_0039926_2977_3579 | 196 |
| 671 | 3300049586 | Ga0501070_0075317 | Ga0501070_0075317_2137_2751 | 196 |
| 672 | 3300049586 | Ga0501070_0120164 | Ga0501070_0120164_409_1011 | 196 |
| 673 | 3300049586 | Ga0501070_0166774 | Ga0501070_0166774_224_826 | 196 |
| 674 | 3300049586 | Ga0501070_0221410 | Ga0501070_0221410_147_749 | 196 |
| 675 | 3300049588 | Ga0501072_0020816 | Ga0501072_0020816_1544_2146 | 196 |
| 676 | 3300049589 | Ga0501073_0006683 | Ga0501073_0006683_612_1214 | 196 |
| 677 | 3300049589 | Ga0501073_0263526 | Ga0501073_0263526_343_945 | 196 |
| 678 | 3300049589 | Ga0501073_0472860 | Ga0501073_0472860_58_660 | 196 |
| 679 | 3300049592 | Ga0501076_0669512 | Ga0501076_0669512_24_626 | 196 |
| 680 | 3300049741 | Ga0501079_0041411 | Ga0501079_0041411_1352_1954 | 196 |
| 681 | 3300049742 | Ga0501080_0002883 | Ga0501080_0002883_11316_11918 | 196 |
| 682 | 3300049742 | Ga0501080_0076339 | Ga0501080_0076339_614_1219 | 196 |
| 683 | 3300049742 | Ga0501080_0491288 | Ga0501080_0491288_428_1042 | 196 |
| 684 | 3300049742 | Ga0501080_0737252 | Ga0501080_0737252_123_725 | 196 |
| 685 | 3300049742 | Ga0501080_0969471 | Ga0501080_0969471_79_681 | 196 |
| 686 | 3300049822 | Ga0501035_0030048 | Ga0501035_0030048_4253_4843 | 196 |
| 687 | 3300049822 | Ga0501035_0065312 | Ga0501035_0065312_2557_3159 | 196 |
| 688 | 3300049822 | Ga0501035_0169065 | Ga0501035_0169065_512_1114 | 196 |
| 689 | 3300049822 | Ga0501035_0255660 | Ga0501035_0255660_613_1203 | 196 |
| 690 | 3300049822 | Ga0501035_0500650 | Ga0501035_0500650_85_675 | 196 |
| 691 | 3300049823 | Ga0501044_0003661 | Ga0501044_0003661_10635_11225 | 196 |
| 692 | 3300049823 | Ga0501044_0025682 | Ga0501044_0025682_2384_2986 | 196 |
| 693 | 3300049823 | Ga0501044_0127704 | Ga0501044_0127704_800_1390 | 196 |
| 694 | 3300049823 | Ga0501044_0190249 | Ga0501044_0190249_696_1298 | 196 |
| 695 | 3300049823 | Ga0501044_0956262 | Ga0501044_0956262_73_663 | 196 |
| 696 | 3300050509 | nmdc:mga0qj67_212823_c1 | nmdc:mga0qj67_212823_c1_100_702 | 196 |
| 697 | 3300050511 | nmdc:mga08y16_312326_c1 | nmdc:mga08y16_312326_c1_171_773 | 196 |
| 698 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_204636_205241 | 196 |
| 699 | 3300053119 | Ga0500595_004900 | Ga0500595_004900_4523_5113 | 196 |
| 700 | 3300053119 | Ga0500595_048945 | Ga0500595_048945_518_1123 | 196 |
| 701 | 3300053123 | Ga0500614_078905 | Ga0500614_078905_292_882 | 196 |
| 702 | 3300053130 | Ga0500642_0037868 | Ga0500642_0037868_925_1530 | 196 |
| 703 | 3300053133 | Ga0500655_001037 | Ga0500655_001037_3026_3628 | 196 |
| 704 | 3300053136 | Ga0500559_0006453 | Ga0500559_0006453_444_1046 | 196 |
| 705 | 3300053136 | Ga0500559_0054652 | Ga0500559_0054652_720_1310 | 196 |
| 706 | 3300053139 | Ga0500568_0037697 | Ga0500568_0037697_395_1000 | 196 |
| 707 | 3300053140 | Ga0500573_0000032 | Ga0500573_0000032_121802_122407 | 196 |
| 708 | 3300053142 | Ga0500577_0076821 | Ga0500577_0076821_446_1090 | 196 |
| 709 | 3300053154 | Ga0500619_005322 | Ga0500619_005322_1814_2416 | 196 |
| 710 | 3300053730 | Ga0500645_047516 | Ga0500645_047516_68_673 | 196 |
| 711 | 3300054114 | Ga0501084_0000971 | Ga0501084_0000971_9754_10356 | 196 |
| 712 | 3300054114 | Ga0501084_0012790 | Ga0501084_0012790_3813_4415 | 196 |
| 713 | 3300054114 | Ga0501084_0015332 | Ga0501084_0015332_5075_5677 | 196 |
| 714 | 3300060353 | Ga0501082_0050277 | Ga0501082_0050277_2944_3546 | 196 |
| 715 | 3300060353 | Ga0501082_0132765 | Ga0501082_0132765_1509_2111 | 196 |
| 716 | 3300060353 | Ga0501082_0841200 | Ga0501082_0841200_163_765 | 196 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9432 | 82 | 169 |
| 8a93-assembly1.cif.gz_F | complex of recf-recr-dna from thermus thermophilus. | 0.9133 | 82 | 169 |
| 3ve5-assembly1.cif.gz_A | structure of recombination mediator protein recr16-196 deletion mutant | 0.8958 | 19 | 196 |
| 3ve5-assembly1.cif.gz_A | structure of recombination mediator protein recr16-196 deletion mutant | 0.8768 | 19 | 196 |
| 6z2b-assembly1.cif.gz_A | toprim domain of rnase m5 bound with two mg2+ ions | 0.7902 | 79 | 194 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ve5A03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9632 | 78 | 196 | 3.40.1360.10 |
| af_P0A7H6_77_171_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9416 | 81 | 168 | 3.40.1360.10 |
| af_P9WHI3_76_174_3.40.1360.10 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.938 | 78 | 168 | 3.40.1360.10 |
| 3ve5A03 | Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; | 0.9327 | 78 | 196 | 3.40.1360.10 |
| 3vdpC01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 | 0.923 | 7 | 53 | 1.10.8.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9BGG3-F1-model_v4 | Recombination protein RecR | 0.991 | 60 | 155 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A3B9BGG3-F1-model_v4 | Recombination protein RecR | 0.9709 | 60 | 155 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A3D0TKE5-F1-model_v4 | Recombination protein RecR | 0.9626 | 55 | 171 |
GO:0003677
GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A2V2L171-F1-model_v4 | deleted | 0.9519 | 45 | 124 |
|
| AF-W4U8H3-F1-model_v4 | deleted | 0.9494 | 53 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar