F477053

General Info

Members Datasets Scaffolds Average Seq Length
716 269 712 196

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10120706|Ga0207698_101207062
Length 221
Sequence MAFLAFQNDIGKVFARLLDRVMASHPAGPEIERLIQLLAKLPGLGPRSARRAALALLKKREALLEPLGMAMREASAAIKVCETCGNLDTTNPCALCRDPQRDSHLLCVVEDVADLWALERAGIFRGKYHVLGGALSALDGVTPERLNVASLVRRAGEGVDEVILAVNATVEGQTTAHYLMDVLTPSGVKVTRLAHGVPVGGELDYLDEGTLSAAFKARRGL

Samples

Sample ID Description Type Environment
1 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
2 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
3 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
4 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
258 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
259 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
262 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
263 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
264 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
265 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.07
Nodule 0.42
Rhizoplane 0.14
Rhizosphere 92.32
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000080 3300003214 Bacteria 176649
2 JGI25153J46596_10000812 3300003215 Bacteria 19097
3 Ga0070658_10002534 3300005327 Bacteria 15249
4 Ga0070658_10300450 3300005327 Bacteria 1369
5 Ga0070658_10413174 3300005327 Bacteria 1160
6 Ga0070658_10489405 3300005327 Bacteria 1062
7 Ga0070658_10819072 3300005327 Bacteria 809
8 Ga0070676_10089400 3300005328 Bacteria 1884
9 Ga0070683_100208029 3300005329 Bacteria 1858
10 Ga0070690_100146593 3300005330 Bacteria 1607
11 Ga0068869_100176857 3300005334 Bacteria 1671
12 Ga0068869_100187227 3300005334 Bacteria 1626
13 Ga0070680_100000332 3300005336 Bacteria 31618
14 Ga0070680_100062010 3300005336 Bacteria 3061
15 Ga0070680_100136542 3300005336 Bacteria 2055
16 Ga0070680_100401604 3300005336 Bacteria 1168
17 Ga0068868_100556110 3300005338 Bacteria 1012
18 Ga0068868_100962811 3300005338 Bacteria 779
19 Ga0070660_100086353 3300005339 Bacteria 2468
20 Ga0070689_101072836 3300005340 Bacteria 719
21 Ga0070691_10137849 3300005341 Bacteria 1241
22 Ga0070661_100000135 3300005344 Bacteria 61669
23 Ga0070661_100022011 3300005344 Bacteria 4560
24 Ga0070661_100292728 3300005344 Bacteria 1265
25 Ga0070675_100087059 3300005354 Bacteria 2612
26 Ga0070675_100223448 3300005354 Bacteria 1641
27 Ga0070671_100217559 3300005355 Bacteria 1621
28 Ga0070671_100802032 3300005355 Bacteria 820
29 Ga0070674_100181571 3300005356 Bacteria 1612
30 Ga0070674_100446990 3300005356 Bacteria 1066
31 Ga0070674_100897353 3300005356 Bacteria 772
32 Ga0070673_100109977 3300005364 Bacteria 2284
33 Ga0070673_100116003 3300005364 Bacteria 2227
34 Ga0070673_100253767 3300005364 Bacteria 1534
35 Ga0070667_100047937 3300005367 Bacteria 3596
36 Ga0070667_100083406 3300005367 Bacteria 2738
37 Ga0070714_100078148 3300005435 Bacteria 2876
38 Ga0070714_100098978 3300005435 Bacteria 2566
39 Ga0070714_100571097 3300005435 Bacteria 1084
40 Ga0070713_100025897 3300005436 Bacteria 4595
41 Ga0070713_100289753 3300005436 Bacteria 1504
42 Ga0070710_10006054 3300005437 Bacteria 5782
43 Ga0070711_100036579 3300005439 Bacteria 3289
44 Ga0070711_100204462 3300005439 Bacteria 1526
45 Ga0070711_100444418 3300005439 Bacteria 1060
46 Ga0070678_100002862 3300005456 Bacteria 9557
47 Ga0070678_100016293 3300005456 Bacteria 4751
48 Ga0070678_100019805 3300005456 Bacteria 4398
49 Ga0070678_100079469 3300005456 Bacteria 2481
50 Ga0070678_100141932 3300005456 Bacteria 1923
51 Ga0070681_10000123 3300005458 Bacteria 57938
52 Ga0070681_10055003 3300005458 Bacteria 3965
53 Ga0070681_10227662 3300005458 Bacteria 1779
54 Ga0070681_10249613 3300005458 Bacteria 1687
55 Ga0070681_10279598 3300005458 Bacteria 1580
56 Ga0070681_10746889 3300005458 Bacteria 895
57 Ga0070707_100062475 3300005468 Bacteria 3573
58 Ga0070698_100005421 3300005471 Bacteria 13939
59 Ga0070698_100137307 3300005471 Bacteria 2398
60 Ga0070699_100037090 3300005518 Bacteria 4218
61 Ga0070699_100337014 3300005518 Bacteria 1357
62 Ga0070699_100364519 3300005518 Bacteria 1303
63 Ga0070679_100000490 3300005530 Bacteria 33743
64 Ga0070679_100005993 3300005530 Bacteria 11303
65 Ga0070679_100024189 3300005530 Bacteria 5951
66 Ga0070679_100267901 3300005530 Bacteria 1663
67 Ga0070679_100431881 3300005530 Bacteria 1262
68 Ga0070684_100199581 3300005535 Bacteria 1822
69 Ga0070684_100611340 3300005535 Bacteria 1014
70 Ga0068853_100005091 3300005539 Bacteria 10262
71 Ga0068853_100016798 3300005539 Bacteria 6029
72 Ga0068853_100073378 3300005539 Bacteria 2984
73 Ga0068853_101049883 3300005539 Bacteria 785
74 Ga0070672_100429844 3300005543 Bacteria 1135
75 Ga0070672_101053026 3300005543 Bacteria 722
76 Ga0070695_100274511 3300005545 Bacteria 1236
77 Ga0070693_100069882 3300005547 Bacteria 2065
78 Ga0070665_100002457 3300005548 Bacteria 20427
79 Ga0070665_100089174 3300005548 Bacteria 3090
80 Ga0070665_100099565 3300005548 Bacteria 2911
81 Ga0070665_100127884 3300005548 Bacteria 2543
82 Ga0070665_100134188 3300005548 Bacteria 2477
83 Ga0070665_100169252 3300005548 Bacteria 2186
84 Ga0070665_100187834 3300005548 Bacteria 2067
85 Ga0070665_100213620 3300005548 Bacteria 1930
86 Ga0070665_100395431 3300005548 Bacteria 1390
87 Ga0068855_100000529 3300005563 Bacteria 46748
88 Ga0068855_100030598 3300005563 Bacteria 6435
89 Ga0068855_100148589 3300005563 Bacteria 2666
90 Ga0068855_100307750 3300005563 Bacteria 1754
91 Ga0068855_100870463 3300005563 Bacteria 953
92 Ga0068857_100100352 3300005577 Bacteria 2597
93 Ga0068857_100103816 3300005577 Bacteria 2552
94 Ga0068857_100192559 3300005577 Bacteria 1857
95 Ga0068854_100294821 3300005578 Bacteria 1310
96 Ga0068856_100103164 3300005614 Bacteria 2846
97 Ga0068856_100467004 3300005614 Bacteria 1283
98 Ga0070702_100157769 3300005615 Bacteria 1463
99 Ga0068852_100090814 3300005616 Bacteria 2732
100 Ga0068852_100174582 3300005616 Bacteria 2017
101 Ga0068852_100600280 3300005616 Bacteria 1105
102 Ga0068859_100388566 3300005617 Bacteria 1491
103 Ga0068859_100825594 3300005617 Bacteria 1014
104 Ga0068864_100602615 3300005618 Bacteria 1066
105 Ga0068861_100101094 3300005719 Bacteria 2293
106 Ga0068870_10081587 3300005840 Bacteria 1789
107 Ga0068863_100248827 3300005841 Bacteria 1717
108 Ga0068858_100007195 3300005842 Bacteria 10791
109 Ga0068858_100100353 3300005842 Bacteria 2700
110 Ga0068860_100037804 3300005843 Bacteria 4619
111 Ga0068860_100269766 3300005843 Bacteria 1661
112 Ga0068860_101041327 3300005843 Bacteria 837
113 Ga0081455_10215516 3300005937 Bacteria 1427
114 Ga0081538_10028741 3300005981 Bacteria 3815
115 Ga0070717_10002736 3300006028 Bacteria 12453
116 Ga0070717_10004979 3300006028 Bacteria 9665
117 Ga0070717_10749084 3300006028 Bacteria 888
118 Ga0075362_10019412 3300006177 Bacteria 2826
119 Ga0097621_100000267 3300006237 Bacteria 35345
120 Ga0097621_100025424 3300006237 Bacteria 4633
121 Ga0097621_100045626 3300006237 Bacteria 3541
122 Ga0097621_100084595 3300006237 Bacteria 2645
123 Ga0097621_100169682 3300006237 Bacteria 1880
124 Ga0097621_100237065 3300006237 Bacteria 1594
125 Ga0068871_100002164 3300006358 Bacteria 13334
126 Ga0068871_100003594 3300006358 Bacteria 10654
127 Ga0068871_100180019 3300006358 Bacteria 1816
128 Ga0068871_100202798 3300006358 Bacteria 1713
129 Ga0068871_100548626 3300006358 Bacteria 1047
130 Ga0075428_100511987 3300006844 Bacteria 1284
131 Ga0075430_100194453 3300006846 Bacteria 1685
132 Ga0075431_100196176 3300006847 Bacteria 2067
133 Ga0075434_100196301 3300006871 Bacteria 2038
134 Ga0068865_100005263 3300006881 Bacteria 7824
135 Ga0097620_100388579 3300006931 Bacteria 1491
136 Ga0097620_100825590 3300006931 Bacteria 1014
137 Ga0099795_10003494 3300007788 Bacteria 3898
138 Ga0105240_10000055 3300009093 Bacteria 225380
139 Ga0105240_10021384 3300009093 Bacteria 8605
140 Ga0105240_10029678 3300009093 Bacteria 7117
141 Ga0105240_10042935 3300009093 Bacteria 5759
142 Ga0105240_10081334 3300009093 Bacteria 3981
143 Ga0105240_10116517 3300009093 Bacteria 3223
144 Ga0105240_10153807 3300009093 Bacteria 2737
145 Ga0105240_10362552 3300009093 Bacteria 1641
146 Ga0105240_10455168 3300009093 Bacteria 1431
147 Ga0105240_10783049 3300009093 Bacteria 1034
148 Ga0105240_11055795 3300009093 Bacteria 866
149 Ga0111539_10159125 3300009094 Bacteria 2642
150 Ga0111539_10801479 3300009094 Bacteria 1096
151 Ga0105245_10001742 3300009098 Bacteria 19846
152 Ga0105245_10376812 3300009098 Bacteria 1412
153 Ga0105245_10444974 3300009098 Bacteria 1303
154 Ga0105245_10506287 3300009098 Bacteria 1224
155 Ga0105245_10537001 3300009098 Bacteria 1190
156 Ga0105247_10052153 3300009101 Bacteria 2521
157 Ga0105243_10042358 3300009148 Bacteria 3565
158 Ga0105243_10299509 3300009148 Bacteria 1457
159 Ga0105241_10105447 3300009174 Bacteria 2248
160 Ga0105241_10167246 3300009174 Bacteria 1813
161 Ga0105241_10642923 3300009174 Bacteria 963
162 Ga0105241_11008583 3300009174 Bacteria 779
163 Ga0105242_10017460 3300009176 Bacteria 5594
164 Ga0105242_10037486 3300009176 Bacteria 3894
165 Ga0105242_10084700 3300009176 Bacteria 2657
166 Ga0105248_10000001 3300009177 Bacteria 1881304
167 Ga0105248_10049054 3300009177 Bacteria 4736
168 Ga0105248_10128292 3300009177 Bacteria 2861
169 Ga0105237_10070835 3300009545 Bacteria 3482
170 Ga0105237_10159778 3300009545 Bacteria 2252
171 Ga0105237_10320893 3300009545 Bacteria 1552
172 Ga0105237_10395432 3300009545 Bacteria 1387
173 Ga0105237_10746619 3300009545 Bacteria 985
174 Ga0105237_10765380 3300009545 Bacteria 972
175 Ga0105238_10042693 3300009551 Bacteria 4591
176 Ga0105238_10083039 3300009551 Bacteria 3193
177 Ga0105238_10283127 3300009551 Bacteria 1639
178 Ga0105238_10560908 3300009551 Bacteria 1147
179 Ga0105238_10858050 3300009551 Bacteria 925
180 Ga0105238_11060011 3300009551 Bacteria 832
181 Ga0105238_11426975 3300009551 Bacteria 720
182 Ga0105249_10004983 3300009553 Bacteria 11454
183 Ga0105249_10180275 3300009553 Bacteria 2055
184 Ga0105239_10003373 3300010375 Bacteria 19598
185 Ga0105239_10009872 3300010375 Bacteria 10724
186 Ga0105239_10012800 3300010375 Bacteria 9333
187 Ga0105239_10274120 3300010375 Bacteria 1898
188 Ga0105239_10456918 3300010375 Bacteria 1449
189 Ga0105239_10594920 3300010375 Bacteria 1261
190 Ga0105239_11878927 3300010375 Bacteria 694
191 Ga0105246_10093243 3300011119 Bacteria 2175
192 Ga0157373_10455590 3300013100 Bacteria 921
193 Ga0157373_10491860 3300013100 Bacteria 886
194 Ga0157370_10038939 3300013104 Bacteria 4598
195 Ga0157370_10046667 3300013104 Bacteria 4153
196 Ga0157370_10182100 3300013104 Bacteria 1952
197 Ga0157370_10298056 3300013104 Bacteria 1489
198 Ga0157370_10450650 3300013104 Bacteria 1183
199 Ga0157369_10012565 3300013105 Bacteria 9606
200 Ga0157369_10118610 3300013105 Bacteria 2809
201 Ga0157369_10604210 3300013105 Bacteria 1132
202 Ga0157374_10051271 3300013296 Bacteria 3839
203 Ga0157374_10220212 3300013296 Bacteria 1862
204 Ga0157378_10088182 3300013297 Bacteria 2815
205 Ga0157378_10097732 3300013297 Bacteria 2677
206 Ga0157378_10287625 3300013297 Bacteria 1586
207 Ga0157378_10745418 3300013297 Bacteria 1002
208 Ga0163162_10008334 3300013306 Bacteria 10111
209 Ga0163162_10093293 3300013306 Bacteria 3095
210 Ga0163162_10566639 3300013306 Bacteria 1263
211 Ga0157372_10064258 3300013307 Bacteria 4118
212 Ga0157372_10159582 3300013307 Bacteria 2606
213 Ga0157372_10226351 3300013307 Bacteria 2168
214 Ga0157375_10173971 3300013308 Bacteria 2302
215 Ga0157375_10174265 3300013308 Bacteria 2300
216 Ga0157375_10893451 3300013308 Bacteria 1033
217 Ga0157375_11072178 3300013308 Bacteria 942
218 Ga0163163_10000021 3300014325 Bacteria 191799
219 Ga0163163_10048632 3300014325 Bacteria 4171
220 Ga0163163_10077632 3300014325 Bacteria 3316
221 Ga0163163_10301609 3300014325 Bacteria 1654
222 Ga0163163_10439617 3300014325 Bacteria 1364
223 Ga0157380_10757972 3300014326 Bacteria 983
224 Ga0157377_10144416 3300014745 Bacteria 1465
225 Ga0157379_10000304 3300014968 Bacteria 38893
226 Ga0157379_10003277 3300014968 Bacteria 13713
227 Ga0157379_10162175 3300014968 Bacteria 2018
228 Ga0157379_10241593 3300014968 Bacteria 1638
229 Ga0157379_11038885 3300014968 Bacteria 783
230 Ga0157376_10340468 3300014969 Bacteria 1432
231 Ga0157376_11148654 3300014969 Bacteria 804
232 Ga0163161_10325510 3300017792 Bacteria 1216
233 Ga0213872_10098369 3300021361 Bacteria 1306
234 Ga0213874_10001161 3300021377 Bacteria 5402
235 Ga0213874_10038817 3300021377 Bacteria 1415
236 Ga0213876_10000167 3300021384 Bacteria 69385
237 Ga0213876_10000322 3300021384 Bacteria 41914
238 Ga0213876_10011629 3300021384 Bacteria 4699
239 Ga0213876_10141117 3300021384 Bacteria 1281
240 Ga0213876_10222275 3300021384 Bacteria 1004
241 Ga0213875_10000911 3300021388 Bacteria 21434
242 Ga0213871_10079436 3300021441 Bacteria 938
243 Ga0209233_1000006 3300025261 Bacteria 1473685
244 Ga0209233_1043971 3300025261 Bacteria 949
245 Ga0209676_1000269 3300025292 Bacteria 108375
246 Ga0209758_1000008 3300025297 Bacteria 1215263
247 Ga0209050_1014548 3300025298 Bacteria 3380
248 Ga0207710_10026810 3300025900 Bacteria 2491
249 Ga0207688_10261151 3300025901 Bacteria 1051
250 Ga0207705_10004807 3300025909 Bacteria 10169
251 Ga0207705_10029374 3300025909 Bacteria 3919
252 Ga0207705_10246891 3300025909 Bacteria 1361
253 Ga0207654_10017205 3300025911 Bacteria 3776
254 Ga0207654_10025054 3300025911 Bacteria 3213
255 Ga0207654_10100203 3300025911 Bacteria 1783
256 Ga0207654_10116673 3300025911 Bacteria 1670
257 Ga0207654_10135096 3300025911 Bacteria 1566
258 Ga0207654_10232511 3300025911 Bacteria 1228
259 Ga0207654_10281859 3300025911 Bacteria 1124
260 Ga0207707_10000002 3300025912 Bacteria 1142054
261 Ga0207707_10024954 3300025912 Bacteria 5230
262 Ga0207707_10036197 3300025912 Bacteria 4317
263 Ga0207707_10188997 3300025912 Bacteria 1797
264 Ga0207695_10000012 3300025913 Bacteria 840961
265 Ga0207695_10018410 3300025913 Bacteria 8078
266 Ga0207695_10021214 3300025913 Bacteria 7418
267 Ga0207695_10039690 3300025913 Bacteria 5057
268 Ga0207695_10072969 3300025913 Bacteria 3499
269 Ga0207695_10106427 3300025913 Bacteria 2791
270 Ga0207695_10136383 3300025913 Bacteria 2407
271 Ga0207695_10178394 3300025913 Bacteria 2046
272 Ga0207695_10263480 3300025913 Bacteria 1621
273 Ga0207695_10267290 3300025913 Bacteria 1606
274 Ga0207693_10000809 3300025915 Bacteria 27963
275 Ga0207693_10178561 3300025915 Bacteria 1670
276 Ga0207663_10143965 3300025916 Bacteria 1664
277 Ga0207660_10001154 3300025917 Bacteria 17638
278 Ga0207660_10022576 3300025917 Bacteria 4241
279 Ga0207660_10051588 3300025917 Bacteria 2925
280 Ga0207660_10300920 3300025917 Bacteria 1277
281 Ga0207657_10006097 3300025919 Bacteria 12535
282 Ga0207657_10051133 3300025919 Bacteria 3592
283 Ga0207657_10261848 3300025919 Bacteria 1376
284 Ga0207657_10628821 3300025919 Bacteria 836
285 Ga0207649_10000060 3300025920 Bacteria 99202
286 Ga0207649_10241976 3300025920 Bacteria 1296
287 Ga0207649_10960649 3300025920 Bacteria 671
288 Ga0207652_10000197 3300025921 Bacteria 63525
289 Ga0207652_10023428 3300025921 Bacteria 5115
290 Ga0207652_10086100 3300025921 Bacteria 2755
291 Ga0207652_10276272 3300025921 Bacteria 1515
292 Ga0207646_10076216 3300025922 Bacteria 2997
293 Ga0207694_10000006 3300025924 Bacteria 631109
294 Ga0207694_10176022 3300025924 Bacteria 1734
295 Ga0207694_10280954 3300025924 Bacteria 1367
296 Ga0207694_10552388 3300025924 Bacteria 967
297 Ga0207659_11264604 3300025926 Bacteria 634
298 Ga0207687_10005839 3300025927 Bacteria 8142
299 Ga0207687_10106730 3300025927 Bacteria 2071
300 Ga0207700_10098889 3300025928 Bacteria 2322
301 Ga0207700_10190330 3300025928 Bacteria 1724
302 Ga0207664_10143490 3300025929 Bacteria 2023
303 Ga0207664_10300089 3300025929 Bacteria 1413
304 Ga0207690_10006072 3300025932 Bacteria 7155
305 Ga0207690_10272772 3300025932 Bacteria 1315
306 Ga0207686_10001631 3300025934 Bacteria 12536
307 Ga0207686_10024090 3300025934 Bacteria 3522
308 Ga0207686_10097491 3300025934 Bacteria 1956
309 Ga0207709_10152238 3300025935 Bacteria 1603
310 Ga0207670_10498436 3300025936 Bacteria 988
311 Ga0207669_10483504 3300025937 Bacteria 987
312 Ga0207704_10073711 3300025938 Bacteria 2175
313 Ga0207704_10629487 3300025938 Bacteria 881
314 Ga0207704_10642640 3300025938 Bacteria 873
315 Ga0207711_10000001 3300025941 Bacteria 1325674
316 Ga0207711_10134983 3300025941 Bacteria 2216
317 Ga0207689_10078008 3300025942 Bacteria 2722
318 Ga0207689_10083601 3300025942 Bacteria 2624
319 Ga0207689_10187325 3300025942 Bacteria 1707
320 Ga0207679_10349273 3300025945 Bacteria 1289
321 Ga0207679_10936697 3300025945 Bacteria 793
322 Ga0207667_10000026 3300025949 Bacteria 343713
323 Ga0207667_10089940 3300025949 Bacteria 3172
324 Ga0207667_10183552 3300025949 Bacteria 2148
325 Ga0207667_10271040 3300025949 Bacteria 1735
326 Ga0207651_10040945 3300025960 Bacteria 3071
327 Ga0207712_10084372 3300025961 Bacteria 2321
328 Ga0207712_10162925 3300025961 Bacteria 1735
329 Ga0207712_10730874 3300025961 Bacteria 866
330 Ga0207668_11066121 3300025972 Bacteria 724
331 Ga0207668_11094377 3300025972 Bacteria 714
332 Ga0207677_10066545 3300026023 Bacteria 2520
333 Ga0207677_10327066 3300026023 Bacteria 1276
334 Ga0207677_10609319 3300026023 Bacteria 959
335 Ga0207703_10029882 3300026035 Bacteria 4303
336 Ga0207703_10069710 3300026035 Bacteria 2900
337 Ga0207703_10527624 3300026035 Bacteria 1111
338 Ga0207639_10028153 3300026041 Bacteria 4101
339 Ga0207639_10078708 3300026041 Bacteria 2603
340 Ga0207639_10157725 3300026041 Bacteria 1909
341 Ga0207678_10418493 3300026067 Bacteria 1162
342 Ga0207702_10277503 3300026078 Bacteria 1583
343 Ga0207702_10419543 3300026078 Bacteria 1294
344 Ga0207641_10101756 3300026088 Bacteria 2532
345 Ga0207641_10509611 3300026088 Bacteria 1169
346 Ga0207648_10002996 3300026089 Bacteria 17849
347 Ga0207648_11230552 3300026089 Bacteria 703
348 Ga0207676_10029076 3300026095 Bacteria 4134
349 Ga0207676_10260840 3300026095 Bacteria 1565
350 Ga0207674_10116115 3300026116 Bacteria 2648
351 Ga0207674_10243964 3300026116 Bacteria 1743
352 Ga0207674_10641198 3300026116 Bacteria 1026
353 Ga0207674_10902591 3300026116 Bacteria 852
354 Ga0207675_100102346 3300026118 Bacteria 2699
355 Ga0207675_100143644 3300026118 Bacteria 2268
356 Ga0207675_100702832 3300026118 Bacteria 1020
357 Ga0207675_100730070 3300026118 Bacteria 1001
358 Ga0207683_10004248 3300026121 Bacteria 12363
359 Ga0207683_10018865 3300026121 Bacteria 5885
360 Ga0207683_10021537 3300026121 Bacteria 5521
361 Ga0207683_10258480 3300026121 Bacteria 1590
362 Ga0207683_10871480 3300026121 Bacteria 836
363 Ga0207698_10063956 3300026142 Bacteria 2882
364 Ga0207698_10120706 3300026142 Bacteria 2218
365 Ga0207698_10360026 3300026142 Bacteria 1377
366 Ga0207698_11009920 3300026142 Bacteria 843
367 Ga0207428_10191342 3300027907 Bacteria 1542
368 Ga0268266_10001271 3300028379 Bacteria 30810
369 Ga0268266_10072563 3300028379 Bacteria 2985
370 Ga0268266_10100739 3300028379 Bacteria 2545
371 Ga0268266_10101684 3300028379 Bacteria 2534
372 Ga0268266_10184980 3300028379 Bacteria 1899
373 Ga0268264_10038901 3300028381 Bacteria 3928
374 Ga0268264_10136500 3300028381 Bacteria 2181
375 Ga0265334_10000673 3300028573 Bacteria 17152
376 Ga0265334_10032497 3300028573 Bacteria 2081
377 Ga0265318_10000388 3300028577 Bacteria 34328
378 Ga0265318_10028719 3300028577 Bacteria 2173
379 Ga0265338_10000011 3300028800 Bacteria 433370
380 Ga0265338_10004398 3300028800 Bacteria 19064
381 Ga0265338_10033971 3300028800 Bacteria 4940
382 Ga0265330_10041620 3300031235 Bacteria 2036
383 Ga0265330_10054655 3300031235 Bacteria 1745
384 Ga0265330_10061366 3300031235 Bacteria 1635
385 Ga0265330_10081018 3300031235 Bacteria 1399
386 Ga0265330_10131524 3300031235 Bacteria 1065
387 Ga0265330_10215028 3300031235 Bacteria 811
388 Ga0265332_10004596 3300031238 Bacteria 6457
389 Ga0265332_10037781 3300031238 Bacteria 2094
390 Ga0265328_10225315 3300031239 Bacteria 714
391 Ga0265320_10000123 3300031240 Bacteria 67449
392 Ga0265320_10022145 3300031240 Bacteria 3404
393 Ga0265325_10000002 3300031241 Bacteria 396758
394 Ga0265325_10016521 3300031241 Bacteria 4126
395 Ga0265325_10017178 3300031241 Bacteria 4024
396 Ga0265325_10023835 3300031241 Bacteria 3335
397 Ga0265325_10040167 3300031241 Bacteria 2458
398 Ga0265325_10088185 3300031241 Bacteria 1533
399 Ga0265325_10186837 3300031241 Bacteria 962
400 Ga0265325_10251623 3300031241 Bacteria 800
401 Ga0265329_10014355 3300031242 Bacteria 2798
402 Ga0265329_10131959 3300031242 Bacteria 804
403 Ga0265340_10000356 3300031247 Bacteria 24392
404 Ga0265340_10001813 3300031247 Bacteria 12205
405 Ga0265340_10026657 3300031247 Bacteria 2920
406 Ga0265340_10030321 3300031247 Bacteria 2710
407 Ga0265340_10060346 3300031247 Bacteria 1817
408 Ga0265340_10069521 3300031247 Bacteria 1671
409 Ga0265340_10133856 3300031247 Bacteria 1136
410 Ga0265340_10134292 3300031247 Bacteria 1134
411 Ga0265339_10002449 3300031249 Bacteria 13290
412 Ga0265339_10006481 3300031249 Bacteria 7675
413 Ga0265339_10013056 3300031249 Bacteria 5046
414 Ga0265339_10020986 3300031249 Bacteria 3809
415 Ga0265339_10041153 3300031249 Bacteria 2566
416 Ga0265339_10170076 3300031249 Bacteria 1091
417 Ga0265339_10352548 3300031249 Bacteria 693
418 Ga0265331_10000049 3300031250 Bacteria 182618
419 Ga0265331_10000303 3300031250 Bacteria 53811
420 Ga0265331_10001113 3300031250 Bacteria 20686
421 Ga0265331_10006811 3300031250 Bacteria 6694
422 Ga0265331_10011826 3300031250 Bacteria 4764
423 Ga0265331_10017858 3300031250 Bacteria 3692
424 Ga0265331_10025616 3300031250 Bacteria 2975
425 Ga0265327_10000007 3300031251 Bacteria 678515
426 Ga0265316_10003516 3300031344 Bacteria 15817
427 Ga0265316_10021855 3300031344 Bacteria 5409
428 Ga0265316_10176558 3300031344 Bacteria 1591
429 Ga0265316_10305331 3300031344 Bacteria 1158
430 Ga0307513_10272958 3300031456 Bacteria 1473
431 Ga0265313_10000689 3300031595 Bacteria 34784
432 Ga0265313_10001836 3300031595 Bacteria 19363
433 Ga0265313_10004096 3300031595 Bacteria 11352
434 Ga0265313_10028353 3300031595 Bacteria 2912
435 Ga0265313_10060491 3300031595 Bacteria 1776
436 Ga0265313_10075295 3300031595 Bacteria 1545
437 Ga0265313_10142954 3300031595 Bacteria 1028
438 Ga0265313_10144845 3300031595 Bacteria 1019
439 Ga0265314_10001319 3300031711 Bacteria 28119
440 Ga0265314_10002354 3300031711 Bacteria 19492
441 Ga0265314_10008314 3300031711 Bacteria 8901
442 Ga0265314_10024900 3300031711 Bacteria 4527
443 Ga0265314_10035726 3300031711 Bacteria 3620
444 Ga0265314_10039342 3300031711 Bacteria 3407
445 Ga0265314_10049983 3300031711 Bacteria 2924
446 Ga0265314_10050108 3300031711 Bacteria 2919
447 Ga0265314_10071816 3300031711 Bacteria 2314
448 Ga0265314_10079446 3300031711 Bacteria 2168
449 Ga0265314_10100146 3300031711 Bacteria 1865
450 Ga0265342_10007269 3300031712 Bacteria 8132
451 Ga0265342_10018188 3300031712 Bacteria 4558
452 Ga0265342_10020762 3300031712 Bacteria 4204
453 Ga0265342_10138377 3300031712 Bacteria 1360
454 Ga0265342_10230315 3300031712 Bacteria 995
455 Ga0265342_10252024 3300031712 Bacteria 942
456 Ga0265342_10269151 3300031712 Bacteria 904
457 Ga0307516_10015652 3300031730 Bacteria 7973
458 Ga0307516_10101357 3300031730 Bacteria 2694
459 Ga0307407_10238747 3300031903 Bacteria 1239
460 Ga0307407_10425956 3300031903 Bacteria 958
461 Ga0307414_10425634 3300032004 Bacteria 1159
462 Ga0307411_10522838 3300032005 Bacteria 1007
463 Ga0373923_0208784 3300035111 Bacteria 905
464 Ga0373936_0032915 3300035113 Bacteria 2053
465 Ga0373939_0008087 3300035114 Bacteria 2571
466 Ga0373956_0215427 3300035119 Bacteria 911
467 Ga0373946_0034867 3300035171 Bacteria 2034
468 Ga0373955_0072854 3300035172 Bacteria 1925
469 Ga0373935_0073481 3300035692 Bacteria 2209
470 Ga0373927_0016671 3300035695 Bacteria 4847
471 Ga0373927_0038435 3300035695 Bacteria 3107
472 Ga0373927_0656051 3300035695 Bacteria 693
473 Ga0373933_0486823 3300035724 Bacteria 808
474 Ga0373947_0009096 3300035725 Bacteria 5709
475 Ga0373937_0000338 3300036401 Bacteria 44355
476 Ga0373937_0187274 3300036401 Bacteria 1944
477 Ga0373937_0365600 3300036401 Bacteria 1368
478 Ga0373937_0635489 3300036401 Bacteria 1013
479 Ga0316582_0246670 3300036647 Bacteria 1224
480 Ga0373925_0029717 3300037068 Bacteria 4009
481 Ga0373925_0124627 3300037068 Bacteria 2003
482 Ga0395899_0446136 3300037312 Bacteria 848
483 Ga0395900_0064337 3300037418 Bacteria 3770
484 Ga0395900_0095814 3300037418 Bacteria 3049
485 Ga0395900_0854836 3300037418 Bacteria 835
486 Ga0395898_0009675 3300037466 Bacteria 10111
487 Ga0395898_0054844 3300037466 Bacteria 3888
488 Ga0436364_0220830 3300037853 Bacteria 2633
489 Ga0436364_0259249 3300037853 Bacteria 81192
490 Ga0395901_0017833 3300038443 Bacteria 7246
491 Ga0395901_0029255 3300038443 Bacteria 5670
492 Ga0400483_018790 3300039062 Bacteria 1194
493 Ga0400483_085364 3300039062 Bacteria 2445
494 Ga0400483_211285 3300039062 Bacteria 2496
495 Ga0436365_0072725 3300039437 Bacteria 1109
496 Ga0436365_0173471 3300039437 Bacteria 110650
497 Ga0436365_0193778 3300039437 Bacteria 999
498 Ga0436365_0308916 3300039437 Bacteria 9769
499 Ga0436365_0606497 3300039437 Bacteria 1373
500 Ga0436365_0982785 3300039437 Bacteria 28509
501 Ga0436365_1291084 3300039437 Bacteria 167262
502 Ga0436360_0385609 3300039438 Bacteria 1035
503 Ga0436360_0553989 3300039438 Bacteria 1239
504 Ga0436360_0906325 3300039438 Bacteria 1572
505 Ga0436361_0018378 3300039447 Bacteria 535
506 Ga0436361_0106800 3300039447 Bacteria 664
507 Ga0436361_0157546 3300039447 Bacteria 1408
508 Ga0436361_0647200 3300039447 Bacteria 1041
509 Ga0436361_0687573 3300039447 Bacteria 896
510 Ga0436361_0764950 3300039447 Bacteria 2443
511 Ga0436361_0829388 3300039447 Bacteria 8428
512 Ga0436361_0950603 3300039447 Bacteria 2977
513 Ga0436363_1184338 3300039450 Bacteria 22162
514 Ga0436363_1287632 3300039450 Bacteria 1511
515 Ga0436362_0031048 3300039453 Bacteria 2067
516 Ga0436362_0076139 3300039453 Bacteria 958
517 Ga0436362_1154232 3300039453 Bacteria 698
518 Ga0439446_0098379 3300042156 Bacteria 923
519 Ga0439464_0063777 3300042439 Bacteria 1082
520 Ga0453684_0000006 3300044712 Bacteria 1364191
521 Ga0453684_0000410 3300044712 Bacteria 175627
522 Ga0466957_0327983 3300044842 Bacteria 1034
523 Ga0466958_0145466 3300045836 Bacteria 1494
524 Ga0466967_0254369 3300045976 Bacteria 1679
525 Ga0466967_0653669 3300045976 Bacteria 1040
526 Ga0495592_0356207 3300046454 Bacteria 937
527 Ga0495580_0022060 3300046472 Bacteria 4692
528 Ga0495580_0362947 3300046472 Bacteria 980
529 Ga0495580_0496426 3300046472 Bacteria 815
530 Ga0495582_0005935 3300046473 Bacteria 6809
531 Ga0495582_0401121 3300046473 Bacteria 791
532 Ga0495662_0330768 3300046476 Bacteria 749
533 Ga0495664_0112737 3300046477 Bacteria 1642
534 Ga0495664_0212227 3300046477 Bacteria 1172
535 Ga0495664_0284403 3300046477 Bacteria 999
536 Ga0495628_0210658 3300046516 Bacteria 1462
537 Ga0495630_0469358 3300046517 Bacteria 965
538 Ga0495652_0153912 3300046529 Bacteria 1793
539 Ga0495652_0173490 3300046529 Bacteria 1662
540 Ga0495665_0069877 3300046531 Bacteria 1851
541 Ga0495621_0085484 3300046539 Bacteria 1182
542 Ga0495645_0044951 3300046543 Bacteria 3221
543 Ga0495645_0118450 3300046543 Bacteria 1867
544 Ga0495622_0002990 3300046557 Bacteria 8035
545 Ga0495647_0177328 3300046681 Bacteria 926
546 Ga0495658_0000415 3300046683 Bacteria 23946
547 Ga0495669_0188591 3300046684 Bacteria 984
548 Ga0495613_0203206 3300046689 Bacteria 1396
549 Ga0495671_0176808 3300046692 Bacteria 1037
550 Ga0495600_0403655 3300046809 Bacteria 850
551 Ga0495600_0412797 3300046809 Bacteria 839
552 Ga0495672_0271063 3300047320 Bacteria 815
553 Ga0495675_0072141 3300047444 Bacteria 2179
554 Ga0495602_0024171 3300048088 Bacteria 5899
555 Ga0496106_0294308 3300048909 Bacteria 1302
556 Ga0496120_0136847 3300048923 Bacteria 1248
557 Ga0496121_0000154 3300048924 Bacteria 150013
558 Ga0496126_0001104 3300048929 Bacteria 45291
559 Ga0496126_0057975 3300048929 Bacteria 3493
560 Ga0495682_0038380 3300049460 Bacteria 1760
561 Ga0501031_0003581 3300049568 Bacteria 9989
562 Ga0501032_0011974 3300049569 Bacteria 6211
563 Ga0501032_0055900 3300049569 Bacteria 2654
564 Ga0501032_0150963 3300049569 Bacteria 1528
565 Ga0501032_0258564 3300049569 Bacteria 1129
566 Ga0501033_0019688 3300049570 Bacteria 5100
567 Ga0501033_0024361 3300049570 Bacteria 4566
568 Ga0501033_0024604 3300049570 Bacteria 4541
569 Ga0501033_0045401 3300049570 Bacteria 3270
570 Ga0501033_0074198 3300049570 Bacteria 2497
571 Ga0501033_0089680 3300049570 Bacteria 2249
572 Ga0501033_0093553 3300049570 Bacteria 2198
573 Ga0501033_0121976 3300049570 Bacteria 1891
574 Ga0501033_0169487 3300049570 Bacteria 1568
575 Ga0501034_0019438 3300049571 Bacteria 6948
576 Ga0501034_0067469 3300049571 Bacteria 3590
577 Ga0501034_0117501 3300049571 Bacteria 2647
578 Ga0501034_0227400 3300049571 Bacteria 1816
579 Ga0501034_0325872 3300049571 Bacteria 1468
580 Ga0501034_0333949 3300049571 Bacteria 1447
581 Ga0501034_0392461 3300049571 Bacteria 1312
582 Ga0501036_0013630 3300049572 Bacteria 6758
583 Ga0501036_0046458 3300049572 Bacteria 3677
584 Ga0501037_0024061 3300049573 Bacteria 4503
585 Ga0501037_0038370 3300049573 Bacteria 3529
586 Ga0501037_0275275 3300049573 Bacteria 1174
587 Ga0501037_0310201 3300049573 Bacteria 1094
588 Ga0501037_0312012 3300049573 Bacteria 1090
589 Ga0501037_0399467 3300049573 Bacteria 943
590 Ga0501037_0561452 3300049573 Bacteria 769
591 Ga0501038_0119239 3300049574 Bacteria 2178
592 Ga0501038_0124114 3300049574 Bacteria 2126
593 Ga0501038_0130457 3300049574 Bacteria 2064
594 Ga0501038_0206322 3300049574 Bacteria 1575
595 Ga0501039_0012551 3300049575 Bacteria 6471
596 Ga0501039_0210885 3300049575 Bacteria 1528
597 Ga0501039_0793787 3300049575 Bacteria 739
598 Ga0501042_0032711 3300049578 Bacteria 3683
599 Ga0501042_0397908 3300049578 Bacteria 998
600 Ga0501043_0028653 3300049579 Bacteria 4371
601 Ga0501043_0037134 3300049579 Bacteria 3832
602 Ga0501043_0045214 3300049579 Bacteria 3463
603 Ga0501043_0111974 3300049579 Bacteria 2143
604 Ga0501043_0121004 3300049579 Bacteria 2053
605 Ga0501043_0141740 3300049579 Bacteria 1882
606 Ga0501043_0143809 3300049579 Bacteria 1867
607 Ga0501046_0002562 3300049580 Bacteria 17013
608 Ga0501046_0014573 3300049580 Bacteria 6627
609 Ga0501046_0040290 3300049580 Bacteria 3734
610 Ga0501046_0044234 3300049580 Bacteria 3542
611 Ga0501046_0179595 3300049580 Bacteria 1583
612 Ga0501047_0002943 3300049581 Bacteria 16145
613 Ga0501047_0004907 3300049581 Bacteria 12563
614 Ga0501047_0009478 3300049581 Bacteria 9199
615 Ga0501047_0009629 3300049581 Bacteria 9135
616 Ga0501047_0032360 3300049581 Bacteria 5048
617 Ga0501047_0037093 3300049581 Bacteria 4712
618 Ga0501047_0089165 3300049581 Bacteria 2962
619 Ga0501047_0170499 3300049581 Bacteria 2045
620 Ga0501047_0252181 3300049581 Bacteria 1613
621 Ga0501047_0258296 3300049581 Bacteria 1590
622 Ga0501047_0286784 3300049581 Bacteria 1490
623 Ga0501047_0314612 3300049581 Bacteria 1406
624 Ga0501047_0584876 3300049581 Bacteria 939
625 Ga0501048_0023710 3300049582 Bacteria 4481
626 Ga0501048_0397940 3300049582 Bacteria 984
627 Ga0501048_0575269 3300049582 Bacteria 808
628 Ga0501067_0001612 3300049583 Bacteria 12353
629 Ga0501067_0011618 3300049583 Bacteria 4876
630 Ga0501067_0015267 3300049583 Bacteria 4251
631 Ga0501069_0015193 3300049585 Bacteria 4126
632 Ga0501069_0016664 3300049585 Bacteria 3949
633 Ga0501070_0002763 3300049586 Bacteria 15316
634 Ga0501070_0039926 3300049586 Bacteria 3914
635 Ga0501070_0075317 3300049586 Bacteria 2794
636 Ga0501070_0120164 3300049586 Bacteria 2171
637 Ga0501070_0166774 3300049586 Bacteria 1815
638 Ga0501070_0221410 3300049586 Bacteria 1552
639 Ga0501071_0066497 3300049587 Bacteria 2620
640 Ga0501071_0196002 3300049587 Bacteria 1516
641 Ga0501072_0020816 3300049588 Bacteria 5083
642 Ga0501072_0029107 3300049588 Bacteria 4312
643 Ga0501072_0231434 3300049588 Bacteria 1472
644 Ga0501073_0002197 3300049589 Bacteria 14601
645 Ga0501073_0006683 3300049589 Bacteria 8587
646 Ga0501073_0263526 3300049589 Bacteria 1189
647 Ga0501073_0264951 3300049589 Bacteria 1186
648 Ga0501073_0472860 3300049589 Bacteria 866
649 Ga0501074_0003734 3300049590 Bacteria 10812
650 Ga0501075_0116205 3300049591 Bacteria 2034
651 Ga0501076_0064285 3300049592 Bacteria 2924
652 Ga0501076_0209089 3300049592 Bacteria 1594
653 Ga0501076_0669512 3300049592 Bacteria 857
654 Ga0501079_0010441 3300049741 Bacteria 7059
655 Ga0501079_0041411 3300049741 Bacteria 3555
656 Ga0501080_0002883 3300049742 Bacteria 15123
657 Ga0501080_0033031 3300049742 Bacteria 4828
658 Ga0501080_0076339 3300049742 Bacteria 3117
659 Ga0501080_0292540 3300049742 Bacteria 1479
660 Ga0501080_0491288 3300049742 Bacteria 1098
661 Ga0501080_0737252 3300049742 Bacteria 867
662 Ga0501080_0773936 3300049742 Bacteria 843
663 Ga0501080_0969471 3300049742 Bacteria 738
664 Ga0501083_0005960 3300049744 Bacteria 8628
665 Ga0501083_0157494 3300049744 Bacteria 1486
666 Ga0501035_0030048 3300049822 Bacteria 4955
667 Ga0501035_0044913 3300049822 Bacteria 3976
668 Ga0501035_0065312 3300049822 Bacteria 3232
669 Ga0501035_0066136 3300049822 Bacteria 3208
670 Ga0501035_0089875 3300049822 Bacteria 2704
671 Ga0501035_0141930 3300049822 Bacteria 2088
672 Ga0501035_0169065 3300049822 Bacteria 1889
673 Ga0501035_0185270 3300049822 Bacteria 1792
674 Ga0501035_0255660 3300049822 Bacteria 1486
675 Ga0501035_0500650 3300049822 Bacteria 1000
676 Ga0501044_0003661 3300049823 Bacteria 17289
677 Ga0501044_0025682 3300049823 Bacteria 6244
678 Ga0501044_0045945 3300049823 Bacteria 4523
679 Ga0501044_0057848 3300049823 Bacteria 3977
680 Ga0501044_0127704 3300049823 Bacteria 2539
681 Ga0501044_0149757 3300049823 Bacteria 2316
682 Ga0501044_0154106 3300049823 Bacteria 2278
683 Ga0501044_0190249 3300049823 Bacteria 2015
684 Ga0501044_0285031 3300049823 Bacteria 1584
685 Ga0501044_0404448 3300049823 Bacteria 1277
686 Ga0501044_0956262 3300049823 Bacteria 730
687 nmdc:mga0qj67_212823_c1 3300050509 Bacteria 1569
688 nmdc:mga08y16_312326_c1 3300050511 Bacteria 1619
689 Ga0495619_0254768 3300053085 Bacteria 1216
690 Ga0500643_000027 3300053087 Bacteria 251062
691 Ga0500595_004900 3300053119 Bacteria 5921
692 Ga0500595_048945 3300053119 Bacteria 1318
693 Ga0500614_078905 3300053123 Bacteria 918
694 Ga0500642_0037868 3300053130 Bacteria 2064
695 Ga0500655_001037 3300053133 Bacteria 5364
696 Ga0500559_0006453 3300053136 Bacteria 5298
697 Ga0500559_0054652 3300053136 Bacteria 1769
698 Ga0500568_0037697 3300053139 Bacteria 1960
699 Ga0500573_0000032 3300053140 Bacteria 131098
700 Ga0500577_0076821 3300053142 Bacteria 1323
701 Ga0500619_005322 3300053154 Bacteria 2859
702 Ga0500639_154325 3300053163 Bacteria 1054
703 Ga0500645_047516 3300053730 Bacteria 1258
704 Ga0501084_0000971 3300054114 Bacteria 22218
705 Ga0501084_0008855 3300054114 Bacteria 8331
706 Ga0501084_0012790 3300054114 Bacteria 6953
707 Ga0501084_0015332 3300054114 Bacteria 6355
708 Ga0501082_0004104 3300060353 Bacteria 12719
709 Ga0501082_0050277 3300060353 Bacteria 3595
710 Ga0501082_0132765 3300060353 Bacteria 2160
711 Ga0501082_0841200 3300060353 Bacteria 803
712 Ga0530510_0203973 3300061734 Bacteria 1469

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_018790 Ga0400483_018790_31_534 157
2 3300031903 Ga0307407_10238747 Ga0307407_102387473 163
3 3300039447 Ga0436361_0018378 Ga0436361_0018378_17_520 164
4 3300046476 Ga0495662_0330768 Ga0495662_0330768_95_601 165
5 3300005327 Ga0070658_10300450 Ga0070658_103004502 166
6 3300025909 Ga0207705_10246891 Ga0207705_102468912 166
7 3300005937 Ga0081455_10215516 Ga0081455_102155162 172
8 3300025919 Ga0207657_10261848 Ga0207657_102618482 174
9 3300036647 Ga0316582_0246670 Ga0316582_0246670_174_767 174
10 3300005436 Ga0070713_100289753 Ga0070713_1002897531 175
11 3300005471 Ga0070698_100005421 Ga0070698_1000054219 175
12 3300005518 Ga0070699_100364519 Ga0070699_1003645191 175
13 3300006028 Ga0070717_10004979 Ga0070717_100049793 175
14 3300025928 Ga0207700_10190330 Ga0207700_101903303 175
15 3300005327 Ga0070658_10819072 Ga0070658_108190721 176
16 3300009545 Ga0105237_10159778 Ga0105237_101597782 176
17 3300009551 Ga0105238_10083039 Ga0105238_100830392 176
18 3300025292 Ga0209676_1000269 Ga0209676_1000269106 176
19 3300025298 Ga0209050_1014548 Ga0209050_10145483 176
20 3300025911 Ga0207654_10232511 Ga0207654_102325112 176
21 3300025924 Ga0207694_10176022 Ga0207694_101760222 176
22 3300026041 Ga0207639_10078708 Ga0207639_100787082 176
23 3300026116 Ga0207674_10641198 Ga0207674_106411982 176
24 3300031249 Ga0265339_10013056 Ga0265339_100130564 176
25 3300031250 Ga0265331_10011826 Ga0265331_100118262 176
26 3300037312 Ga0395899_0446136 Ga0395899_0446136_189_779 176
27 3300037418 Ga0395900_0064337 Ga0395900_0064337_1070_1660 176
28 3300037466 Ga0395898_0054844 Ga0395898_0054844_2765_3355 176
29 3300038443 Ga0395901_0029255 Ga0395901_0029255_2480_3070 176
30 3300048088 Ga0495602_0024171 Ga0495602_0024171_1952_2542 176
31 3300006177 Ga0075362_10019412 Ga0075362_100194122 177
32 3300013100 Ga0157373_10491860 Ga0157373_104918601 177
33 3300026118 Ga0207675_100730070 Ga0207675_1007300702 177
34 3300005458 Ga0070681_10227662 Ga0070681_102276622 178
35 3300005530 Ga0070679_100431881 Ga0070679_1004318812 178
36 3300025912 Ga0207707_10188997 Ga0207707_101889972 178
37 3300025917 Ga0207660_10300920 Ga0207660_103009201 178
38 3300005436 Ga0070713_100025897 Ga0070713_1000258975 179
39 3300005437 Ga0070710_10006054 Ga0070710_100060543 179
40 3300005439 Ga0070711_100444418 Ga0070711_1004444182 179
41 3300006028 Ga0070717_10002736 Ga0070717_100027363 179
42 3300021361 Ga0213872_10098369 Ga0213872_100983693 179
43 3300021384 Ga0213876_10222275 Ga0213876_102222751 179
44 3300025915 Ga0207693_10000809 Ga0207693_1000080927 179
45 3300039437 Ga0436365_0072725 Ga0436365_0072725_12_593 179
46 3300039437 Ga0436365_0606497 Ga0436365_0606497_15_605 179
47 3300039438 Ga0436360_0906325 Ga0436360_0906325_131_712 179
48 3300039447 Ga0436361_0106800 Ga0436361_0106800_51_632 179
49 3300039447 Ga0436361_0764950 Ga0436361_0764950_1193_1774 179
50 3300039447 Ga0436361_0950603 Ga0436361_0950603_1810_2391 179
51 3300039453 Ga0436362_0076139 Ga0436362_0076139_322_903 179
52 3300039453 Ga0436362_1154232 Ga0436362_1154232_40_621 179
53 3300021441 Ga0213871_10079436 Ga0213871_100794362 180
54 3300039438 Ga0436360_0553989 Ga0436360_0553989_240_821 180
55 3300039447 Ga0436361_0687573 Ga0436361_0687573_147_728 180
56 3300007788 Ga0099795_10003494 Ga0099795_100034943 181
57 3300039437 Ga0436365_0193778 Ga0436365_0193778_343_924 181
58 3300039447 Ga0436361_0157546 Ga0436361_0157546_485_1066 181
59 3300039447 Ga0436361_0647200 Ga0436361_0647200_290_871 181
60 3300049570 Ga0501033_0024361 Ga0501033_0024361_706_1302 181
61 3300049571 Ga0501034_0333949 Ga0501034_0333949_471_1067 181
62 3300021384 Ga0213876_10011629 Ga0213876_100116292 182
63 3300039437 Ga0436365_0308916 Ga0436365_0308916_3102_3683 182
64 3300039453 Ga0436362_0031048 Ga0436362_0031048_1392_1973 182
65 3300014325 Ga0163163_10048632 Ga0163163_100486323 185
66 3300028573 Ga0265334_10000673 Ga0265334_100006736 185
67 3300028800 Ga0265338_10033971 Ga0265338_100339713 185
68 3300031241 Ga0265325_10251623 Ga0265325_102516231 185
69 3300031344 Ga0265316_10305331 Ga0265316_103053312 185
70 3300031595 Ga0265313_10060491 Ga0265313_100604913 185
71 3300039447 Ga0436361_0829388 Ga0436361_0829388_6205_6798 185
72 3300005458 Ga0070681_10746889 Ga0070681_107468892 186
73 3300035695 Ga0373927_0016671 Ga0373927_0016671_301_894 186
74 3300037068 Ga0373925_0124627 Ga0373925_0124627_1307_1900 186
75 3300046681 Ga0495647_0177328 Ga0495647_0177328_19_612 186
76 3300025949 Ga0207667_10089940 Ga0207667_100899402 187
77 3300035695 Ga0373927_0656051 Ga0373927_0656051_52_639 187
78 3300005327 Ga0070658_10489405 Ga0070658_104894051 188
79 3300005336 Ga0070680_100062010 Ga0070680_1000620103 188
80 3300005458 Ga0070681_10249613 Ga0070681_102496132 188
81 3300005458 Ga0070681_10279598 Ga0070681_102795982 188
82 3300005530 Ga0070679_100024189 Ga0070679_1000241894 188
83 3300005563 Ga0068855_100030598 Ga0068855_1000305987 188
84 3300005577 Ga0068857_100103816 Ga0068857_1001038162 188
85 3300005578 Ga0068854_100294821 Ga0068854_1002948211 188
86 3300009093 Ga0105240_10021384 Ga0105240_100213849 188
87 3300009093 Ga0105240_10362552 Ga0105240_103625522 188
88 3300013104 Ga0157370_10046667 Ga0157370_100466674 188
89 3300025912 Ga0207707_10024954 Ga0207707_100249544 188
90 3300025913 Ga0207695_10178394 Ga0207695_101783942 188
91 3300025913 Ga0207695_10267290 Ga0207695_102672902 188
92 3300025917 Ga0207660_10051588 Ga0207660_100515882 188
93 3300025921 Ga0207652_10276272 Ga0207652_102762722 188
94 3300025932 Ga0207690_10006072 Ga0207690_100060726 188
95 3300025949 Ga0207667_10183552 Ga0207667_101835523 188
96 3300026088 Ga0207641_10509611 Ga0207641_105096111 188
97 3300026116 Ga0207674_10243964 Ga0207674_102439642 188
98 3300049568 Ga0501031_0003581 Ga0501031_0003581_6043_6636 188
99 3300049569 Ga0501032_0011974 Ga0501032_0011974_3794_4387 188
100 3300049570 Ga0501033_0024604 Ga0501033_0024604_1235_1828 188
101 3300049571 Ga0501034_0019438 Ga0501034_0019438_1990_2583 188
102 3300049572 Ga0501036_0013630 Ga0501036_0013630_3374_3967 188
103 3300049573 Ga0501037_0024061 Ga0501037_0024061_1825_2418 188
104 3300049574 Ga0501038_0124114 Ga0501038_0124114_615_1208 188
105 3300049575 Ga0501039_0012551 Ga0501039_0012551_3088_3681 188
106 3300049578 Ga0501042_0032711 Ga0501042_0032711_1938_2531 188
107 3300049579 Ga0501043_0037134 Ga0501043_0037134_2638_3231 188
108 3300049580 Ga0501046_0002562 Ga0501046_0002562_10796_11389 188
109 3300049581 Ga0501047_0009478 Ga0501047_0009478_6072_6665 188
110 3300049582 Ga0501048_0023710 Ga0501048_0023710_2526_3119 188
111 3300049583 Ga0501067_0001612 Ga0501067_0001612_8983_9576 188
112 3300049585 Ga0501069_0015193 Ga0501069_0015193_1687_2280 188
113 3300049586 Ga0501070_0002763 Ga0501070_0002763_13014_13607 188
114 3300049587 Ga0501071_0066497 Ga0501071_0066497_1056_1649 188
115 3300049588 Ga0501072_0029107 Ga0501072_0029107_2255_2848 188
116 3300049589 Ga0501073_0002197 Ga0501073_0002197_4731_5324 188
117 3300049590 Ga0501074_0003734 Ga0501074_0003734_5407_6000 188
118 3300049592 Ga0501076_0064285 Ga0501076_0064285_745_1338 188
119 3300049741 Ga0501079_0010441 Ga0501079_0010441_3377_3970 188
120 3300049742 Ga0501080_0033031 Ga0501080_0033031_2334_2927 188
121 3300049744 Ga0501083_0005960 Ga0501083_0005960_6244_6837 188
122 3300049822 Ga0501035_0066136 Ga0501035_0066136_1825_2418 188
123 3300049823 Ga0501044_0057848 Ga0501044_0057848_1560_2153 188
124 3300054114 Ga0501084_0008855 Ga0501084_0008855_5314_5907 188
125 3300060353 Ga0501082_0004104 Ga0501082_0004104_3036_3629 188
126 3300025929 Ga0207664_10300089 Ga0207664_103000892 189
127 3300046543 Ga0495645_0118450 Ga0495645_0118450_476_1057 189
128 3300005327 Ga0070658_10413174 Ga0070658_104131742 190
129 3300005577 Ga0068857_100192559 Ga0068857_1001925592 190
130 3300013105 Ga0157369_10118610 Ga0157369_101186102 190
131 3300014968 Ga0157379_11038885 Ga0157379_110388852 190
132 3300025919 Ga0207657_10628821 Ga0207657_106288212 190
133 3300025932 Ga0207690_10272772 Ga0207690_102727723 190
134 3300026116 Ga0207674_10116115 Ga0207674_101161154 190
135 3300037418 Ga0395900_0854836 Ga0395900_0854836_84_695 190
136 3300049581 Ga0501047_0286784 Ga0501047_0286784_260_847 190
137 3300049823 Ga0501044_0285031 Ga0501044_0285031_640_1227 190
138 iso_pu_bacteria 2840878972 2840881304 190
139 3300005435 Ga0070714_100078148 Ga0070714_1000781482 191
140 3300021388 Ga0213875_10000911 Ga0213875_100009116 191
141 3300037853 Ga0436364_0220830 Ga0436364_0220830_1203_1784 191
142 3300037853 Ga0436364_0259249 Ga0436364_0259249_48691_49272 191
143 3300045836 Ga0466958_0145466 Ga0466958_0145466_358_966 191
144 3300049573 Ga0501037_0561452 Ga0501037_0561452_58_648 191
145 3300049744 Ga0501083_0157494 Ga0501083_0157494_872_1453 191
146 3300049822 Ga0501035_0185270 Ga0501035_0185270_543_1133 191
147 3300005336 Ga0070680_100401604 Ga0070680_1004016041 192
148 3300005518 Ga0070699_100337014 Ga0070699_1003370143 192
149 3300005530 Ga0070679_100005993 Ga0070679_1000059934 192
150 3300013104 Ga0157370_10038939 Ga0157370_100389392 192
151 3300021384 Ga0213876_10000322 Ga0213876_1000032239 193
152 3300028577 Ga0265318_10028719 Ga0265318_100287193 193
153 3300031235 Ga0265330_10054655 Ga0265330_100546551 193
154 3300031235 Ga0265330_10061366 Ga0265330_100613663 193
155 3300031235 Ga0265330_10131524 Ga0265330_101315241 193
156 3300031235 Ga0265330_10215028 Ga0265330_102150282 193
157 3300031240 Ga0265320_10022145 Ga0265320_100221453 193
158 3300031241 Ga0265325_10023835 Ga0265325_100238352 193
159 3300031241 Ga0265325_10186837 Ga0265325_101868371 193
160 3300031247 Ga0265340_10000356 Ga0265340_1000035629 193
161 3300031247 Ga0265340_10001813 Ga0265340_1000181313 193
162 3300031247 Ga0265340_10060346 Ga0265340_100603463 193
163 3300031247 Ga0265340_10133856 Ga0265340_101338561 193
164 3300031249 Ga0265339_10006481 Ga0265339_100064817 193
165 3300031249 Ga0265339_10170076 Ga0265339_101700762 193
166 3300031344 Ga0265316_10003516 Ga0265316_1000351618 193
167 3300031344 Ga0265316_10176558 Ga0265316_101765582 193
168 3300031595 Ga0265313_10001836 Ga0265313_1000183618 193
169 3300031595 Ga0265313_10142954 Ga0265313_101429542 193
170 3300031711 Ga0265314_10001319 Ga0265314_1000131912 193
171 3300031711 Ga0265314_10002354 Ga0265314_1000235414 193
172 3300031711 Ga0265314_10039342 Ga0265314_100393425 193
173 3300031711 Ga0265314_10100146 Ga0265314_101001462 193
174 3300031712 Ga0265342_10007269 Ga0265342_100072693 193
175 3300031712 Ga0265342_10018188 Ga0265342_100181882 193
176 3300031712 Ga0265342_10230315 Ga0265342_102303151 193
177 3300031712 Ga0265342_10252024 Ga0265342_102520242 193
178 3300032004 Ga0307414_10425634 Ga0307414_104256343 193
179 3300032005 Ga0307411_10522838 Ga0307411_105228382 193
180 3300039437 Ga0436365_0173471 Ga0436365_0173471_99812_100402 193
181 3300046473 Ga0495582_0401121 Ga0495582_0401121_169_762 193
182 3300046531 Ga0495665_0069877 Ga0495665_0069877_1147_1740 193
183 3300049570 Ga0501033_0045401 Ga0501033_0045401_2017_2598 193
184 3300049573 Ga0501037_0275275 Ga0501037_0275275_327_992 193
185 3300049573 Ga0501037_0312012 Ga0501037_0312012_420_1013 193
186 iso_pu_bacteria 2838029111 2838034324 193
187 iso_pu_bacteria 2842475841 2842481070 193
188 iso_pu_bacteria 2842502639 2842507798 193
189 3300005548 Ga0070665_100134188 Ga0070665_1001341882 194
190 3300005614 Ga0068856_100467004 Ga0068856_1004670042 194
191 3300005981 Ga0081538_10028741 Ga0081538_100287413 194
192 3300009551 Ga0105238_11060011 Ga0105238_110600112 194
193 3300039062 Ga0400483_211285 Ga0400483_211285_1013_1606 194
194 3300044712 Ga0453684_0000006 Ga0453684_0000006_58694_59287 194
195 3300044712 Ga0453684_0000410 Ga0453684_0000410_34616_35209 194
196 3300049579 Ga0501043_0121004 Ga0501043_0121004_24_617 194
197 3300049582 Ga0501048_0397940 Ga0501048_0397940_259_873 194
198 3300049587 Ga0501071_0196002 Ga0501071_0196002_606_1220 194
199 3300049588 Ga0501072_0231434 Ga0501072_0231434_494_1108 194
200 3300049591 Ga0501075_0116205 Ga0501075_0116205_775_1389 194
201 3300049592 Ga0501076_0209089 Ga0501076_0209089_844_1458 194
202 3300049742 Ga0501080_0292540 Ga0501080_0292540_25_618 194
203 3300049823 Ga0501044_0404448 Ga0501044_0404448_664_1251 194
204 3300061734 Ga0530510_0203973 Ga0530510_0203973_211_825 194
205 3300005336 Ga0070680_100136542 Ga0070680_1001365422 195
206 3300005344 Ga0070661_100000135 Ga0070661_10000013555 195
207 3300005439 Ga0070711_100036579 Ga0070711_1000365791 195
208 3300005548 Ga0070665_100099565 Ga0070665_1000995652 195
209 3300009093 Ga0105240_10042935 Ga0105240_100429354 195
210 3300009093 Ga0105240_10081334 Ga0105240_100813343 195
211 3300009174 Ga0105241_11008583 Ga0105241_110085831 195
212 3300009545 Ga0105237_10765380 Ga0105237_107653801 195
213 3300010375 Ga0105239_10274120 Ga0105239_102741202 195
214 3300010375 Ga0105239_10594920 Ga0105239_105949202 195
215 3300010375 Ga0105239_11878927 Ga0105239_118789271 195
216 3300013104 Ga0157370_10298056 Ga0157370_102980562 195
217 3300013104 Ga0157370_10450650 Ga0157370_104506503 195
218 3300014968 Ga0157379_10241593 Ga0157379_102415931 195
219 3300025909 Ga0207705_10029374 Ga0207705_100293743 195
220 3300025913 Ga0207695_10018410 Ga0207695_100184106 195
221 3300025913 Ga0207695_10039690 Ga0207695_100396903 195
222 3300025913 Ga0207695_10072969 Ga0207695_100729694 195
223 3300025913 Ga0207695_10136383 Ga0207695_101363832 195
224 3300025915 Ga0207693_10178561 Ga0207693_101785613 195
225 3300025917 Ga0207660_10022576 Ga0207660_100225762 195
226 3300025920 Ga0207649_10000060 Ga0207649_1000006066 195
227 3300025921 Ga0207652_10023428 Ga0207652_100234282 195
228 3300025934 Ga0207686_10024090 Ga0207686_100240902 195
229 3300025938 Ga0207704_10629487 Ga0207704_106294872 195
230 3300025972 Ga0207668_11066121 Ga0207668_110661212 195
231 3300026078 Ga0207702_10419543 Ga0207702_104195432 195
232 3300031235 Ga0265330_10081018 Ga0265330_100810182 195
233 3300031241 Ga0265325_10017178 Ga0265325_100171785 195
234 3300031249 Ga0265339_10041153 Ga0265339_100411531 195
235 3300031250 Ga0265331_10025616 Ga0265331_100256162 195
236 3300031595 Ga0265313_10075295 Ga0265313_100752952 195
237 3300031711 Ga0265314_10035726 Ga0265314_100357263 195
238 3300031711 Ga0265314_10049983 Ga0265314_100499833 195
239 3300035111 Ga0373923_0208784 Ga0373923_0208784_265_864 195
240 3300035113 Ga0373936_0032915 Ga0373936_0032915_1340_1939 195
241 3300035114 Ga0373939_0008087 Ga0373939_0008087_411_1028 195
242 3300035172 Ga0373955_0072854 Ga0373955_0072854_672_1271 195
243 3300036401 Ga0373937_0000338 Ga0373937_0000338_20334_20933 195
244 3300036401 Ga0373937_0187274 Ga0373937_0187274_134_733 195
245 3300039062 Ga0400483_085364 Ga0400483_085364_119_715 195
246 3300039438 Ga0436360_0385609 Ga0436360_0385609_69_659 195
247 3300049569 Ga0501032_0150963 Ga0501032_0150963_804_1397 195
248 3300049570 Ga0501033_0019688 Ga0501033_0019688_2642_3232 195
249 3300049570 Ga0501033_0089680 Ga0501033_0089680_64_657 195
250 3300049570 Ga0501033_0093553 Ga0501033_0093553_1220_1813 195
251 3300049570 Ga0501033_0121976 Ga0501033_0121976_635_1228 195
252 3300049571 Ga0501034_0325872 Ga0501034_0325872_804_1397 195
253 3300049573 Ga0501037_0310201 Ga0501037_0310201_56_646 195
254 3300049573 Ga0501037_0399467 Ga0501037_0399467_280_873 195
255 3300049574 Ga0501038_0130457 Ga0501038_0130457_907_1500 195
256 3300049575 Ga0501039_0210885 Ga0501039_0210885_608_1201 195
257 3300049579 Ga0501043_0028653 Ga0501043_0028653_3757_4350 195
258 3300049579 Ga0501043_0045214 Ga0501043_0045214_674_1264 195
259 3300049580 Ga0501046_0014573 Ga0501046_0014573_5335_5934 195
260 3300049581 Ga0501047_0170499 Ga0501047_0170499_1186_1776 195
261 3300049581 Ga0501047_0314612 Ga0501047_0314612_80_673 195
262 3300049589 Ga0501073_0264951 Ga0501073_0264951_554_1147 195
263 3300049742 Ga0501080_0773936 Ga0501080_0773936_138_731 195
264 3300049822 Ga0501035_0044913 Ga0501035_0044913_2579_3172 195
265 3300049822 Ga0501035_0089875 Ga0501035_0089875_828_1418 195
266 3300049822 Ga0501035_0141930 Ga0501035_0141930_792_1385 195
267 3300049823 Ga0501044_0045945 Ga0501044_0045945_2814_3407 195
268 3300049823 Ga0501044_0149757 Ga0501044_0149757_396_986 195
269 3300049823 Ga0501044_0154106 Ga0501044_0154106_365_958 195
270 3300053085 Ga0495619_0254768 Ga0495619_0254768_494_1093 195
271 3300053163 Ga0500639_154325 Ga0500639_154325_63_650 195
272 3300003214 JGI25165J46597_1000080 JGI25165J46597_100008032 196
273 3300003215 JGI25153J46596_10000812 JGI25153J46596_1000081218 196
274 3300005327 Ga0070658_10002534 Ga0070658_1000253413 196
275 3300005328 Ga0070676_10089400 Ga0070676_100894002 196
276 3300005329 Ga0070683_100208029 Ga0070683_1002080294 196
277 3300005330 Ga0070690_100146593 Ga0070690_1001465933 196
278 3300005334 Ga0068869_100176857 Ga0068869_1001768573 196
279 3300005334 Ga0068869_100187227 Ga0068869_1001872271 196
280 3300005336 Ga0070680_100000332 Ga0070680_1000003323 196
281 3300005338 Ga0068868_100556110 Ga0068868_1005561101 196
282 3300005338 Ga0068868_100962811 Ga0068868_1009628111 196
283 3300005339 Ga0070660_100086353 Ga0070660_1000863532 196
284 3300005340 Ga0070689_101072836 Ga0070689_1010728361 196
285 3300005341 Ga0070691_10137849 Ga0070691_101378491 196
286 3300005344 Ga0070661_100022011 Ga0070661_1000220118 196
287 3300005344 Ga0070661_100292728 Ga0070661_1002927282 196
288 3300005354 Ga0070675_100087059 Ga0070675_1000870593 196
289 3300005354 Ga0070675_100223448 Ga0070675_1002234482 196
290 3300005355 Ga0070671_100217559 Ga0070671_1002175592 196
291 3300005355 Ga0070671_100802032 Ga0070671_1008020322 196
292 3300005356 Ga0070674_100181571 Ga0070674_1001815712 196
293 3300005356 Ga0070674_100446990 Ga0070674_1004469902 196
294 3300005356 Ga0070674_100897353 Ga0070674_1008973531 196
295 3300005364 Ga0070673_100109977 Ga0070673_1001099772 196
296 3300005364 Ga0070673_100116003 Ga0070673_1001160031 196
297 3300005364 Ga0070673_100253767 Ga0070673_1002537672 196
298 3300005367 Ga0070667_100047937 Ga0070667_1000479372 196
299 3300005367 Ga0070667_100083406 Ga0070667_1000834063 196
300 3300005435 Ga0070714_100098978 Ga0070714_1000989782 196
301 3300005435 Ga0070714_100571097 Ga0070714_1005710972 196
302 3300005439 Ga0070711_100204462 Ga0070711_1002044621 196
303 3300005456 Ga0070678_100002862 Ga0070678_1000028623 196
304 3300005456 Ga0070678_100016293 Ga0070678_1000162934 196
305 3300005456 Ga0070678_100019805 Ga0070678_1000198055 196
306 3300005456 Ga0070678_100079469 Ga0070678_1000794692 196
307 3300005456 Ga0070678_100141932 Ga0070678_1001419324 196
308 3300005458 Ga0070681_10000123 Ga0070681_100001233 196
309 3300005458 Ga0070681_10055003 Ga0070681_100550031 196
310 3300005468 Ga0070707_100062475 Ga0070707_1000624751 196
311 3300005471 Ga0070698_100137307 Ga0070698_1001373073 196
312 3300005518 Ga0070699_100037090 Ga0070699_1000370905 196
313 3300005530 Ga0070679_100000490 Ga0070679_10000049037 196
314 3300005530 Ga0070679_100267901 Ga0070679_1002679013 196
315 3300005535 Ga0070684_100199581 Ga0070684_1001995813 196
316 3300005535 Ga0070684_100611340 Ga0070684_1006113401 196
317 3300005539 Ga0068853_100005091 Ga0068853_1000050914 196
318 3300005539 Ga0068853_100016798 Ga0068853_1000167984 196
319 3300005539 Ga0068853_100073378 Ga0068853_1000733784 196
320 3300005539 Ga0068853_101049883 Ga0068853_1010498831 196
321 3300005543 Ga0070672_100429844 Ga0070672_1004298441 196
322 3300005543 Ga0070672_101053026 Ga0070672_1010530261 196
323 3300005545 Ga0070695_100274511 Ga0070695_1002745112 196
324 3300005547 Ga0070693_100069882 Ga0070693_1000698822 196
325 3300005548 Ga0070665_100002457 Ga0070665_10000245724 196
326 3300005548 Ga0070665_100089174 Ga0070665_1000891745 196
327 3300005548 Ga0070665_100127884 Ga0070665_1001278842 196
328 3300005548 Ga0070665_100169252 Ga0070665_1001692522 196
329 3300005548 Ga0070665_100187834 Ga0070665_1001878342 196
330 3300005548 Ga0070665_100213620 Ga0070665_1002136201 196
331 3300005548 Ga0070665_100395431 Ga0070665_1003954312 196
332 3300005563 Ga0068855_100000529 Ga0068855_10000052936 196
333 3300005563 Ga0068855_100148589 Ga0068855_1001485892 196
334 3300005563 Ga0068855_100307750 Ga0068855_1003077502 196
335 3300005563 Ga0068855_100870463 Ga0068855_1008704631 196
336 3300005577 Ga0068857_100100352 Ga0068857_1001003522 196
337 3300005614 Ga0068856_100103164 Ga0068856_1001031642 196
338 3300005615 Ga0070702_100157769 Ga0070702_1001577692 196
339 3300005616 Ga0068852_100090814 Ga0068852_1000908143 196
340 3300005616 Ga0068852_100174582 Ga0068852_1001745822 196
341 3300005616 Ga0068852_100600280 Ga0068852_1006002801 196
342 3300005617 Ga0068859_100388566 Ga0068859_1003885662 196
343 3300005617 Ga0068859_100825594 Ga0068859_1008255942 196
344 3300005618 Ga0068864_100602615 Ga0068864_1006026152 196
345 3300005719 Ga0068861_100101094 Ga0068861_1001010942 196
346 3300005840 Ga0068870_10081587 Ga0068870_100815872 196
347 3300005841 Ga0068863_100248827 Ga0068863_1002488272 196
348 3300005842 Ga0068858_100007195 Ga0068858_1000071954 196
349 3300005842 Ga0068858_100100353 Ga0068858_1001003532 196
350 3300005843 Ga0068860_100037804 Ga0068860_1000378045 196
351 3300005843 Ga0068860_100269766 Ga0068860_1002697662 196
352 3300005843 Ga0068860_101041327 Ga0068860_1010413271 196
353 3300006028 Ga0070717_10749084 Ga0070717_107490841 196
354 3300006237 Ga0097621_100000267 Ga0097621_10000026717 196
355 3300006237 Ga0097621_100025424 Ga0097621_1000254244 196
356 3300006237 Ga0097621_100045626 Ga0097621_1000456262 196
357 3300006237 Ga0097621_100084595 Ga0097621_1000845952 196
358 3300006237 Ga0097621_100169682 Ga0097621_1001696822 196
359 3300006237 Ga0097621_100237065 Ga0097621_1002370652 196
360 3300006358 Ga0068871_100002164 Ga0068871_10000216416 196
361 3300006358 Ga0068871_100003594 Ga0068871_1000035945 196
362 3300006358 Ga0068871_100180019 Ga0068871_1001800192 196
363 3300006358 Ga0068871_100202798 Ga0068871_1002027982 196
364 3300006358 Ga0068871_100548626 Ga0068871_1005486262 196
365 3300006844 Ga0075428_100511987 Ga0075428_1005119872 196
366 3300006846 Ga0075430_100194453 Ga0075430_1001944532 196
367 3300006847 Ga0075431_100196176 Ga0075431_1001961763 196
368 3300006871 Ga0075434_100196301 Ga0075434_1001963011 196
369 3300006881 Ga0068865_100005263 Ga0068865_10000526310 196
370 3300006931 Ga0097620_100388579 Ga0097620_1003885792 196
371 3300006931 Ga0097620_100825590 Ga0097620_1008255902 196
372 3300009093 Ga0105240_10000055 Ga0105240_10000055228 196
373 3300009093 Ga0105240_10029678 Ga0105240_100296787 196
374 3300009093 Ga0105240_10116517 Ga0105240_101165172 196
375 3300009093 Ga0105240_10153807 Ga0105240_101538072 196
376 3300009093 Ga0105240_10455168 Ga0105240_104551682 196
377 3300009093 Ga0105240_10783049 Ga0105240_107830492 196
378 3300009093 Ga0105240_11055795 Ga0105240_110557952 196
379 3300009094 Ga0111539_10159125 Ga0111539_101591253 196
380 3300009094 Ga0111539_10801479 Ga0111539_108014793 196
381 3300009098 Ga0105245_10001742 Ga0105245_1000174216 196
382 3300009098 Ga0105245_10376812 Ga0105245_103768122 196
383 3300009098 Ga0105245_10444974 Ga0105245_104449742 196
384 3300009098 Ga0105245_10506287 Ga0105245_105062872 196
385 3300009098 Ga0105245_10537001 Ga0105245_105370012 196
386 3300009101 Ga0105247_10052153 Ga0105247_100521532 196
387 3300009148 Ga0105243_10042358 Ga0105243_100423583 196
388 3300009148 Ga0105243_10299509 Ga0105243_102995092 196
389 3300009174 Ga0105241_10105447 Ga0105241_101054474 196
390 3300009174 Ga0105241_10167246 Ga0105241_101672463 196
391 3300009174 Ga0105241_10642923 Ga0105241_106429232 196
392 3300009176 Ga0105242_10017460 Ga0105242_100174602 196
393 3300009176 Ga0105242_10037486 Ga0105242_100374865 196
394 3300009176 Ga0105242_10084700 Ga0105242_100847005 196
395 3300009177 Ga0105248_10000001 Ga0105248_100000011794 196
396 3300009177 Ga0105248_10049054 Ga0105248_100490542 196
397 3300009177 Ga0105248_10128292 Ga0105248_101282922 196
398 3300009545 Ga0105237_10070835 Ga0105237_100708353 196
399 3300009545 Ga0105237_10320893 Ga0105237_103208932 196
400 3300009545 Ga0105237_10395432 Ga0105237_103954322 196
401 3300009545 Ga0105237_10746619 Ga0105237_107466191 196
402 3300009551 Ga0105238_10042693 Ga0105238_100426936 196
403 3300009551 Ga0105238_10283127 Ga0105238_102831272 196
404 3300009551 Ga0105238_10560908 Ga0105238_105609082 196
405 3300009551 Ga0105238_10858050 Ga0105238_108580502 196
406 3300009551 Ga0105238_11426975 Ga0105238_114269751 196
407 3300009553 Ga0105249_10004983 Ga0105249_100049836 196
408 3300009553 Ga0105249_10180275 Ga0105249_101802752 196
409 3300010375 Ga0105239_10003373 Ga0105239_100033739 196
410 3300010375 Ga0105239_10009872 Ga0105239_100098726 196
411 3300010375 Ga0105239_10012800 Ga0105239_100128004 196
412 3300010375 Ga0105239_10456918 Ga0105239_104569182 196
413 3300011119 Ga0105246_10093243 Ga0105246_100932432 196
414 3300013100 Ga0157373_10455590 Ga0157373_104555903 196
415 3300013104 Ga0157370_10182100 Ga0157370_101821003 196
416 3300013105 Ga0157369_10012565 Ga0157369_100125656 196
417 3300013105 Ga0157369_10604210 Ga0157369_106042103 196
418 3300013296 Ga0157374_10051271 Ga0157374_100512712 196
419 3300013296 Ga0157374_10220212 Ga0157374_102202122 196
420 3300013297 Ga0157378_10088182 Ga0157378_100881824 196
421 3300013297 Ga0157378_10097732 Ga0157378_100977322 196
422 3300013297 Ga0157378_10287625 Ga0157378_102876252 196
423 3300013297 Ga0157378_10745418 Ga0157378_107454181 196
424 3300013306 Ga0163162_10008334 Ga0163162_100083345 196
425 3300013306 Ga0163162_10093293 Ga0163162_100932936 196
426 3300013306 Ga0163162_10566639 Ga0163162_105666392 196
427 3300013307 Ga0157372_10064258 Ga0157372_100642585 196
428 3300013307 Ga0157372_10159582 Ga0157372_101595822 196
429 3300013307 Ga0157372_10226351 Ga0157372_102263513 196
430 3300013308 Ga0157375_10173971 Ga0157375_101739711 196
431 3300013308 Ga0157375_10174265 Ga0157375_101742652 196
432 3300013308 Ga0157375_10893451 Ga0157375_108934512 196
433 3300013308 Ga0157375_11072178 Ga0157375_110721782 196
434 3300014325 Ga0163163_10000021 Ga0163163_10000021134 196
435 3300014325 Ga0163163_10077632 Ga0163163_100776326 196
436 3300014325 Ga0163163_10301609 Ga0163163_103016091 196
437 3300014325 Ga0163163_10439617 Ga0163163_104396172 196
438 3300014326 Ga0157380_10757972 Ga0157380_107579722 196
439 3300014745 Ga0157377_10144416 Ga0157377_101444162 196
440 3300014968 Ga0157379_10000304 Ga0157379_1000030427 196
441 3300014968 Ga0157379_10003277 Ga0157379_100032775 196
442 3300014968 Ga0157379_10162175 Ga0157379_101621754 196
443 3300014969 Ga0157376_10340468 Ga0157376_103404683 196
444 3300014969 Ga0157376_11148654 Ga0157376_111486541 196
445 3300017792 Ga0163161_10325510 Ga0163161_103255102 196
446 3300021377 Ga0213874_10001161 Ga0213874_100011616 196
447 3300021377 Ga0213874_10038817 Ga0213874_100388172 196
448 3300021384 Ga0213876_10000167 Ga0213876_1000016761 196
449 3300021384 Ga0213876_10141117 Ga0213876_101411172 196
450 3300025261 Ga0209233_1000006 Ga0209233_1000006827 196
451 3300025261 Ga0209233_1043971 Ga0209233_10439712 196
452 3300025297 Ga0209758_1000008 Ga0209758_1000008116 196
453 3300025900 Ga0207710_10026810 Ga0207710_100268102 196
454 3300025901 Ga0207688_10261151 Ga0207688_102611512 196
455 3300025909 Ga0207705_10004807 Ga0207705_100048079 196
456 3300025911 Ga0207654_10017205 Ga0207654_100172053 196
457 3300025911 Ga0207654_10025054 Ga0207654_100250542 196
458 3300025911 Ga0207654_10100203 Ga0207654_101002032 196
459 3300025911 Ga0207654_10116673 Ga0207654_101166733 196
460 3300025911 Ga0207654_10135096 Ga0207654_101350962 196
461 3300025911 Ga0207654_10281859 Ga0207654_102818592 196
462 3300025912 Ga0207707_10000002 Ga0207707_1000000263 196
463 3300025912 Ga0207707_10036197 Ga0207707_100361972 196
464 3300025913 Ga0207695_10000012 Ga0207695_10000012109 196
465 3300025913 Ga0207695_10021214 Ga0207695_100212142 196
466 3300025913 Ga0207695_10106427 Ga0207695_101064272 196
467 3300025913 Ga0207695_10263480 Ga0207695_102634802 196
468 3300025916 Ga0207663_10143965 Ga0207663_101439653 196
469 3300025917 Ga0207660_10001154 Ga0207660_100011543 196
470 3300025919 Ga0207657_10006097 Ga0207657_100060979 196
471 3300025919 Ga0207657_10051133 Ga0207657_100511335 196
472 3300025920 Ga0207649_10241976 Ga0207649_102419762 196
473 3300025920 Ga0207649_10960649 Ga0207649_109606491 196
474 3300025921 Ga0207652_10000197 Ga0207652_1000019741 196
475 3300025921 Ga0207652_10086100 Ga0207652_100861002 196
476 3300025922 Ga0207646_10076216 Ga0207646_100762163 196
477 3300025924 Ga0207694_10000006 Ga0207694_10000006554 196
478 3300025924 Ga0207694_10280954 Ga0207694_102809543 196
479 3300025924 Ga0207694_10552388 Ga0207694_105523882 196
480 3300025926 Ga0207659_11264604 Ga0207659_112646041 196
481 3300025927 Ga0207687_10005839 Ga0207687_100058394 196
482 3300025927 Ga0207687_10106730 Ga0207687_101067302 196
483 3300025928 Ga0207700_10098889 Ga0207700_100988892 196
484 3300025929 Ga0207664_10143490 Ga0207664_101434902 196
485 3300025934 Ga0207686_10001631 Ga0207686_1000163112 196
486 3300025934 Ga0207686_10097491 Ga0207686_100974912 196
487 3300025935 Ga0207709_10152238 Ga0207709_101522382 196
488 3300025936 Ga0207670_10498436 Ga0207670_104984361 196
489 3300025937 Ga0207669_10483504 Ga0207669_104835041 196
490 3300025938 Ga0207704_10073711 Ga0207704_100737112 196
491 3300025938 Ga0207704_10642640 Ga0207704_106426402 196
492 3300025941 Ga0207711_10000001 Ga0207711_1000000178 196
493 3300025941 Ga0207711_10134983 Ga0207711_101349832 196
494 3300025942 Ga0207689_10078008 Ga0207689_100780082 196
495 3300025942 Ga0207689_10083601 Ga0207689_100836012 196
496 3300025942 Ga0207689_10187325 Ga0207689_101873253 196
497 3300025945 Ga0207679_10349273 Ga0207679_103492732 196
498 3300025945 Ga0207679_10936697 Ga0207679_109366972 196
499 3300025949 Ga0207667_10000026 Ga0207667_10000026285 196
500 3300025949 Ga0207667_10271040 Ga0207667_102710402 196
501 3300025960 Ga0207651_10040945 Ga0207651_100409454 196
502 3300025961 Ga0207712_10084372 Ga0207712_100843724 196
503 3300025961 Ga0207712_10162925 Ga0207712_101629252 196
504 3300025961 Ga0207712_10730874 Ga0207712_107308742 196
505 3300025972 Ga0207668_11094377 Ga0207668_110943771 196
506 3300026023 Ga0207677_10066545 Ga0207677_100665451 196
507 3300026023 Ga0207677_10327066 Ga0207677_103270663 196
508 3300026023 Ga0207677_10609319 Ga0207677_106093192 196
509 3300026035 Ga0207703_10029882 Ga0207703_100298826 196
510 3300026035 Ga0207703_10069710 Ga0207703_100697104 196
511 3300026035 Ga0207703_10527624 Ga0207703_105276242 196
512 3300026041 Ga0207639_10028153 Ga0207639_100281533 196
513 3300026041 Ga0207639_10157725 Ga0207639_101577252 196
514 3300026067 Ga0207678_10418493 Ga0207678_104184931 196
515 3300026078 Ga0207702_10277503 Ga0207702_102775031 196
516 3300026088 Ga0207641_10101756 Ga0207641_101017562 196
517 3300026089 Ga0207648_10002996 Ga0207648_100029961 196
518 3300026089 Ga0207648_11230552 Ga0207648_112305521 196
519 3300026095 Ga0207676_10029076 Ga0207676_100290763 196
520 3300026095 Ga0207676_10260840 Ga0207676_102608402 196
521 3300026116 Ga0207674_10902591 Ga0207674_109025911 196
522 3300026118 Ga0207675_100102346 Ga0207675_1001023463 196
523 3300026118 Ga0207675_100143644 Ga0207675_1001436442 196
524 3300026118 Ga0207675_100702832 Ga0207675_1007028321 196
525 3300026121 Ga0207683_10004248 Ga0207683_100042482 196
526 3300026121 Ga0207683_10018865 Ga0207683_100188657 196
527 3300026121 Ga0207683_10021537 Ga0207683_100215373 196
528 3300026121 Ga0207683_10258480 Ga0207683_102584802 196
529 3300026121 Ga0207683_10871480 Ga0207683_108714802 196
530 3300026142 Ga0207698_10063956 Ga0207698_100639563 196
531 3300026142 Ga0207698_10120706 Ga0207698_101207062 196
532 3300026142 Ga0207698_10360026 Ga0207698_103600262 196
533 3300026142 Ga0207698_11009920 Ga0207698_110099202 196
534 3300027907 Ga0207428_10191342 Ga0207428_101913422 196
535 3300028379 Ga0268266_10001271 Ga0268266_100012719 196
536 3300028379 Ga0268266_10072563 Ga0268266_100725635 196
537 3300028379 Ga0268266_10100739 Ga0268266_101007392 196
538 3300028379 Ga0268266_10101684 Ga0268266_101016843 196
539 3300028379 Ga0268266_10184980 Ga0268266_101849802 196
540 3300028381 Ga0268264_10038901 Ga0268264_100389012 196
541 3300028381 Ga0268264_10136500 Ga0268264_101365002 196
542 3300028573 Ga0265334_10032497 Ga0265334_100324973 196
543 3300028577 Ga0265318_10000388 Ga0265318_1000038835 196
544 3300028800 Ga0265338_10000011 Ga0265338_10000011422 196
545 3300028800 Ga0265338_10004398 Ga0265338_100043989 196
546 3300031235 Ga0265330_10041620 Ga0265330_100416202 196
547 3300031238 Ga0265332_10004596 Ga0265332_100045965 196
548 3300031238 Ga0265332_10037781 Ga0265332_100377812 196
549 3300031239 Ga0265328_10225315 Ga0265328_102253151 196
550 3300031240 Ga0265320_10000123 Ga0265320_1000012338 196
551 3300031241 Ga0265325_10000002 Ga0265325_1000000290 196
552 3300031241 Ga0265325_10016521 Ga0265325_100165213 196
553 3300031241 Ga0265325_10040167 Ga0265325_100401673 196
554 3300031241 Ga0265325_10088185 Ga0265325_100881853 196
555 3300031242 Ga0265329_10014355 Ga0265329_100143553 196
556 3300031242 Ga0265329_10131959 Ga0265329_101319592 196
557 3300031247 Ga0265340_10026657 Ga0265340_100266572 196
558 3300031247 Ga0265340_10030321 Ga0265340_100303212 196
559 3300031247 Ga0265340_10069521 Ga0265340_100695211 196
560 3300031247 Ga0265340_10134292 Ga0265340_101342922 196
561 3300031249 Ga0265339_10002449 Ga0265339_100024496 196
562 3300031249 Ga0265339_10020986 Ga0265339_100209862 196
563 3300031249 Ga0265339_10352548 Ga0265339_103525481 196
564 3300031250 Ga0265331_10000049 Ga0265331_1000004987 196
565 3300031250 Ga0265331_10000303 Ga0265331_100003033 196
566 3300031250 Ga0265331_10001113 Ga0265331_100011138 196
567 3300031250 Ga0265331_10006811 Ga0265331_100068114 196
568 3300031250 Ga0265331_10017858 Ga0265331_100178584 196
569 3300031251 Ga0265327_10000007 Ga0265327_10000007436 196
570 3300031344 Ga0265316_10021855 Ga0265316_100218557 196
571 3300031456 Ga0307513_10272958 Ga0307513_102729583 196
572 3300031595 Ga0265313_10000689 Ga0265313_1000068914 196
573 3300031595 Ga0265313_10004096 Ga0265313_100040969 196
574 3300031595 Ga0265313_10028353 Ga0265313_100283532 196
575 3300031595 Ga0265313_10144845 Ga0265313_101448451 196
576 3300031711 Ga0265314_10008314 Ga0265314_100083145 196
577 3300031711 Ga0265314_10024900 Ga0265314_100249003 196
578 3300031711 Ga0265314_10050108 Ga0265314_100501082 196
579 3300031711 Ga0265314_10071816 Ga0265314_100718162 196
580 3300031711 Ga0265314_10079446 Ga0265314_100794463 196
581 3300031712 Ga0265342_10020762 Ga0265342_100207622 196
582 3300031712 Ga0265342_10138377 Ga0265342_101383772 196
583 3300031712 Ga0265342_10269151 Ga0265342_102691512 196
584 3300031730 Ga0307516_10015652 Ga0307516_100156525 196
585 3300031730 Ga0307516_10101357 Ga0307516_101013574 196
586 3300031903 Ga0307407_10425956 Ga0307407_104259562 196
587 3300035119 Ga0373956_0215427 Ga0373956_0215427_92_694 196
588 3300035171 Ga0373946_0034867 Ga0373946_0034867_967_1569 196
589 3300035692 Ga0373935_0073481 Ga0373935_0073481_855_1457 196
590 3300035695 Ga0373927_0038435 Ga0373927_0038435_2254_2856 196
591 3300035724 Ga0373933_0486823 Ga0373933_0486823_38_640 196
592 3300035725 Ga0373947_0009096 Ga0373947_0009096_995_1597 196
593 3300036401 Ga0373937_0365600 Ga0373937_0365600_632_1234 196
594 3300036401 Ga0373937_0635489 Ga0373937_0635489_39_641 196
595 3300037068 Ga0373925_0029717 Ga0373925_0029717_2753_3355 196
596 3300037418 Ga0395900_0095814 Ga0395900_0095814_1443_2048 196
597 3300037466 Ga0395898_0009675 Ga0395898_0009675_2410_3015 196
598 3300038443 Ga0395901_0017833 Ga0395901_0017833_4477_5082 196
599 3300039437 Ga0436365_0982785 Ga0436365_0982785_27651_28241 196
600 3300039437 Ga0436365_1291084 Ga0436365_1291084_8851_9459 196
601 3300039450 Ga0436363_1184338 Ga0436363_1184338_18751_19353 196
602 3300039450 Ga0436363_1287632 Ga0436363_1287632_396_998 196
603 3300042156 Ga0439446_0098379 Ga0439446_0098379_246_848 196
604 3300042439 Ga0439464_0063777 Ga0439464_0063777_182_784 196
605 3300044842 Ga0466957_0327983 Ga0466957_0327983_204_800 196
606 3300045976 Ga0466967_0254369 Ga0466967_0254369_727_1323 196
607 3300045976 Ga0466967_0653669 Ga0466967_0653669_352_960 196
608 3300046454 Ga0495592_0356207 Ga0495592_0356207_162_764 196
609 3300046472 Ga0495580_0022060 Ga0495580_0022060_1753_2355 196
610 3300046472 Ga0495580_0362947 Ga0495580_0362947_327_929 196
611 3300046472 Ga0495580_0496426 Ga0495580_0496426_96_698 196
612 3300046473 Ga0495582_0005935 Ga0495582_0005935_2219_2821 196
613 3300046477 Ga0495664_0112737 Ga0495664_0112737_935_1537 196
614 3300046477 Ga0495664_0212227 Ga0495664_0212227_456_1058 196
615 3300046477 Ga0495664_0284403 Ga0495664_0284403_94_696 196
616 3300046516 Ga0495628_0210658 Ga0495628_0210658_46_648 196
617 3300046517 Ga0495630_0469358 Ga0495630_0469358_283_897 196
618 3300046529 Ga0495652_0153912 Ga0495652_0153912_345_947 196
619 3300046529 Ga0495652_0173490 Ga0495652_0173490_158_760 196
620 3300046539 Ga0495621_0085484 Ga0495621_0085484_22_627 196
621 3300046543 Ga0495645_0044951 Ga0495645_0044951_2245_2847 196
622 3300046557 Ga0495622_0002990 Ga0495622_0002990_3479_4084 196
623 3300046683 Ga0495658_0000415 Ga0495658_0000415_3725_4327 196
624 3300046684 Ga0495669_0188591 Ga0495669_0188591_166_768 196
625 3300046689 Ga0495613_0203206 Ga0495613_0203206_745_1347 196
626 3300046692 Ga0495671_0176808 Ga0495671_0176808_182_787 196
627 3300046809 Ga0495600_0403655 Ga0495600_0403655_61_651 196
628 3300046809 Ga0495600_0412797 Ga0495600_0412797_124_726 196
629 3300047320 Ga0495672_0271063 Ga0495672_0271063_81_686 196
630 3300047444 Ga0495675_0072141 Ga0495675_0072141_1289_1891 196
631 3300048909 Ga0496106_0294308 Ga0496106_0294308_383_985 196
632 3300048923 Ga0496120_0136847 Ga0496120_0136847_233_823 196
633 3300048924 Ga0496121_0000154 Ga0496121_0000154_9861_10451 196
634 3300048929 Ga0496126_0001104 Ga0496126_0001104_31710_32312 196
635 3300048929 Ga0496126_0057975 Ga0496126_0057975_849_1439 196
636 3300049460 Ga0495682_0038380 Ga0495682_0038380_83_685 196
637 3300049569 Ga0501032_0055900 Ga0501032_0055900_898_1500 196
638 3300049569 Ga0501032_0258564 Ga0501032_0258564_341_931 196
639 3300049570 Ga0501033_0074198 Ga0501033_0074198_498_1088 196
640 3300049570 Ga0501033_0169487 Ga0501033_0169487_527_1129 196
641 3300049571 Ga0501034_0067469 Ga0501034_0067469_2157_2759 196
642 3300049571 Ga0501034_0117501 Ga0501034_0117501_684_1286 196
643 3300049571 Ga0501034_0227400 Ga0501034_0227400_310_900 196
644 3300049571 Ga0501034_0392461 Ga0501034_0392461_588_1178 196
645 3300049572 Ga0501036_0046458 Ga0501036_0046458_1591_2193 196
646 3300049573 Ga0501037_0038370 Ga0501037_0038370_302_892 196
647 3300049574 Ga0501038_0119239 Ga0501038_0119239_1311_1913 196
648 3300049574 Ga0501038_0206322 Ga0501038_0206322_163_753 196
649 3300049575 Ga0501039_0793787 Ga0501039_0793787_89_679 196
650 3300049578 Ga0501042_0397908 Ga0501042_0397908_169_765 196
651 3300049579 Ga0501043_0111974 Ga0501043_0111974_535_1137 196
652 3300049579 Ga0501043_0141740 Ga0501043_0141740_1130_1732 196
653 3300049579 Ga0501043_0143809 Ga0501043_0143809_1163_1765 196
654 3300049580 Ga0501046_0040290 Ga0501046_0040290_1217_1807 196
655 3300049580 Ga0501046_0044234 Ga0501046_0044234_1382_1972 196
656 3300049580 Ga0501046_0179595 Ga0501046_0179595_919_1509 196
657 3300049581 Ga0501047_0002943 Ga0501047_0002943_14542_15144 196
658 3300049581 Ga0501047_0004907 Ga0501047_0004907_5707_6297 196
659 3300049581 Ga0501047_0009629 Ga0501047_0009629_7903_8493 196
660 3300049581 Ga0501047_0032360 Ga0501047_0032360_3751_4341 196
661 3300049581 Ga0501047_0037093 Ga0501047_0037093_2977_3579 196
662 3300049581 Ga0501047_0089165 Ga0501047_0089165_1691_2281 196
663 3300049581 Ga0501047_0252181 Ga0501047_0252181_700_1290 196
664 3300049581 Ga0501047_0258296 Ga0501047_0258296_525_1127 196
665 3300049581 Ga0501047_0584876 Ga0501047_0584876_77_667 196
666 3300049582 Ga0501048_0575269 Ga0501048_0575269_109_711 196
667 3300049583 Ga0501067_0011618 Ga0501067_0011618_2198_2800 196
668 3300049583 Ga0501067_0015267 Ga0501067_0015267_387_989 196
669 3300049585 Ga0501069_0016664 Ga0501069_0016664_560_1162 196
670 3300049586 Ga0501070_0039926 Ga0501070_0039926_2977_3579 196
671 3300049586 Ga0501070_0075317 Ga0501070_0075317_2137_2751 196
672 3300049586 Ga0501070_0120164 Ga0501070_0120164_409_1011 196
673 3300049586 Ga0501070_0166774 Ga0501070_0166774_224_826 196
674 3300049586 Ga0501070_0221410 Ga0501070_0221410_147_749 196
675 3300049588 Ga0501072_0020816 Ga0501072_0020816_1544_2146 196
676 3300049589 Ga0501073_0006683 Ga0501073_0006683_612_1214 196
677 3300049589 Ga0501073_0263526 Ga0501073_0263526_343_945 196
678 3300049589 Ga0501073_0472860 Ga0501073_0472860_58_660 196
679 3300049592 Ga0501076_0669512 Ga0501076_0669512_24_626 196
680 3300049741 Ga0501079_0041411 Ga0501079_0041411_1352_1954 196
681 3300049742 Ga0501080_0002883 Ga0501080_0002883_11316_11918 196
682 3300049742 Ga0501080_0076339 Ga0501080_0076339_614_1219 196
683 3300049742 Ga0501080_0491288 Ga0501080_0491288_428_1042 196
684 3300049742 Ga0501080_0737252 Ga0501080_0737252_123_725 196
685 3300049742 Ga0501080_0969471 Ga0501080_0969471_79_681 196
686 3300049822 Ga0501035_0030048 Ga0501035_0030048_4253_4843 196
687 3300049822 Ga0501035_0065312 Ga0501035_0065312_2557_3159 196
688 3300049822 Ga0501035_0169065 Ga0501035_0169065_512_1114 196
689 3300049822 Ga0501035_0255660 Ga0501035_0255660_613_1203 196
690 3300049822 Ga0501035_0500650 Ga0501035_0500650_85_675 196
691 3300049823 Ga0501044_0003661 Ga0501044_0003661_10635_11225 196
692 3300049823 Ga0501044_0025682 Ga0501044_0025682_2384_2986 196
693 3300049823 Ga0501044_0127704 Ga0501044_0127704_800_1390 196
694 3300049823 Ga0501044_0190249 Ga0501044_0190249_696_1298 196
695 3300049823 Ga0501044_0956262 Ga0501044_0956262_73_663 196
696 3300050509 nmdc:mga0qj67_212823_c1 nmdc:mga0qj67_212823_c1_100_702 196
697 3300050511 nmdc:mga08y16_312326_c1 nmdc:mga08y16_312326_c1_171_773 196
698 3300053087 Ga0500643_000027 Ga0500643_000027_204636_205241 196
699 3300053119 Ga0500595_004900 Ga0500595_004900_4523_5113 196
700 3300053119 Ga0500595_048945 Ga0500595_048945_518_1123 196
701 3300053123 Ga0500614_078905 Ga0500614_078905_292_882 196
702 3300053130 Ga0500642_0037868 Ga0500642_0037868_925_1530 196
703 3300053133 Ga0500655_001037 Ga0500655_001037_3026_3628 196
704 3300053136 Ga0500559_0006453 Ga0500559_0006453_444_1046 196
705 3300053136 Ga0500559_0054652 Ga0500559_0054652_720_1310 196
706 3300053139 Ga0500568_0037697 Ga0500568_0037697_395_1000 196
707 3300053140 Ga0500573_0000032 Ga0500573_0000032_121802_122407 196
708 3300053142 Ga0500577_0076821 Ga0500577_0076821_446_1090 196
709 3300053154 Ga0500619_005322 Ga0500619_005322_1814_2416 196
710 3300053730 Ga0500645_047516 Ga0500645_047516_68_673 196
711 3300054114 Ga0501084_0000971 Ga0501084_0000971_9754_10356 196
712 3300054114 Ga0501084_0012790 Ga0501084_0012790_3813_4415 196
713 3300054114 Ga0501084_0015332 Ga0501084_0015332_5075_5677 196
714 3300060353 Ga0501082_0050277 Ga0501082_0050277_2944_3546 196
715 3300060353 Ga0501082_0132765 Ga0501082_0132765_1509_2111 196
716 3300060353 Ga0501082_0841200 Ga0501082_0841200_163_765 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

196

219

0.99

PF13662

Toprim_4

Toprim domain

104

194

0.97

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

78

98

0.96

PF21176

RecR_HhH

RecR, helix-hairpin-helix

31

75

0.96

PF01751

Toprim

Toprim domain

105

193

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9432 82 169
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9133 82 169
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8958 19 196
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8768 19 196
6z2b-assembly1.cif.gz_A toprim domain of rnase m5 bound with two mg2+ ions 0.7902 79 194
ID Description Score Start End Superfamily
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9632 78 196 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9416 81 168 3.40.1360.10
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.938 78 168 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9327 78 196 3.40.1360.10
3vdpC01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.923 7 53 1.10.8.420
ID Description Score Start End GO Terms
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.991 60 155 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9709 60 155 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3D0TKE5-F1-model_v4 Recombination protein RecR 0.9626 55 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A2V2L171-F1-model_v4 deleted 0.9519 45 124
AF-W4U8H3-F1-model_v4 deleted 0.9494 53 141

Feature Viewer

pLDDT pTM Quality
91.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map