F477030

General Info

Members Datasets Scaffolds Average Seq Length
716 317 716 108

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100773247|Ga0070688_1007732472
Length 110
Sequence MSRPAYQVIRRPLLTEKGTRLRESGGRLPGSVSEEELKPKVFFEVAMDANKIEIKQAVEALFNVKVADVHTTVVRGKEKRVGRYIGRRSNWKRAIVTLSKGQKIDFFEGV

Samples

Sample ID Description Type Environment
1 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
201 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
202 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
203 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
204 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
241 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
285 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
296 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
303 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
304 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.67
Metatranscriptomes 4.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 4.75
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006767J43181_103125 3300002868 Bacteria 8971
2 Ga0006763J43179_104103 3300002870 Bacteria 8906
3 Ga0006760J45825_104057 3300003158 Bacteria 821
4 Ga0006759J45824_1006649 3300003163 Bacteria 16605
5 Ga0006759J45824_1093956 3300003163 Bacteria 540
6 Ga0006759J45824_1158952 3300003163 Unclassified 581
7 Ga0006758J48902_1008419 3300003300 Bacteria 4745
8 Ga0006770J48903_1041109 3300003305 Bacteria 565
9 rootH1_10067392 3300003323 Bacteria 1161
10 Ga0032354_1009872 3300003693 Bacteria 14763
11 Ga0058859_11239146 3300004798 Bacteria 1000
12 Ga0058859_11768657 3300004798 Bacteria 736
13 Ga0058859_11779707 3300004798 Bacteria 633
14 Ga0065712_10175385 3300005290 Bacteria 1220
15 Ga0065712_10693493 3300005290 Unclassified 549
16 Ga0065715_10346913 3300005293 Bacteria 957
17 Ga0070658_10111351 3300005327 Bacteria 2268
18 Ga0070676_10278379 3300005328 Bacteria 1126
19 Ga0070676_11102779 3300005328 Unclassified 600
20 Ga0070683_100082061 3300005329 Bacteria 3019
21 Ga0070683_100093535 3300005329 Bacteria 2824
22 Ga0070683_100095923 3300005329 Bacteria 2789
23 Ga0070683_100293889 3300005329 Bacteria 1545
24 Ga0070683_100910515 3300005329 Bacteria 844
25 Ga0070683_100972752 3300005329 Bacteria 815
26 Ga0070683_101273004 3300005329 Bacteria 707
27 Ga0070690_100079405 3300005330 Bacteria 2145
28 Ga0070690_100216563 3300005330 Bacteria 1340
29 Ga0070690_101707513 3300005330 Bacteria 512
30 Ga0070670_100034493 3300005331 Bacteria 4354
31 Ga0070670_100690222 3300005331 Bacteria 917
32 Ga0070670_101540257 3300005331 Bacteria 611
33 Ga0068869_100700486 3300005334 Bacteria 864
34 Ga0068869_101075753 3300005334 Bacteria 703
35 Ga0070666_10254507 3300005335 Bacteria 1244
36 Ga0070666_10319417 3300005335 Bacteria 1107
37 Ga0070680_100078067 3300005336 Bacteria 2727
38 Ga0070680_100997661 3300005336 Bacteria 723
39 Ga0070680_101073878 3300005336 Bacteria 696
40 Ga0070682_100189835 3300005337 Bacteria 1442
41 Ga0070682_100198045 3300005337 Bacteria 1415
42 Ga0070682_100403296 3300005337 Bacteria 1035
43 Ga0070682_100893131 3300005337 Bacteria 730
44 Ga0070682_101378178 3300005337 Unclassified 602
45 Ga0068868_100467322 3300005338 Bacteria 1100
46 Ga0068868_101251073 3300005338 Bacteria 688
47 Ga0068868_102198059 3300005338 Unclassified 526
48 Ga0070660_100562713 3300005339 Unclassified 951
49 Ga0070660_101356042 3300005339 Unclassified 604
50 Ga0070689_100000043 3300005340 Bacteria 79179
51 Ga0070689_100080071 3300005340 Bacteria 2563
52 Ga0070689_100157622 3300005340 Bacteria 1833
53 Ga0070689_100178334 3300005340 Bacteria 1724
54 Ga0070689_100453005 3300005340 Bacteria 1092
55 Ga0070689_100614353 3300005340 Bacteria 943
56 Ga0070689_102141255 3300005340 Bacteria 512
57 Ga0070691_10066982 3300005341 Bacteria 1736
58 Ga0070691_10478747 3300005341 Bacteria 716
59 Ga0070687_100001952 3300005343 Bacteria 7531
60 Ga0070687_100034358 3300005343 Bacteria 2509
61 Ga0070687_100282976 3300005343 Bacteria 1045
62 Ga0070687_101410989 3300005343 Bacteria 521
63 Ga0070661_100586268 3300005344 Bacteria 900
64 Ga0070692_10067654 3300005345 Bacteria 1896
65 Ga0070692_10981398 3300005345 Bacteria 589
66 Ga0070668_100250387 3300005347 Bacteria 1470
67 Ga0070668_101912527 3300005347 Unclassified 546
68 Ga0070669_100066027 3300005353 Bacteria 2666
69 Ga0070675_100235508 3300005354 Bacteria 1598
70 Ga0070675_100246062 3300005354 Bacteria 1563
71 Ga0070671_101116695 3300005355 Bacteria 693
72 Ga0070671_101516481 3300005355 Bacteria 593
73 Ga0070674_100116088 3300005356 Bacteria 1974
74 Ga0070674_101419954 3300005356 Bacteria 622
75 Ga0070673_100036693 3300005364 Bacteria 3728
76 Ga0070673_100091524 3300005364 Bacteria 2487
77 Ga0070673_102040137 3300005364 Bacteria 545
78 Ga0070688_100032408 3300005365 Bacteria 3150
79 Ga0070688_100061965 3300005365 Bacteria 2367
80 Ga0070688_100294589 3300005365 Bacteria 1171
81 Ga0070688_100773247 3300005365 Bacteria 749
82 Ga0070688_100847836 3300005365 Bacteria 717
83 Ga0070688_100936868 3300005365 Bacteria 685
84 Ga0070659_100180238 3300005366 Bacteria 1733
85 Ga0070667_100204537 3300005367 Bacteria 1753
86 Ga0070667_100309483 3300005367 Bacteria 1424
87 Ga0070667_101131486 3300005367 Bacteria 732
88 Ga0070667_102093951 3300005367 Bacteria 533
89 Ga0070709_10272743 3300005434 Bacteria 1226
90 Ga0070709_10792312 3300005434 Bacteria 743
91 Ga0070713_101158800 3300005436 Bacteria 748
92 Ga0070713_101371109 3300005436 Unclassified 685
93 Ga0070710_10149428 3300005437 Bacteria 1439
94 Ga0070701_10077689 3300005438 Bacteria 1789
95 Ga0070701_10873261 3300005438 Bacteria 619
96 Ga0070711_100214813 3300005439 Bacteria 1492
97 Ga0070705_100067352 3300005440 Bacteria 2151
98 Ga0070705_101156657 3300005440 Bacteria 636
99 Ga0070700_100019232 3300005441 Bacteria 3939
100 Ga0070700_100560814 3300005441 Bacteria 889
101 Ga0070700_101329846 3300005441 Unclassified 605
102 Ga0070694_100089893 3300005444 Bacteria 2152
103 Ga0070694_101298826 3300005444 Unclassified 612
104 Ga0070708_101918034 3300005445 Bacteria 549
105 Ga0070678_100061341 3300005456 Bacteria 2771
106 Ga0070678_100745075 3300005456 Bacteria 886
107 Ga0070678_101483080 3300005456 Bacteria 635
108 Ga0070662_100030416 3300005457 Bacteria 3777
109 Ga0070681_10775056 3300005458 Bacteria 876
110 Ga0070681_10947926 3300005458 Bacteria 780
111 Ga0068867_100680719 3300005459 Unclassified 906
112 Ga0068867_100725051 3300005459 Bacteria 880
113 Ga0070685_10052343 3300005466 Bacteria 2362
114 Ga0070685_10109607 3300005466 Bacteria 1698
115 Ga0070685_10160181 3300005466 Bacteria 1433
116 Ga0070685_10477584 3300005466 Bacteria 878
117 Ga0070706_101199227 3300005467 Bacteria 697
118 Ga0070706_102074715 3300005467 Unclassified 514
119 Ga0070698_100648628 3300005471 Bacteria 997
120 Ga0070679_100029036 3300005530 Bacteria 5455
121 Ga0070679_100190634 3300005530 Bacteria 2019
122 Ga0070679_100290785 3300005530 Bacteria 1585
123 Ga0070684_100058335 3300005535 Bacteria 3374
124 Ga0070684_100136595 3300005535 Bacteria 2215
125 Ga0070684_100400359 3300005535 Bacteria 1265
126 Ga0070684_100532982 3300005535 Bacteria 1089
127 Ga0070684_100741356 3300005535 Bacteria 917
128 Ga0070684_101074725 3300005535 Bacteria 756
129 Ga0070684_101811665 3300005535 Unclassified 576
130 Ga0070697_100919961 3300005536 Bacteria 776
131 Ga0070697_101206902 3300005536 Bacteria 674
132 Ga0070697_101650823 3300005536 Bacteria 573
133 Ga0068853_100000004 3300005539 Bacteria 405732
134 Ga0068853_100267348 3300005539 Bacteria 1574
135 Ga0068853_100293961 3300005539 Bacteria 1500
136 Ga0068853_102484884 3300005539 Unclassified 501
137 Ga0070672_100042880 3300005543 Bacteria 3485
138 Ga0070672_100102627 3300005543 Bacteria 2321
139 Ga0070672_100488954 3300005543 Bacteria 1063
140 Ga0070686_100016687 3300005544 Bacteria 4276
141 Ga0070686_100046683 3300005544 Bacteria 2734
142 Ga0070686_100433255 3300005544 Bacteria 1007
143 Ga0070686_100831462 3300005544 Bacteria 746
144 Ga0070695_100032852 3300005545 Bacteria 3244
145 Ga0070696_100669537 3300005546 Bacteria 843
146 Ga0070665_100342825 3300005548 Bacteria 1499
147 Ga0070665_101619982 3300005548 Unclassified 655
148 Ga0070704_100239301 3300005549 Bacteria 1485
149 Ga0068855_100076432 3300005563 Bacteria 3886
150 Ga0068855_100152247 3300005563 Bacteria 2629
151 Ga0068855_100153786 3300005563 Bacteria 2614
152 Ga0068857_100171461 3300005577 Bacteria 1973
153 Ga0068857_101935815 3300005577 Bacteria 578
154 Ga0068857_102428114 3300005577 Archaea 515
155 Ga0068856_100060062 3300005614 Bacteria 3756
156 Ga0068856_100231627 3300005614 Bacteria 1862
157 Ga0068856_100367002 3300005614 Bacteria 1458
158 Ga0070702_100176947 3300005615 Bacteria 1393
159 Ga0070702_100393589 3300005615 Bacteria 989
160 Ga0070702_100845384 3300005615 Bacteria 712
161 Ga0068852_100443584 3300005616 Bacteria 1284
162 Ga0068852_100771108 3300005616 Bacteria 975
163 Ga0068852_101328740 3300005616 Unclassified 741
164 Ga0068859_100042834 3300005617 Bacteria 4548
165 Ga0068859_100180325 3300005617 Bacteria 2195
166 Ga0068864_102184926 3300005618 Bacteria 560
167 Ga0068864_102593756 3300005618 Bacteria 513
168 Ga0068866_10268249 3300005718 Bacteria 1052
169 Ga0068866_10350800 3300005718 Bacteria 937
170 Ga0068861_100046691 3300005719 Bacteria 3266
171 Ga0068863_100316875 3300005841 Bacteria 1514
172 Ga0068863_100492968 3300005841 Bacteria 1206
173 Ga0068863_102415467 3300005841 Bacteria 535
174 Ga0068860_100481748 3300005843 Unclassified 1237
175 Ga0068860_100484640 3300005843 Bacteria 1233
176 Ga0068860_101608691 3300005843 Unclassified 672
177 Ga0068862_101532282 3300005844 Bacteria 672
178 Ga0068862_101736155 3300005844 Bacteria 633
179 Ga0081455_10113380 3300005937 Bacteria 2150
180 Ga0070717_11208333 3300006028 Bacteria 688
181 Ga0070716_100264302 3300006173 Bacteria 1179
182 Ga0070716_100870745 3300006173 Bacteria 703
183 Ga0070712_100331620 3300006175 Bacteria 1240
184 Ga0075366_10549464 3300006195 Bacteria 715
185 Ga0097621_100716854 3300006237 Bacteria 922
186 Ga0097621_101186330 3300006237 Unclassified 719
187 Ga0068871_100672501 3300006358 Bacteria 947
188 Ga0068871_101274853 3300006358 Bacteria 691
189 Ga0068871_101277471 3300006358 Bacteria 690
190 Ga0068871_102006037 3300006358 Bacteria 551
191 Ga0068871_102035268 3300006358 Bacteria 547
192 Ga0075428_102059615 3300006844 Bacteria 591
193 Ga0075433_11428935 3300006852 Bacteria 598
194 Ga0075434_100727321 3300006871 Bacteria 1010
195 Ga0068865_100279850 3300006881 Bacteria 1328
196 Ga0068865_100582500 3300006881 Bacteria 943
197 Ga0068865_100829526 3300006881 Unclassified 800
198 Ga0068865_101252525 3300006881 Bacteria 658
199 Ga0075436_101014650 3300006914 Unclassified 623
200 Ga0097620_100042837 3300006931 Bacteria 4548
201 Ga0097620_100180328 3300006931 Bacteria 2195
202 Ga0105240_10000795 3300009093 Bacteria 57129
203 Ga0105240_10318108 3300009093 Bacteria 1775
204 Ga0105240_10951372 3300009093 Unclassified 921
205 Ga0111539_10165120 3300009094 Bacteria 2589
206 Ga0111539_10563491 3300009094 Bacteria 1327
207 Ga0111539_11404632 3300009094 Bacteria 810
208 Ga0105245_10326263 3300009098 Bacteria 1514
209 Ga0105245_10364874 3300009098 Bacteria 1434
210 Ga0105245_10402423 3300009098 Bacteria 1368
211 Ga0105245_12253441 3300009098 Bacteria 598
212 Ga0105245_12678882 3300009098 Unclassified 552
213 Ga0105247_11095213 3300009101 Bacteria 628
214 Ga0114129_10569212 3300009147 Bacteria 1471
215 Ga0105243_11565369 3300009148 Bacteria 685
216 Ga0105241_10505368 3300009174 Bacteria 1078
217 Ga0105242_10638967 3300009176 Bacteria 1033
218 Ga0105237_10002220 3300009545 Bacteria 24289
219 Ga0105237_10201518 3300009545 Bacteria 1990
220 Ga0105237_11078049 3300009545 Bacteria 810
221 Ga0105237_11492670 3300009545 Bacteria 683
222 Ga0105238_10056048 3300009551 Bacteria 3954
223 Ga0105238_10686083 3300009551 Bacteria 1036
224 Ga0105238_12147164 3300009551 Unclassified 593
225 Ga0105239_10284944 3300010375 Bacteria 1860
226 Ga0105239_11745225 3300010375 Bacteria 721
227 Ga0105239_12755137 3300010375 Bacteria 574
228 Ga0105246_11645796 3300011119 Bacteria 608
229 Ga0105246_12128475 3300011119 Unclassified 544
230 Ga0157371_10325770 3300013102 Bacteria 1115
231 Ga0157374_10054827 3300013296 Bacteria 3720
232 Ga0157374_11075912 3300013296 Bacteria 824
233 Ga0157378_10487709 3300013297 Bacteria 1229
234 Ga0157378_10495841 3300013297 Bacteria 1219
235 Ga0157378_10724834 3300013297 Bacteria 1015
236 Ga0163162_10162216 3300013306 Bacteria 2357
237 Ga0157372_10918100 3300013307 Bacteria 1015
238 Ga0157372_10966444 3300013307 Unclassified 987
239 Ga0157372_12714985 3300013307 Unclassified 568
240 Ga0157375_11266341 3300013308 Bacteria 866
241 Ga0157375_11962180 3300013308 Bacteria 695
242 Ga0163163_11226335 3300014325 Bacteria 813
243 Ga0157380_10983976 3300014326 Bacteria 876
244 Ga0157380_11404115 3300014326 Bacteria 749
245 Ga0157377_10462162 3300014745 Bacteria 879
246 Ga0157379_10164923 3300014968 Bacteria 2000
247 Ga0157379_12035381 3300014968 Bacteria 568
248 Ga0157376_10253275 3300014969 Bacteria 1646
249 Ga0157376_10655572 3300014969 Bacteria 1050
250 Ga0157376_10846268 3300014969 Bacteria 930
251 Ga0206352_10638828 3300020078 Bacteria 1956
252 Ga0206352_11129659 3300020078 Bacteria 1009
253 Ga0213875_10009336 3300021388 Bacteria 4974
254 Ga0207666_1000994 3300025271 Bacteria 3365
255 Ga0207692_10701363 3300025898 Bacteria 657
256 Ga0207688_10588246 3300025901 Bacteria 701
257 Ga0207680_10036485 3300025903 Bacteria 2831
258 Ga0207699_10193517 3300025906 Bacteria 1374
259 Ga0207699_10530758 3300025906 Bacteria 852
260 Ga0207645_10026906 3300025907 Bacteria 3716
261 Ga0207643_10748640 3300025908 Bacteria 632
262 Ga0207643_11083284 3300025908 Unclassified 517
263 Ga0207705_10026045 3300025909 Bacteria 4173
264 Ga0207684_11005027 3300025910 Bacteria 698
265 Ga0207654_10400479 3300025911 Bacteria 954
266 Ga0207707_10055935 3300025912 Bacteria 3432
267 Ga0207707_10433520 3300025912 Bacteria 1126
268 Ga0207707_10659437 3300025912 Unclassified 881
269 Ga0207695_10000834 3300025913 Bacteria 57039
270 Ga0207695_10283316 3300025913 Bacteria 1551
271 Ga0207671_10000510 3300025914 Bacteria 52543
272 Ga0207671_10006782 3300025914 Bacteria 10121
273 Ga0207671_10343405 3300025914 Bacteria 1183
274 Ga0207693_10420783 3300025915 Bacteria 1044
275 Ga0207663_10548379 3300025916 Bacteria 904
276 Ga0207660_10081230 3300025917 Bacteria 2382
277 Ga0207660_11578348 3300025917 Bacteria 529
278 Ga0207662_10000745 3300025918 Bacteria 14909
279 Ga0207662_10057285 3300025918 Bacteria 2329
280 Ga0207662_10080129 3300025918 Bacteria 1991
281 Ga0207662_10184853 3300025918 Bacteria 1343
282 Ga0207657_10184384 3300025919 Bacteria 1686
283 Ga0207657_10651981 3300025919 Unclassified 819
284 Ga0207649_10617610 3300025920 Unclassified 835
285 Ga0207652_10091748 3300025921 Bacteria 2671
286 Ga0207652_10249882 3300025921 Bacteria 1599
287 Ga0207652_11394684 3300025921 Bacteria 604
288 Ga0207652_11482574 3300025921 Bacteria 582
289 Ga0207681_10002742 3300025923 Bacteria 11146
290 Ga0207694_10019794 3300025924 Bacteria 5092
291 Ga0207694_10334653 3300025924 Bacteria 1251
292 Ga0207694_10546681 3300025924 Bacteria 972
293 Ga0207694_10998884 3300025924 Unclassified 708
294 Ga0207650_10331885 3300025925 Bacteria 1247
295 Ga0207650_10412449 3300025925 Bacteria 1120
296 Ga0207659_10178033 3300025926 Bacteria 1682
297 Ga0207687_10080679 3300025927 Bacteria 2349
298 Ga0207687_11208432 3300025927 Bacteria 650
299 Ga0207700_10241544 3300025928 Bacteria 1539
300 Ga0207664_10987838 3300025929 Bacteria 755
301 Ga0207644_10244061 3300025931 Bacteria 1431
302 Ga0207644_11584875 3300025931 Bacteria 549
303 Ga0207644_11717683 3300025931 Bacteria 526
304 Ga0207690_10294826 3300025932 Bacteria 1267
305 Ga0207706_10050162 3300025933 Bacteria 3689
306 Ga0207706_10704768 3300025933 Bacteria 862
307 Ga0207686_10564906 3300025934 Bacteria 891
308 Ga0207670_10000022 3300025936 Bacteria 145904
309 Ga0207670_10033174 3300025936 Bacteria 3325
310 Ga0207670_10038900 3300025936 Bacteria 3110
311 Ga0207670_10583824 3300025936 Bacteria 916
312 Ga0207670_10971512 3300025936 Unclassified 714
313 Ga0207670_11466375 3300025936 Bacteria 580
314 Ga0207670_11731623 3300025936 Bacteria 532
315 Ga0207669_10032783 3300025937 Bacteria 2922
316 Ga0207704_10215606 3300025938 Bacteria 1416
317 Ga0207704_10969184 3300025938 Bacteria 718
318 Ga0207704_11159472 3300025938 Archaea 658
319 Ga0207665_10327042 3300025939 Bacteria 1152
320 Ga0207691_10111430 3300025940 Bacteria 2433
321 Ga0207691_10195137 3300025940 Bacteria 1764
322 Ga0207691_10205570 3300025940 Bacteria 1712
323 Ga0207689_10079744 3300025942 Bacteria 2690
324 Ga0207689_11475473 3300025942 Bacteria 568
325 Ga0207661_10053370 3300025944 Bacteria 3234
326 Ga0207661_10394917 3300025944 Bacteria 1253
327 Ga0207661_10684704 3300025944 Unclassified 943
328 Ga0207661_11074409 3300025944 Bacteria 741
329 Ga0207667_10023566 3300025949 Bacteria 6777
330 Ga0207667_10209758 3300025949 Bacteria 1997
331 Ga0207667_10299139 3300025949 Bacteria 1644
332 Ga0207667_10505733 3300025949 Bacteria 1225
333 Ga0207651_10007125 3300025960 Bacteria 5937
334 Ga0207651_10057682 3300025960 Bacteria 2679
335 Ga0207651_10149277 3300025960 Bacteria 1817
336 Ga0207651_10250285 3300025960 Bacteria 1449
337 Ga0207668_10166349 3300025972 Bacteria 1724
338 Ga0207668_11489344 3300025972 Bacteria 611
339 Ga0207668_12056919 3300025972 Unclassified 514
340 Ga0207640_10144783 3300025981 Bacteria 1737
341 Ga0207658_10301364 3300025986 Bacteria 1381
342 Ga0207658_10629819 3300025986 Bacteria 965
343 Ga0207658_10685249 3300025986 Bacteria 925
344 Ga0207658_11330371 3300025986 Unclassified 657
345 Ga0207677_10134658 3300026023 Bacteria 1882
346 Ga0207677_10205289 3300026023 Bacteria 1569
347 Ga0207677_10417879 3300026023 Bacteria 1141
348 Ga0207639_10000029 3300026041 Bacteria 195764
349 Ga0207639_10005667 3300026041 Bacteria 8449
350 Ga0207639_10042182 3300026041 Bacteria 3418
351 Ga0207708_10012451 3300026075 Bacteria 6340
352 Ga0207708_10801332 3300026075 Bacteria 811
353 Ga0207702_10204836 3300026078 Bacteria 1831
354 Ga0207702_10362040 3300026078 Bacteria 1390
355 Ga0207702_10461801 3300026078 Bacteria 1233
356 Ga0207641_10549601 3300026088 Bacteria 1126
357 Ga0207641_12000603 3300026088 Unclassified 581
358 Ga0207641_12077650 3300026088 Unclassified 569
359 Ga0207648_10011154 3300026089 Bacteria 8479
360 Ga0207648_11346760 3300026089 Bacteria 671
361 Ga0207676_10628970 3300026095 Bacteria 1034
362 Ga0207676_11014416 3300026095 Bacteria 818
363 Ga0207676_11370606 3300026095 Bacteria 703
364 Ga0207676_12115241 3300026095 Bacteria 561
365 Ga0207674_10143954 3300026116 Bacteria 2343
366 Ga0207674_11429596 3300026116 Bacteria 661
367 Ga0207675_100013850 3300026118 Bacteria 7520
368 Ga0207675_100523954 3300026118 Bacteria 1182
369 Ga0207683_10055874 3300026121 Bacteria 3462
370 Ga0207683_10406889 3300026121 Bacteria 1252
371 Ga0207683_11608085 3300026121 Bacteria 599
372 Ga0207698_10740360 3300026142 Bacteria 981
373 Ga0209998_10134052 3300027717 Bacteria 630
374 Ga0209974_10047202 3300027876 Bacteria 1442
375 Ga0207428_10071472 3300027907 Bacteria 2725
376 Ga0268266_11113797 3300028379 Unclassified 764
377 Ga0268265_10053988 3300028380 Bacteria 3046
378 Ga0268265_11176573 3300028380 Bacteria 764
379 Ga0268265_12459148 3300028380 Bacteria 527
380 Ga0268264_11590237 3300028381 Unclassified 664
381 Ga0268264_11795831 3300028381 Bacteria 623
382 Ga0265337_1016213 3300028556 Bacteria 2415
383 Ga0265337_1019764 3300028556 Bacteria 2118
384 Ga0265326_10086852 3300028558 Bacteria 885
385 Ga0265319_1022863 3300028563 Bacteria 2271
386 Ga0265319_1028578 3300028563 Bacteria 1965
387 Ga0265319_1066428 3300028563 Bacteria 1162
388 Ga0265334_10003040 3300028573 Bacteria 7662
389 Ga0265318_10000169 3300028577 Bacteria 57590
390 Ga0265318_10000384 3300028577 Bacteria 34508
391 Ga0265318_10033468 3300028577 Bacteria 1984
392 Ga0265323_10003319 3300028653 Bacteria 7141
393 Ga0265323_10015822 3300028653 Bacteria 2960
394 Ga0265323_10015991 3300028653 Bacteria 2938
395 Ga0265323_10018664 3300028653 Bacteria 2681
396 Ga0265323_10051237 3300028653 Bacteria 1465
397 Ga0265322_10007541 3300028654 Bacteria 3172
398 Ga0265322_10012481 3300028654 Bacteria 2459
399 Ga0265336_10016694 3300028666 Bacteria 2399
400 Ga0265336_10184290 3300028666 Unclassified 620
401 Ga0265336_10201627 3300028666 Unclassified 591
402 Ga0265338_10001810 3300028800 Bacteria 33582
403 Ga0265338_10016967 3300028800 Bacteria 7878
404 Ga0265338_10132703 3300028800 Bacteria 1963
405 Ga0265338_10143543 3300028800 Bacteria 1866
406 Ga0265338_10161608 3300028800 Bacteria 1729
407 Ga0265338_10251224 3300028800 Bacteria 1304
408 Ga0265338_10529671 3300028800 Bacteria 827
409 Ga0265338_10794916 3300028800 Unclassified 649
410 Ga0265324_10005897 3300029957 Bacteria 5205
411 Ga0265324_10052976 3300029957 Bacteria 1393
412 Ga0265324_10291215 3300029957 Unclassified 555
413 Ga0265330_10000068 3300031235 Bacteria 90225
414 Ga0265330_10000541 3300031235 Bacteria 24732
415 Ga0265330_10001334 3300031235 Bacteria 14415
416 Ga0265330_10003962 3300031235 Bacteria 7608
417 Ga0265330_10009350 3300031235 Bacteria 4660
418 Ga0265330_10013183 3300031235 Bacteria 3855
419 Ga0265330_10065761 3300031235 Bacteria 1573
420 Ga0265330_10265117 3300031235 Unclassified 724
421 Ga0265332_10001607 3300031238 Bacteria 12385
422 Ga0265332_10005477 3300031238 Bacteria 5854
423 Ga0265332_10035759 3300031238 Bacteria 2157
424 Ga0265332_10041106 3300031238 Bacteria 2001
425 Ga0265332_10336885 3300031238 Bacteria 623
426 Ga0265328_10000172 3300031239 Bacteria 29964
427 Ga0265328_10000528 3300031239 Bacteria 17832
428 Ga0265328_10004363 3300031239 Bacteria 6145
429 Ga0265328_10005372 3300031239 Bacteria 5487
430 Ga0265328_10187915 3300031239 Unclassified 782
431 Ga0265320_10000069 3300031240 Bacteria 90253
432 Ga0265320_10005252 3300031240 Bacteria 8348
433 Ga0265320_10017635 3300031240 Bacteria 3957
434 Ga0265320_10040972 3300031240 Bacteria 2305
435 Ga0265320_10188685 3300031240 Bacteria 922
436 Ga0265320_10476221 3300031240 Bacteria 551
437 Ga0265325_10089603 3300031241 Bacteria 1519
438 Ga0265325_10158897 3300031241 Unclassified 1064
439 Ga0265325_10176509 3300031241 Bacteria 997
440 Ga0265325_10206962 3300031241 Bacteria 902
441 Ga0265329_10000733 3300031242 Bacteria 16666
442 Ga0265329_10003473 3300031242 Bacteria 6856
443 Ga0265329_10010575 3300031242 Bacteria 3379
444 Ga0265329_10022198 3300031242 Bacteria 2126
445 Ga0265329_10097232 3300031242 Bacteria 936
446 Ga0265329_10151123 3300031242 Bacteria 752
447 Ga0265340_10007508 3300031247 Bacteria 5918
448 Ga0265340_10061476 3300031247 Bacteria 1796
449 Ga0265340_10188620 3300031247 Bacteria 930
450 Ga0265339_10000001 3300031249 Bacteria 613713
451 Ga0265339_10006249 3300031249 Bacteria 7843
452 Ga0265339_10006835 3300031249 Bacteria 7436
453 Ga0265339_10018501 3300031249 Bacteria 4105
454 Ga0265339_10022740 3300031249 Bacteria 3628
455 Ga0265339_10032693 3300031249 Bacteria 2933
456 Ga0265339_10058815 3300031249 Bacteria 2074
457 Ga0265339_10075283 3300031249 Bacteria 1792
458 Ga0265339_10147825 3300031249 Bacteria 1191
459 Ga0265339_10287933 3300031249 Unclassified 786
460 Ga0265331_10000090 3300031250 Bacteria 123628
461 Ga0265331_10000149 3300031250 Bacteria 90395
462 Ga0265331_10001210 3300031250 Bacteria 19474
463 Ga0265331_10056308 3300031250 Bacteria 1867
464 Ga0265316_10000251 3300031344 Bacteria 61672
465 Ga0265316_10000984 3300031344 Bacteria 30933
466 Ga0265316_10006437 3300031344 Bacteria 11220
467 Ga0265316_10010605 3300031344 Bacteria 8384
468 Ga0265316_10012440 3300031344 Bacteria 7631
469 Ga0265316_10015836 3300031344 Bacteria 6566
470 Ga0265316_10024979 3300031344 Bacteria 4993
471 Ga0265316_10037888 3300031344 Bacteria 3887
472 Ga0265316_10058086 3300031344 Bacteria 3015
473 Ga0265316_10068712 3300031344 Bacteria 2735
474 Ga0265316_10076461 3300031344 Bacteria 2572
475 Ga0265316_10346857 3300031344 Bacteria 1075
476 Ga0265316_10523947 3300031344 Unclassified 845
477 Ga0307408_102063440 3300031548 Bacteria 549
478 Ga0265313_10003761 3300031595 Bacteria 12048
479 Ga0265313_10006146 3300031595 Bacteria 8620
480 Ga0265313_10035771 3300031595 Bacteria 2497
481 Ga0265313_10043972 3300031595 Bacteria 2183
482 Ga0265313_10064585 3300031595 Bacteria 1702
483 Ga0316575_10002995 3300031665 Bacteria 5756
484 Ga0316579_10014492 3300031691 Bacteria 3410
485 Ga0265314_10000109 3300031711 Bacteria 125470
486 Ga0265314_10000191 3300031711 Bacteria 91214
487 Ga0265314_10001397 3300031711 Bacteria 27067
488 Ga0265314_10004534 3300031711 Bacteria 12837
489 Ga0265314_10012182 3300031711 Bacteria 7042
490 Ga0265314_10023062 3300031711 Bacteria 4755
491 Ga0265314_10074680 3300031711 Bacteria 2258
492 Ga0265314_10113712 3300031711 Bacteria 1716
493 Ga0265342_10000812 3300031712 Bacteria 31323
494 Ga0265342_10001254 3300031712 Bacteria 23972
495 Ga0265342_10001889 3300031712 Bacteria 18879
496 Ga0265342_10002136 3300031712 Bacteria 17439
497 Ga0265342_10004388 3300031712 Bacteria 11137
498 Ga0265342_10006355 3300031712 Bacteria 8810
499 Ga0265342_10008085 3300031712 Bacteria 7603
500 Ga0265342_10028395 3300031712 Bacteria 3485
501 Ga0265342_10029446 3300031712 Bacteria 3408
502 Ga0265342_10046425 3300031712 Bacteria 2611
503 Ga0265342_10048044 3300031712 Bacteria 2559
504 Ga0265342_10204027 3300031712 Bacteria 1072
505 Ga0316576_10018164 3300031727 Bacteria 4794
506 Ga0316576_10491746 3300031727 Bacteria 903
507 Ga0316578_10033274 3300031728 Bacteria 2952
508 Ga0316578_10794577 3300031728 Bacteria 549
509 Ga0316577_10012472 3300031733 Bacteria 4630
510 Ga0326468_10027368 3300031889 Bacteria 730
511 Ga0316585_10026458 3300032137 Bacteria 1805
512 Ga0316593_10115032 3300032168 Bacteria 963
513 Ga0316593_10222634 3300032168 Unclassified 701
514 Ga0316593_10254773 3300032168 Bacteria 657
515 Ga0316593_10259055 3300032168 Bacteria 652
516 Ga0316592_1128347 3300033524 Bacteria 591
517 Ga0316586_1041122 3300033527 Bacteria 813
518 Ga0316588_1001749 3300033528 Bacteria 3652
519 Ga0316588_1050233 3300033528 Bacteria 1010
520 Ga0316587_1001986 3300033529 Bacteria 2652
521 Ga0316596_1097766 3300033541 Bacteria 793
522 Ga0373950_0000002 3300034818 Bacteria 933559
523 Ga0373950_0000319 3300034818 Bacteria 6031
524 Ga0373934_0015071 3300035086 Bacteria 2931
525 Ga0373934_0074325 3300035086 Bacteria 1362
526 Ga0373934_0279879 3300035086 Bacteria 691
527 Ga0373940_0185842 3300035088 Unclassified 678
528 Ga0373944_0309337 3300035089 Unclassified 594
529 Ga0373923_0064505 3300035111 Bacteria 1562
530 Ga0373923_0276690 3300035111 Unclassified 790
531 Ga0373936_0125773 3300035113 Bacteria 1099
532 Ga0373945_0196582 3300035116 Bacteria 836
533 Ga0373953_0007606 3300035117 Bacteria 3638
534 Ga0373954_0013761 3300035118 Bacteria 3605
535 Ga0373954_0061229 3300035118 Bacteria 1776
536 Ga0373954_0067157 3300035118 Bacteria 1699
537 Ga0373954_0118115 3300035118 Bacteria 1286
538 Ga0373954_0290057 3300035118 Unclassified 807
539 Ga0373956_0024460 3300035119 Bacteria 2603
540 Ga0373956_0029287 3300035119 Bacteria 2400
541 Ga0373956_0181043 3300035119 Bacteria 996
542 Ga0373956_0181170 3300035119 Bacteria 996
543 Ga0373957_0050880 3300035120 Bacteria 1584
544 Ga0373943_0026949 3300035170 Bacteria 2696
545 Ga0373943_0218286 3300035170 Bacteria 1061
546 Ga0373946_0472468 3300035171 Bacteria 641
547 Ga0373955_0050551 3300035172 Bacteria 2261
548 Ga0373955_0053472 3300035172 Bacteria 2205
549 Ga0373955_0077472 3300035172 Bacteria 1872
550 Ga0373955_0086843 3300035172 Bacteria 1777
551 Ga0373955_0376090 3300035172 Bacteria 862
552 Ga0373961_0073517 3300035241 Bacteria 1062
553 Ga0316574_0010007 3300035398 Bacteria 5335
554 Ga0316574_0530920 3300035398 Bacteria 732
555 Ga0373924_0146534 3300035410 Bacteria 1032
556 Ga0373924_0215395 3300035410 Bacteria 848
557 Ga0373935_0169727 3300035692 Bacteria 1491
558 Ga0373927_0054262 3300035695 Bacteria 2592
559 Ga0373927_0489562 3300035695 Bacteria 813
560 Ga0373933_0001189 3300035724 Bacteria 15436
561 Ga0373933_0083785 3300035724 Bacteria 1958
562 Ga0373933_0178406 3300035724 Bacteria 1354
563 Ga0373933_0437766 3300035724 Bacteria 854
564 Ga0373947_0055815 3300035725 Bacteria 2386
565 Ga0373937_0013762 3300036401 Bacteria 7128
566 Ga0373937_0051912 3300036401 Bacteria 3758
567 Ga0373937_0058959 3300036401 Bacteria 3527
568 Ga0373937_0096824 3300036401 Bacteria 2737
569 Ga0373937_0118014 3300036401 Bacteria 2471
570 Ga0373937_0672030 3300036401 Bacteria 982
571 Ga0373937_1423189 3300036401 Bacteria 641
572 Ga0316582_0035019 3300036647 Bacteria 3096
573 Ga0316582_0079277 3300036647 Bacteria 2141
574 Ga0316584_0019219 3300036712 Bacteria 4937
575 Ga0373925_0117963 3300037068 Bacteria 2057
576 Ga0373925_0900369 3300037068 Bacteria 729
577 Ga0395905_0022619 3300037471 Bacteria 5943
578 Ga0436364_1407027 3300037853 Bacteria 23679
579 Ga0436365_0308800 3300039437 Bacteria 1360
580 Ga0436360_0884324 3300039438 Bacteria 586
581 Ga0436362_0347491 3300039453 Bacteria 1457
582 Ga0451798_0319564 3300041458 Bacteria 833
583 Ga0451802_0662359 3300041460 Bacteria 742
584 Ga0451807_1468954 3300041486 Bacteria 2106
585 Ga0451807_1832672 3300041486 Unclassified 648
586 Ga0451833_0549793 3300041491 Bacteria 524
587 Ga0451853_0034047 3300041512 Bacteria 557
588 Ga0439460_0002577 3300042461 Bacteria 4377
589 Ga0451577_0012523 3300042876 Bacteria 7965
590 Ga0451577_0976860 3300042876 Unclassified 761
591 Ga0453683_0007127 3300044673 Bacteria 7616
592 Ga0453683_0258891 3300044673 Bacteria 1110
593 Ga0466966_0600212 3300044684 Bacteria 663
594 Ga0453684_0000116 3300044712 Bacteria 352304
595 Ga0453684_0000295 3300044712 Bacteria 211570
596 Ga0453684_0037288 3300044712 Bacteria 6674
597 Ga0453684_0085870 3300044712 Bacteria 3908
598 Ga0453684_0093912 3300044712 Bacteria 3693
599 Ga0453684_0147058 3300044712 Bacteria 2805
600 Ga0453684_0789668 3300044712 Bacteria 1025
601 Ga0453684_1855622 3300044712 Unclassified 611
602 Ga0466971_0068907 3300044719 Bacteria 1605
603 Ga0451576_0005894 3300045051 Bacteria 15208
604 Ga0451576_0121470 3300045051 Bacteria 2720
605 Ga0451576_1808345 3300045051 Unclassified 631
606 Ga0466967_0701760 3300045976 Bacteria 1002
607 Ga0495590_0292163 3300046457 Unclassified 612
608 Ga0495641_0118286 3300046461 Bacteria 1182
609 Ga0495664_0153025 3300046477 Bacteria 1399
610 Ga0495596_0361082 3300046500 Unclassified 566
611 Ga0495630_0003551 3300046517 Bacteria 10859
612 Ga0495630_0140876 3300046517 Bacteria 1834
613 Ga0495630_0514425 3300046517 Bacteria 918
614 Ga0495652_0258563 3300046529 Bacteria 1286
615 Ga0495586_0057737 3300046535 Bacteria 2106
616 Ga0495587_0096111 3300046536 Bacteria 1709
617 Ga0495587_0511027 3300046536 Bacteria 664
618 Ga0495645_0229080 3300046543 Bacteria 1246
619 Ga0495634_0000649 3300046642 Bacteria 33746
620 Ga0495635_0305100 3300046663 Bacteria 1067
621 Ga0495613_0308712 3300046689 Bacteria 1094
622 Ga0495624_0493552 3300046690 Bacteria 733
623 Ga0495674_0001336 3300047319 Bacteria 24042
624 Ga0495680_0057650 3300047322 Bacteria 3003
625 Ga0495680_0751946 3300047322 Bacteria 640
626 Ga0495684_0093485 3300047471 Bacteria 2277
627 Ga0496100_0003660 3300048903 Bacteria 8042
628 Ga0496100_0594571 3300048903 Bacteria 859
629 Ga0496101_1284082 3300048904 Bacteria 573
630 Ga0496102_0937571 3300048905 Bacteria 787
631 Ga0496104_0041250 3300048907 Bacteria 4327
632 Ga0496104_0169572 3300048907 Bacteria 2093
633 Ga0496104_1482344 3300048907 Bacteria 581
634 Ga0496105_0164714 3300048908 Bacteria 1819
635 Ga0496105_0374951 3300048908 Bacteria 1133
636 Ga0496105_0595025 3300048908 Bacteria 859
637 Ga0496105_1094817 3300048908 Bacteria 592
638 Ga0496106_1101387 3300048909 Bacteria 622
639 Ga0496107_0035117 3300048910 Bacteria 3594
640 Ga0496107_0966826 3300048910 Bacteria 619
641 Ga0496107_1016478 3300048910 Bacteria 601
642 Ga0496107_1357534 3300048910 Bacteria 507
643 Ga0496108_0085584 3300048911 Bacteria 2676
644 Ga0496108_0473517 3300048911 Bacteria 1094
645 Ga0496108_0520224 3300048911 Bacteria 1039
646 Ga0496110_1491358 3300048913 Bacteria 586
647 Ga0496112_0318677 3300048915 Bacteria 1499
648 Ga0496112_0322525 3300048915 Bacteria 1489
649 Ga0496114_0000386 3300048917 Bacteria 32590
650 Ga0496114_0006073 3300048917 Bacteria 9506
651 Ga0496114_0040273 3300048917 Bacteria 3867
652 Ga0496114_0258990 3300048917 Bacteria 1531
653 Ga0496115_0056627 3300048918 Bacteria 3151
654 Ga0496115_0174462 3300048918 Bacteria 1777
655 Ga0496115_0270114 3300048918 Bacteria 1397
656 Ga0496115_0293289 3300048918 Bacteria 1334
657 Ga0501310_014424 3300049130 Bacteria 928
658 Ga0501305_044170 3300049161 Bacteria 732
659 Ga0501307_024699 3300049162 Bacteria 803
660 Ga0501307_041252 3300049162 Bacteria 671
661 Ga0501299_068579 3300049522 Unclassified 765
662 Ga0501314_045656 3300049530 Bacteria 520
663 Ga0501034_0000037 3300049571 Bacteria 239254
664 Ga0501036_0038638 3300049572 Bacteria 4039
665 Ga0501036_0206025 3300049572 Bacteria 1653
666 Ga0501037_1096582 3300049573 Unclassified 516
667 Ga0501038_0656571 3300049574 Bacteria 789
668 Ga0501042_0633636 3300049578 Bacteria 777
669 Ga0501043_0002483 3300049579 Bacteria 15600
670 Ga0501046_0000751 3300049580 Bacteria 31319
671 Ga0501047_0000053 3300049581 Bacteria 150440
672 Ga0501048_0001235 3300049582 Bacteria 19382
673 Ga0501067_0003773 3300049583 Bacteria 8357
674 Ga0501067_0003984 3300049583 Bacteria 8152
675 Ga0501067_0040666 3300049583 Bacteria 2581
676 Ga0501068_0001718 3300049584 Bacteria 11652
677 Ga0501068_0702952 3300049584 Bacteria 661
678 Ga0501069_0075490 3300049585 Bacteria 1893
679 Ga0501070_0005205 3300049586 Bacteria 11084
680 Ga0501070_0007053 3300049586 Bacteria 9559
681 Ga0501070_0777221 3300049586 Bacteria 753
682 Ga0501072_0002806 3300049588 Bacteria 13074
683 Ga0501073_0003382 3300049589 Bacteria 11991
684 Ga0501073_0005323 3300049589 Bacteria 9649
685 Ga0501073_0006261 3300049589 Bacteria 8870
686 Ga0501073_0090487 3300049589 Bacteria 2126
687 Ga0501073_0215234 3300049589 Bacteria 1327
688 Ga0501073_0294618 3300049589 Bacteria 1119
689 Ga0501074_0022615 3300049590 Bacteria 4570
690 Ga0501074_0041398 3300049590 Bacteria 3335
691 Ga0501074_0122318 3300049590 Bacteria 1861
692 Ga0501227_235951 3300049665 Bacteria 521
693 Ga0501230_166809 3300049667 Bacteria 504
694 Ga0501225_0266137 3300049705 Bacteria 569
695 Ga0501079_0000174 3300049741 Bacteria 36202
696 Ga0501079_0314223 3300049741 Bacteria 1226
697 Ga0501080_0007066 3300049742 Bacteria 10138
698 Ga0501080_1777444 3300049742 Unclassified 518
699 Ga0501083_0092319 3300049744 Bacteria 1998
700 Ga0501083_0463700 3300049744 Bacteria 824
701 nmdc:mga05p37_662727_c1 3300050507 Bacteria 1166
702 nmdc:mga08y16_481495_c1 3300050511 Bacteria 1263
703 nmdc:mga08y16_92382_c1 3300050511 Bacteria 3154
704 nmdc:mga0n895_1036394_c1 3300050512 Bacteria 800
705 Ga0495601_0034268 3300053077 Bacteria 3167
706 Ga0495601_0188118 3300053077 Bacteria 1350
707 Ga0495601_0380331 3300053077 Bacteria 916
708 Ga0495595_0135146 3300053084 Bacteria 1207
709 Ga0495619_0028862 3300053085 Bacteria 3580
710 Ga0495619_0589775 3300053085 Bacteria 761
711 Ga0501084_0000022 3300054114 Bacteria 145804
712 Ga0501084_0531397 3300054114 Bacteria 994
713 Ga0587084_144566 3300059477 Unclassified 518
714 Ga0587111_0096616 3300060346 Bacteria 730
715 Ga0501082_0006072 3300060353 Bacteria 10487
716 Ga0501082_0117541 3300060353 Bacteria 2303

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005444 Ga0070694_100089893 Ga0070694_1000898932 86
2 3300005545 Ga0070695_100032852 Ga0070695_1000328526 86
3 3300005549 Ga0070704_100239301 Ga0070704_1002393012 86
4 3300049584 Ga0501068_0702952 Ga0501068_0702952_22_291 89
5 3300025986 Ga0207658_11330371 Ga0207658_113303712 90
6 3300042876 Ga0451577_0012523 Ga0451577_0012523_4530_4808 91
7 3300044673 Ga0453683_0007127 Ga0453683_0007127_4888_5166 91
8 3300044712 Ga0453684_0000295 Ga0453684_0000295_111398_111676 91
9 3300045051 Ga0451576_0005894 Ga0451576_0005894_1944_2222 91
10 3300032168 Ga0316593_10115032 Ga0316593_101150322 92
11 3300005290 Ga0065712_10693493 Ga0065712_106934931 93
12 3300005340 Ga0070689_100453005 Ga0070689_1004530052 93
13 3300005340 Ga0070689_102141255 Ga0070689_1021412551 93
14 3300005367 Ga0070667_101131486 Ga0070667_1011314862 93
15 3300005539 Ga0068853_100000004 Ga0068853_10000000496 93
16 3300006195 Ga0075366_10549464 Ga0075366_105494642 93
17 3300011119 Ga0105246_11645796 Ga0105246_116457961 93
18 3300025936 Ga0207670_11731623 Ga0207670_117316231 93
19 3300026041 Ga0207639_10000029 Ga0207639_10000029100 93
20 3300026095 Ga0207676_11014416 Ga0207676_110144162 93
21 3300037471 Ga0395905_0022619 Ga0395905_0022619_4025_4309 93
22 3300041512 Ga0451853_0034047 Ga0451853_0034047_100_384 93
23 3300044673 Ga0453683_0258891 Ga0453683_0258891_92_376 93
24 3300049161 Ga0501305_044170 Ga0501305_044170_415_699 93
25 3300049162 Ga0501307_024699 Ga0501307_024699_417_701 93
26 3300049162 Ga0501307_041252 Ga0501307_041252_343_627 93
27 3300049530 Ga0501314_045656 Ga0501314_045656_73_357 93
28 3300049665 Ga0501227_235951 Ga0501227_235951_196_480 93
29 3300005345 Ga0070692_10981398 Ga0070692_109813981 94
30 3300005536 Ga0070697_100919961 Ga0070697_1009199612 94
31 3300005536 Ga0070697_101206902 Ga0070697_1012069022 94
32 3300005546 Ga0070696_100669537 Ga0070696_1006695372 94
33 3300031239 Ga0265328_10005372 Ga0265328_100053725 94
34 3300031250 Ga0265331_10000090 Ga0265331_100000905 94
35 3300039437 Ga0436365_0308800 Ga0436365_0308800_239_571 94
36 3300039438 Ga0436360_0884324 Ga0436360_0884324_79_393 94
37 3300039453 Ga0436362_0347491 Ga0436362_0347491_158_484 94
38 3300044712 Ga0453684_0147058 Ga0453684_0147058_2218_2550 94
39 3300005343 Ga0070687_100001952 Ga0070687_10000195212 96
40 3300009094 Ga0111539_10563491 Ga0111539_105634912 96
41 3300021388 Ga0213875_10009336 Ga0213875_100093367 96
42 3300025918 Ga0207662_10000745 Ga0207662_1000074512 96
43 3300025939 Ga0207665_10327042 Ga0207665_103270422 96
44 3300031665 Ga0316575_10002995 Ga0316575_1000299510 96
45 3300031691 Ga0316579_10014492 Ga0316579_100144926 96
46 3300031727 Ga0316576_10018164 Ga0316576_100181645 96
47 3300031727 Ga0316576_10491746 Ga0316576_104917462 96
48 3300031728 Ga0316578_10033274 Ga0316578_100332742 96
49 3300031728 Ga0316578_10794577 Ga0316578_107945771 96
50 3300031733 Ga0316577_10012472 Ga0316577_100124726 96
51 3300032137 Ga0316585_10026458 Ga0316585_100264581 96
52 3300032168 Ga0316593_10222634 Ga0316593_102226342 96
53 3300032168 Ga0316593_10254773 Ga0316593_102547732 96
54 3300032168 Ga0316593_10259055 Ga0316593_102590552 96
55 3300033527 Ga0316586_1041122 Ga0316586_10411222 96
56 3300033541 Ga0316596_1097766 Ga0316596_10977662 96
57 3300035398 Ga0316574_0010007 Ga0316574_0010007_1738_2028 96
58 3300035398 Ga0316574_0530920 Ga0316574_0530920_85_375 96
59 3300036647 Ga0316582_0035019 Ga0316582_0035019_583_873 96
60 3300036647 Ga0316582_0079277 Ga0316582_0079277_1639_1929 96
61 3300036712 Ga0316584_0019219 Ga0316584_0019219_4047_4337 96
62 3300037853 Ga0436364_1407027 Ga0436364_1407027_6792_7082 96
63 3300042461 Ga0439460_0002577 Ga0439460_0002577_465_773 96
64 3300049573 Ga0501037_1096582 Ga0501037_1096582_84_404 96
65 3300050511 nmdc:mga08y16_481495_c1 nmdc:mga08y16_481495_c1_773_1063 96
66 3300013297 Ga0157378_10495841 Ga0157378_104958412 106
67 3300036401 Ga0373937_0672030 Ga0373937_0672030_288_611 106
68 3300049589 Ga0501073_0006261 Ga0501073_0006261_3848_4171 106
69 3300049590 Ga0501074_0122318 Ga0501074_0122318_1125_1448 106
70 3300005365 Ga0070688_100773247 Ga0070688_1007732472 107
71 3300028558 Ga0265326_10086852 Ga0265326_100868522 107
72 3300028573 Ga0265334_10003040 Ga0265334_100030404 107
73 3300028653 Ga0265323_10015822 Ga0265323_100158224 107
74 3300028653 Ga0265323_10018664 Ga0265323_100186643 107
75 3300028800 Ga0265338_10016967 Ga0265338_100169674 107
76 3300028800 Ga0265338_10132703 Ga0265338_101327033 107
77 3300031235 Ga0265330_10000541 Ga0265330_1000054131 107
78 3300031235 Ga0265330_10001334 Ga0265330_100013343 107
79 3300031235 Ga0265330_10009350 Ga0265330_100093509 107
80 3300031235 Ga0265330_10013183 Ga0265330_100131834 107
81 3300031238 Ga0265332_10336885 Ga0265332_103368852 107
82 3300031242 Ga0265329_10003473 Ga0265329_1000347314 107
83 3300031242 Ga0265329_10022198 Ga0265329_100221983 107
84 3300031242 Ga0265329_10151123 Ga0265329_101511231 107
85 3300031247 Ga0265340_10188620 Ga0265340_101886202 107
86 3300031249 Ga0265339_10287933 Ga0265339_102879332 107
87 3300031344 Ga0265316_10000251 Ga0265316_100002514 107
88 3300031344 Ga0265316_10000984 Ga0265316_1000098438 107
89 3300031344 Ga0265316_10010605 Ga0265316_100106058 107
90 3300031344 Ga0265316_10058086 Ga0265316_100580863 107
91 3300031344 Ga0265316_10068712 Ga0265316_100687123 107
92 3300031344 Ga0265316_10346857 Ga0265316_103468572 107
93 3300031712 Ga0265342_10008085 Ga0265342_100080853 107
94 3300031712 Ga0265342_10048044 Ga0265342_100480444 107
95 3300031712 Ga0265342_10204027 Ga0265342_102040271 107
96 3300042876 Ga0451577_0976860 Ga0451577_0976860_76_405 107
97 3300044712 Ga0453684_0000116 Ga0453684_0000116_247304_247633 107
98 3300044712 Ga0453684_0037288 Ga0453684_0037288_2133_2462 107
99 3300044712 Ga0453684_0093912 Ga0453684_0093912_1866_2195 107
100 3300044712 Ga0453684_1855622 Ga0453684_1855622_112_441 107
101 3300045051 Ga0451576_0121470 Ga0451576_0121470_1248_1577 107
102 3300046461 Ga0495641_0118286 Ga0495641_0118286_776_1102 107
103 3300002868 Ga0006767J43181_103125 Ga0006767J43181_1031252 108
104 3300002870 Ga0006763J43179_104103 Ga0006763J43179_1041032 108
105 3300003158 Ga0006760J45825_104057 Ga0006760J45825_1040572 108
106 3300003163 Ga0006759J45824_1006649 Ga0006759J45824_10066494 108
107 3300003163 Ga0006759J45824_1093956 Ga0006759J45824_10939562 108
108 3300003163 Ga0006759J45824_1158952 Ga0006759J45824_11589522 108
109 3300003300 Ga0006758J48902_1008419 Ga0006758J48902_10084192 108
110 3300003305 Ga0006770J48903_1041109 Ga0006770J48903_10411092 108
111 3300003323 rootH1_10067392 rootH1_100673923 108
112 3300003693 Ga0032354_1009872 Ga0032354_10098723 108
113 3300004798 Ga0058859_11239146 Ga0058859_112391462 108
114 3300004798 Ga0058859_11768657 Ga0058859_117686572 108
115 3300004798 Ga0058859_11779707 Ga0058859_117797072 108
116 3300005290 Ga0065712_10175385 Ga0065712_101753852 108
117 3300005293 Ga0065715_10346913 Ga0065715_103469132 108
118 3300005327 Ga0070658_10111351 Ga0070658_101113514 108
119 3300005328 Ga0070676_10278379 Ga0070676_102783792 108
120 3300005328 Ga0070676_11102779 Ga0070676_111027792 108
121 3300005329 Ga0070683_100082061 Ga0070683_1000820613 108
122 3300005329 Ga0070683_100093535 Ga0070683_1000935354 108
123 3300005329 Ga0070683_100095923 Ga0070683_1000959232 108
124 3300005329 Ga0070683_100293889 Ga0070683_1002938891 108
125 3300005329 Ga0070683_100910515 Ga0070683_1009105152 108
126 3300005329 Ga0070683_100972752 Ga0070683_1009727522 108
127 3300005329 Ga0070683_101273004 Ga0070683_1012730042 108
128 3300005330 Ga0070690_100079405 Ga0070690_1000794054 108
129 3300005330 Ga0070690_100216563 Ga0070690_1002165632 108
130 3300005330 Ga0070690_101707513 Ga0070690_1017075132 108
131 3300005331 Ga0070670_100034493 Ga0070670_1000344935 108
132 3300005331 Ga0070670_100690222 Ga0070670_1006902222 108
133 3300005331 Ga0070670_101540257 Ga0070670_1015402571 108
134 3300005334 Ga0068869_100700486 Ga0068869_1007004862 108
135 3300005334 Ga0068869_101075753 Ga0068869_1010757532 108
136 3300005335 Ga0070666_10254507 Ga0070666_102545072 108
137 3300005335 Ga0070666_10319417 Ga0070666_103194172 108
138 3300005336 Ga0070680_100078067 Ga0070680_1000780674 108
139 3300005336 Ga0070680_100997661 Ga0070680_1009976611 108
140 3300005336 Ga0070680_101073878 Ga0070680_1010738781 108
141 3300005337 Ga0070682_100189835 Ga0070682_1001898352 108
142 3300005337 Ga0070682_100198045 Ga0070682_1001980452 108
143 3300005337 Ga0070682_100403296 Ga0070682_1004032962 108
144 3300005337 Ga0070682_100893131 Ga0070682_1008931312 108
145 3300005337 Ga0070682_101378178 Ga0070682_1013781781 108
146 3300005338 Ga0068868_100467322 Ga0068868_1004673221 108
147 3300005338 Ga0068868_101251073 Ga0068868_1012510731 108
148 3300005338 Ga0068868_102198059 Ga0068868_1021980591 108
149 3300005339 Ga0070660_100562713 Ga0070660_1005627132 108
150 3300005339 Ga0070660_101356042 Ga0070660_1013560422 108
151 3300005340 Ga0070689_100000043 Ga0070689_1000000434 108
152 3300005340 Ga0070689_100080071 Ga0070689_1000800712 108
153 3300005340 Ga0070689_100157622 Ga0070689_1001576224 108
154 3300005340 Ga0070689_100178334 Ga0070689_1001783341 108
155 3300005340 Ga0070689_100614353 Ga0070689_1006143532 108
156 3300005341 Ga0070691_10066982 Ga0070691_100669823 108
157 3300005341 Ga0070691_10478747 Ga0070691_104787472 108
158 3300005343 Ga0070687_100034358 Ga0070687_1000343584 108
159 3300005343 Ga0070687_100282976 Ga0070687_1002829762 108
160 3300005343 Ga0070687_101410989 Ga0070687_1014109891 108
161 3300005344 Ga0070661_100586268 Ga0070661_1005862681 108
162 3300005345 Ga0070692_10067654 Ga0070692_100676542 108
163 3300005347 Ga0070668_100250387 Ga0070668_1002503873 108
164 3300005347 Ga0070668_101912527 Ga0070668_1019125271 108
165 3300005353 Ga0070669_100066027 Ga0070669_1000660273 108
166 3300005354 Ga0070675_100235508 Ga0070675_1002355083 108
167 3300005354 Ga0070675_100246062 Ga0070675_1002460622 108
168 3300005355 Ga0070671_101116695 Ga0070671_1011166952 108
169 3300005355 Ga0070671_101516481 Ga0070671_1015164812 108
170 3300005356 Ga0070674_100116088 Ga0070674_1001160884 108
171 3300005356 Ga0070674_101419954 Ga0070674_1014199541 108
172 3300005364 Ga0070673_100036693 Ga0070673_1000366935 108
173 3300005364 Ga0070673_100091524 Ga0070673_1000915243 108
174 3300005364 Ga0070673_102040137 Ga0070673_1020401372 108
175 3300005365 Ga0070688_100032408 Ga0070688_1000324081 108
176 3300005365 Ga0070688_100061965 Ga0070688_1000619654 108
177 3300005365 Ga0070688_100294589 Ga0070688_1002945891 108
178 3300005365 Ga0070688_100847836 Ga0070688_1008478362 108
179 3300005365 Ga0070688_100936868 Ga0070688_1009368682 108
180 3300005366 Ga0070659_100180238 Ga0070659_1001802384 108
181 3300005367 Ga0070667_100204537 Ga0070667_1002045372 108
182 3300005367 Ga0070667_100309483 Ga0070667_1003094832 108
183 3300005367 Ga0070667_102093951 Ga0070667_1020939511 108
184 3300005434 Ga0070709_10272743 Ga0070709_102727432 108
185 3300005434 Ga0070709_10792312 Ga0070709_107923122 108
186 3300005436 Ga0070713_101158800 Ga0070713_1011588001 108
187 3300005436 Ga0070713_101371109 Ga0070713_1013711091 108
188 3300005437 Ga0070710_10149428 Ga0070710_101494281 108
189 3300005438 Ga0070701_10077689 Ga0070701_100776893 108
190 3300005438 Ga0070701_10873261 Ga0070701_108732612 108
191 3300005439 Ga0070711_100214813 Ga0070711_1002148133 108
192 3300005440 Ga0070705_100067352 Ga0070705_1000673522 108
193 3300005440 Ga0070705_101156657 Ga0070705_1011566571 108
194 3300005441 Ga0070700_100019232 Ga0070700_1000192327 108
195 3300005441 Ga0070700_100560814 Ga0070700_1005608142 108
196 3300005441 Ga0070700_101329846 Ga0070700_1013298462 108
197 3300005444 Ga0070694_101298826 Ga0070694_1012988262 108
198 3300005445 Ga0070708_101918034 Ga0070708_1019180342 108
199 3300005456 Ga0070678_100061341 Ga0070678_1000613414 108
200 3300005456 Ga0070678_100745075 Ga0070678_1007450752 108
201 3300005456 Ga0070678_101483080 Ga0070678_1014830802 108
202 3300005457 Ga0070662_100030416 Ga0070662_1000304163 108
203 3300005458 Ga0070681_10775056 Ga0070681_107750562 108
204 3300005458 Ga0070681_10947926 Ga0070681_109479262 108
205 3300005459 Ga0068867_100680719 Ga0068867_1006807192 108
206 3300005459 Ga0068867_100725051 Ga0068867_1007250512 108
207 3300005466 Ga0070685_10052343 Ga0070685_100523434 108
208 3300005466 Ga0070685_10109607 Ga0070685_101096072 108
209 3300005466 Ga0070685_10160181 Ga0070685_101601811 108
210 3300005466 Ga0070685_10477584 Ga0070685_104775842 108
211 3300005467 Ga0070706_101199227 Ga0070706_1011992272 108
212 3300005467 Ga0070706_102074715 Ga0070706_1020747152 108
213 3300005471 Ga0070698_100648628 Ga0070698_1006486282 108
214 3300005530 Ga0070679_100029036 Ga0070679_1000290364 108
215 3300005530 Ga0070679_100190634 Ga0070679_1001906341 108
216 3300005530 Ga0070679_100290785 Ga0070679_1002907854 108
217 3300005535 Ga0070684_100058335 Ga0070684_1000583353 108
218 3300005535 Ga0070684_100136595 Ga0070684_1001365952 108
219 3300005535 Ga0070684_100400359 Ga0070684_1004003592 108
220 3300005535 Ga0070684_100532982 Ga0070684_1005329822 108
221 3300005535 Ga0070684_100741356 Ga0070684_1007413562 108
222 3300005535 Ga0070684_101074725 Ga0070684_1010747252 108
223 3300005535 Ga0070684_101811665 Ga0070684_1018116652 108
224 3300005536 Ga0070697_101650823 Ga0070697_1016508231 108
225 3300005539 Ga0068853_100267348 Ga0068853_1002673482 108
226 3300005539 Ga0068853_100293961 Ga0068853_1002939611 108
227 3300005539 Ga0068853_102484884 Ga0068853_1024848842 108
228 3300005543 Ga0070672_100042880 Ga0070672_1000428804 108
229 3300005543 Ga0070672_100102627 Ga0070672_1001026274 108
230 3300005543 Ga0070672_100488954 Ga0070672_1004889542 108
231 3300005544 Ga0070686_100016687 Ga0070686_1000166874 108
232 3300005544 Ga0070686_100046683 Ga0070686_1000466834 108
233 3300005544 Ga0070686_100433255 Ga0070686_1004332551 108
234 3300005544 Ga0070686_100831462 Ga0070686_1008314621 108
235 3300005548 Ga0070665_100342825 Ga0070665_1003428253 108
236 3300005548 Ga0070665_101619982 Ga0070665_1016199822 108
237 3300005563 Ga0068855_100076432 Ga0068855_1000764322 108
238 3300005563 Ga0068855_100152247 Ga0068855_1001522473 108
239 3300005563 Ga0068855_100153786 Ga0068855_1001537862 108
240 3300005577 Ga0068857_100171461 Ga0068857_1001714612 108
241 3300005577 Ga0068857_101935815 Ga0068857_1019358151 108
242 3300005577 Ga0068857_102428114 Ga0068857_1024281142 108
243 3300005614 Ga0068856_100060062 Ga0068856_1000600622 108
244 3300005614 Ga0068856_100231627 Ga0068856_1002316274 108
245 3300005614 Ga0068856_100367002 Ga0068856_1003670022 108
246 3300005615 Ga0070702_100176947 Ga0070702_1001769472 108
247 3300005615 Ga0070702_100393589 Ga0070702_1003935891 108
248 3300005615 Ga0070702_100845384 Ga0070702_1008453841 108
249 3300005616 Ga0068852_100443584 Ga0068852_1004435843 108
250 3300005616 Ga0068852_100771108 Ga0068852_1007711082 108
251 3300005616 Ga0068852_101328740 Ga0068852_1013287402 108
252 3300005617 Ga0068859_100042834 Ga0068859_1000428344 108
253 3300005617 Ga0068859_100180325 Ga0068859_1001803253 108
254 3300005618 Ga0068864_102184926 Ga0068864_1021849262 108
255 3300005618 Ga0068864_102593756 Ga0068864_1025937561 108
256 3300005718 Ga0068866_10268249 Ga0068866_102682492 108
257 3300005718 Ga0068866_10350800 Ga0068866_103508002 108
258 3300005719 Ga0068861_100046691 Ga0068861_1000466912 108
259 3300005841 Ga0068863_100316875 Ga0068863_1003168751 108
260 3300005841 Ga0068863_100492968 Ga0068863_1004929682 108
261 3300005841 Ga0068863_102415467 Ga0068863_1024154671 108
262 3300005843 Ga0068860_100481748 Ga0068860_1004817482 108
263 3300005843 Ga0068860_100484640 Ga0068860_1004846402 108
264 3300005843 Ga0068860_101608691 Ga0068860_1016086911 108
265 3300005844 Ga0068862_101532282 Ga0068862_1015322822 108
266 3300005844 Ga0068862_101736155 Ga0068862_1017361551 108
267 3300005937 Ga0081455_10113380 Ga0081455_101133802 108
268 3300006028 Ga0070717_11208333 Ga0070717_112083332 108
269 3300006173 Ga0070716_100264302 Ga0070716_1002643022 108
270 3300006173 Ga0070716_100870745 Ga0070716_1008707452 108
271 3300006175 Ga0070712_100331620 Ga0070712_1003316202 108
272 3300006237 Ga0097621_100716854 Ga0097621_1007168541 108
273 3300006237 Ga0097621_101186330 Ga0097621_1011863301 108
274 3300006358 Ga0068871_100672501 Ga0068871_1006725012 108
275 3300006358 Ga0068871_101274853 Ga0068871_1012748532 108
276 3300006358 Ga0068871_101277471 Ga0068871_1012774712 108
277 3300006358 Ga0068871_102006037 Ga0068871_1020060371 108
278 3300006358 Ga0068871_102035268 Ga0068871_1020352682 108
279 3300006844 Ga0075428_102059615 Ga0075428_1020596152 108
280 3300006852 Ga0075433_11428935 Ga0075433_114289352 108
281 3300006871 Ga0075434_100727321 Ga0075434_1007273211 108
282 3300006881 Ga0068865_100279850 Ga0068865_1002798502 108
283 3300006881 Ga0068865_100582500 Ga0068865_1005825002 108
284 3300006881 Ga0068865_100829526 Ga0068865_1008295262 108
285 3300006881 Ga0068865_101252525 Ga0068865_1012525251 108
286 3300006914 Ga0075436_101014650 Ga0075436_1010146501 108
287 3300006931 Ga0097620_100042837 Ga0097620_1000428374 108
288 3300006931 Ga0097620_100180328 Ga0097620_1001803283 108
289 3300009093 Ga0105240_10000795 Ga0105240_100007958 108
290 3300009093 Ga0105240_10318108 Ga0105240_103181083 108
291 3300009093 Ga0105240_10951372 Ga0105240_109513722 108
292 3300009094 Ga0111539_10165120 Ga0111539_101651205 108
293 3300009094 Ga0111539_11404632 Ga0111539_114046321 108
294 3300009098 Ga0105245_10326263 Ga0105245_103262632 108
295 3300009098 Ga0105245_10364874 Ga0105245_103648742 108
296 3300009098 Ga0105245_10402423 Ga0105245_104024233 108
297 3300009098 Ga0105245_12253441 Ga0105245_122534411 108
298 3300009098 Ga0105245_12678882 Ga0105245_126788822 108
299 3300009101 Ga0105247_11095213 Ga0105247_110952132 108
300 3300009147 Ga0114129_10569212 Ga0114129_105692122 108
301 3300009148 Ga0105243_11565369 Ga0105243_115653691 108
302 3300009174 Ga0105241_10505368 Ga0105241_105053682 108
303 3300009176 Ga0105242_10638967 Ga0105242_106389672 108
304 3300009545 Ga0105237_10002220 Ga0105237_1000222037 108
305 3300009545 Ga0105237_10201518 Ga0105237_102015182 108
306 3300009545 Ga0105237_11078049 Ga0105237_110780492 108
307 3300009545 Ga0105237_11492670 Ga0105237_114926701 108
308 3300009551 Ga0105238_10056048 Ga0105238_100560486 108
309 3300009551 Ga0105238_10686083 Ga0105238_106860832 108
310 3300009551 Ga0105238_12147164 Ga0105238_121471642 108
311 3300010375 Ga0105239_10284944 Ga0105239_102849443 108
312 3300010375 Ga0105239_11745225 Ga0105239_117452252 108
313 3300010375 Ga0105239_12755137 Ga0105239_127551372 108
314 3300011119 Ga0105246_12128475 Ga0105246_121284751 108
315 3300013102 Ga0157371_10325770 Ga0157371_103257702 108
316 3300013296 Ga0157374_10054827 Ga0157374_100548272 108
317 3300013296 Ga0157374_11075912 Ga0157374_110759122 108
318 3300013297 Ga0157378_10487709 Ga0157378_104877091 108
319 3300013297 Ga0157378_10724834 Ga0157378_107248342 108
320 3300013306 Ga0163162_10162216 Ga0163162_101622163 108
321 3300013307 Ga0157372_10918100 Ga0157372_109181002 108
322 3300013307 Ga0157372_10966444 Ga0157372_109664442 108
323 3300013307 Ga0157372_12714985 Ga0157372_127149852 108
324 3300013308 Ga0157375_11266341 Ga0157375_112663412 108
325 3300013308 Ga0157375_11962180 Ga0157375_119621802 108
326 3300014325 Ga0163163_11226335 Ga0163163_112263352 108
327 3300014326 Ga0157380_10983976 Ga0157380_109839762 108
328 3300014326 Ga0157380_11404115 Ga0157380_114041152 108
329 3300014745 Ga0157377_10462162 Ga0157377_104621622 108
330 3300014968 Ga0157379_10164923 Ga0157379_101649234 108
331 3300014968 Ga0157379_12035381 Ga0157379_120353811 108
332 3300014969 Ga0157376_10253275 Ga0157376_102532754 108
333 3300014969 Ga0157376_10655572 Ga0157376_106555722 108
334 3300014969 Ga0157376_10846268 Ga0157376_108462682 108
335 3300020078 Ga0206352_10638828 Ga0206352_106388282 108
336 3300020078 Ga0206352_11129659 Ga0206352_111296592 108
337 3300025271 Ga0207666_1000994 Ga0207666_10009945 108
338 3300025898 Ga0207692_10701363 Ga0207692_107013632 108
339 3300025901 Ga0207688_10588246 Ga0207688_105882462 108
340 3300025903 Ga0207680_10036485 Ga0207680_100364853 108
341 3300025906 Ga0207699_10193517 Ga0207699_101935172 108
342 3300025906 Ga0207699_10530758 Ga0207699_105307582 108
343 3300025907 Ga0207645_10026906 Ga0207645_100269066 108
344 3300025908 Ga0207643_10748640 Ga0207643_107486401 108
345 3300025908 Ga0207643_11083284 Ga0207643_110832842 108
346 3300025909 Ga0207705_10026045 Ga0207705_100260456 108
347 3300025910 Ga0207684_11005027 Ga0207684_110050272 108
348 3300025911 Ga0207654_10400479 Ga0207654_104004792 108
349 3300025912 Ga0207707_10055935 Ga0207707_100559352 108
350 3300025912 Ga0207707_10433520 Ga0207707_104335202 108
351 3300025912 Ga0207707_10659437 Ga0207707_106594372 108
352 3300025913 Ga0207695_10000834 Ga0207695_1000083432 108
353 3300025913 Ga0207695_10283316 Ga0207695_102833162 108
354 3300025914 Ga0207671_10000510 Ga0207671_1000051030 108
355 3300025914 Ga0207671_10006782 Ga0207671_1000678217 108
356 3300025914 Ga0207671_10343405 Ga0207671_103434052 108
357 3300025915 Ga0207693_10420783 Ga0207693_104207832 108
358 3300025916 Ga0207663_10548379 Ga0207663_105483792 108
359 3300025917 Ga0207660_10081230 Ga0207660_100812302 108
360 3300025917 Ga0207660_11578348 Ga0207660_115783481 108
361 3300025918 Ga0207662_10057285 Ga0207662_100572853 108
362 3300025918 Ga0207662_10080129 Ga0207662_100801292 108
363 3300025918 Ga0207662_10184853 Ga0207662_101848532 108
364 3300025919 Ga0207657_10184384 Ga0207657_101843842 108
365 3300025919 Ga0207657_10651981 Ga0207657_106519812 108
366 3300025920 Ga0207649_10617610 Ga0207649_106176102 108
367 3300025921 Ga0207652_10091748 Ga0207652_100917481 108
368 3300025921 Ga0207652_10249882 Ga0207652_102498821 108
369 3300025921 Ga0207652_11394684 Ga0207652_113946842 108
370 3300025921 Ga0207652_11482574 Ga0207652_114825742 108
371 3300025923 Ga0207681_10002742 Ga0207681_1000274220 108
372 3300025924 Ga0207694_10019794 Ga0207694_100197949 108
373 3300025924 Ga0207694_10334653 Ga0207694_103346532 108
374 3300025924 Ga0207694_10546681 Ga0207694_105466812 108
375 3300025924 Ga0207694_10998884 Ga0207694_109988842 108
376 3300025925 Ga0207650_10331885 Ga0207650_103318852 108
377 3300025925 Ga0207650_10412449 Ga0207650_104124492 108
378 3300025926 Ga0207659_10178033 Ga0207659_101780333 108
379 3300025927 Ga0207687_10080679 Ga0207687_100806795 108
380 3300025927 Ga0207687_11208432 Ga0207687_112084322 108
381 3300025928 Ga0207700_10241544 Ga0207700_102415442 108
382 3300025929 Ga0207664_10987838 Ga0207664_109878382 108
383 3300025931 Ga0207644_10244061 Ga0207644_102440612 108
384 3300025931 Ga0207644_11584875 Ga0207644_115848752 108
385 3300025931 Ga0207644_11717683 Ga0207644_117176832 108
386 3300025932 Ga0207690_10294826 Ga0207690_102948263 108
387 3300025933 Ga0207706_10050162 Ga0207706_100501624 108
388 3300025933 Ga0207706_10704768 Ga0207706_107047682 108
389 3300025934 Ga0207686_10564906 Ga0207686_105649062 108
390 3300025936 Ga0207670_10000022 Ga0207670_10000022134 108
391 3300025936 Ga0207670_10033174 Ga0207670_100331742 108
392 3300025936 Ga0207670_10038900 Ga0207670_100389005 108
393 3300025936 Ga0207670_10583824 Ga0207670_105838242 108
394 3300025936 Ga0207670_10971512 Ga0207670_109715122 108
395 3300025936 Ga0207670_11466375 Ga0207670_114663751 108
396 3300025937 Ga0207669_10032783 Ga0207669_100327834 108
397 3300025938 Ga0207704_10215606 Ga0207704_102156063 108
398 3300025938 Ga0207704_10969184 Ga0207704_109691841 108
399 3300025938 Ga0207704_11159472 Ga0207704_111594722 108
400 3300025940 Ga0207691_10111430 Ga0207691_101114302 108
401 3300025940 Ga0207691_10195137 Ga0207691_101951372 108
402 3300025940 Ga0207691_10205570 Ga0207691_102055702 108
403 3300025942 Ga0207689_10079744 Ga0207689_100797444 108
404 3300025942 Ga0207689_11475473 Ga0207689_114754732 108
405 3300025944 Ga0207661_10053370 Ga0207661_100533704 108
406 3300025944 Ga0207661_10394917 Ga0207661_103949172 108
407 3300025944 Ga0207661_10684704 Ga0207661_106847042 108
408 3300025944 Ga0207661_11074409 Ga0207661_110744092 108
409 3300025949 Ga0207667_10023566 Ga0207667_1002356611 108
410 3300025949 Ga0207667_10209758 Ga0207667_102097584 108
411 3300025949 Ga0207667_10299139 Ga0207667_102991394 108
412 3300025949 Ga0207667_10505733 Ga0207667_105057331 108
413 3300025960 Ga0207651_10007125 Ga0207651_100071254 108
414 3300025960 Ga0207651_10057682 Ga0207651_100576824 108
415 3300025960 Ga0207651_10149277 Ga0207651_101492773 108
416 3300025960 Ga0207651_10250285 Ga0207651_102502852 108
417 3300025972 Ga0207668_10166349 Ga0207668_101663492 108
418 3300025972 Ga0207668_11489344 Ga0207668_114893441 108
419 3300025972 Ga0207668_12056919 Ga0207668_120569192 108
420 3300025981 Ga0207640_10144783 Ga0207640_101447832 108
421 3300025986 Ga0207658_10301364 Ga0207658_103013642 108
422 3300025986 Ga0207658_10629819 Ga0207658_106298191 108
423 3300025986 Ga0207658_10685249 Ga0207658_106852492 108
424 3300026023 Ga0207677_10134658 Ga0207677_101346581 108
425 3300026023 Ga0207677_10205289 Ga0207677_102052893 108
426 3300026023 Ga0207677_10417879 Ga0207677_104178792 108
427 3300026041 Ga0207639_10005667 Ga0207639_1000566716 108
428 3300026041 Ga0207639_10042182 Ga0207639_100421821 108
429 3300026075 Ga0207708_10012451 Ga0207708_100124514 108
430 3300026075 Ga0207708_10801332 Ga0207708_108013322 108
431 3300026078 Ga0207702_10204836 Ga0207702_102048362 108
432 3300026078 Ga0207702_10362040 Ga0207702_103620402 108
433 3300026078 Ga0207702_10461801 Ga0207702_104618012 108
434 3300026088 Ga0207641_10549601 Ga0207641_105496012 108
435 3300026088 Ga0207641_12000603 Ga0207641_120006032 108
436 3300026088 Ga0207641_12077650 Ga0207641_120776502 108
437 3300026089 Ga0207648_10011154 Ga0207648_1001115418 108
438 3300026089 Ga0207648_11346760 Ga0207648_113467601 108
439 3300026095 Ga0207676_10628970 Ga0207676_106289702 108
440 3300026095 Ga0207676_11370606 Ga0207676_113706062 108
441 3300026095 Ga0207676_12115241 Ga0207676_121152411 108
442 3300026116 Ga0207674_10143954 Ga0207674_101439542 108
443 3300026116 Ga0207674_11429596 Ga0207674_114295962 108
444 3300026118 Ga0207675_100013850 Ga0207675_10001385015 108
445 3300026118 Ga0207675_100523954 Ga0207675_1005239542 108
446 3300026121 Ga0207683_10055874 Ga0207683_100558745 108
447 3300026121 Ga0207683_10406889 Ga0207683_104068893 108
448 3300026121 Ga0207683_11608085 Ga0207683_116080851 108
449 3300026142 Ga0207698_10740360 Ga0207698_107403602 108
450 3300027717 Ga0209998_10134052 Ga0209998_101340521 108
451 3300027876 Ga0209974_10047202 Ga0209974_100472022 108
452 3300027907 Ga0207428_10071472 Ga0207428_100714722 108
453 3300028379 Ga0268266_11113797 Ga0268266_111137972 108
454 3300028380 Ga0268265_10053988 Ga0268265_100539885 108
455 3300028380 Ga0268265_11176573 Ga0268265_111765732 108
456 3300028380 Ga0268265_12459148 Ga0268265_124591482 108
457 3300028381 Ga0268264_11590237 Ga0268264_115902372 108
458 3300028381 Ga0268264_11795831 Ga0268264_117958312 108
459 3300028556 Ga0265337_1016213 Ga0265337_10162133 108
460 3300028556 Ga0265337_1019764 Ga0265337_10197642 108
461 3300028563 Ga0265319_1022863 Ga0265319_10228633 108
462 3300028563 Ga0265319_1028578 Ga0265319_10285785 108
463 3300028563 Ga0265319_1066428 Ga0265319_10664282 108
464 3300028577 Ga0265318_10000169 Ga0265318_100001694 108
465 3300028577 Ga0265318_10000384 Ga0265318_1000038412 108
466 3300028577 Ga0265318_10033468 Ga0265318_100334684 108
467 3300028653 Ga0265323_10003319 Ga0265323_100033197 108
468 3300028653 Ga0265323_10015991 Ga0265323_100159914 108
469 3300028653 Ga0265323_10051237 Ga0265323_100512373 108
470 3300028654 Ga0265322_10007541 Ga0265322_100075416 108
471 3300028654 Ga0265322_10012481 Ga0265322_100124815 108
472 3300028666 Ga0265336_10016694 Ga0265336_100166944 108
473 3300028666 Ga0265336_10184290 Ga0265336_101842902 108
474 3300028666 Ga0265336_10201627 Ga0265336_102016271 108
475 3300028800 Ga0265338_10001810 Ga0265338_1000181010 108
476 3300028800 Ga0265338_10143543 Ga0265338_101435432 108
477 3300028800 Ga0265338_10161608 Ga0265338_101616081 108
478 3300028800 Ga0265338_10251224 Ga0265338_102512242 108
479 3300028800 Ga0265338_10529671 Ga0265338_105296712 108
480 3300028800 Ga0265338_10794916 Ga0265338_107949162 108
481 3300029957 Ga0265324_10005897 Ga0265324_100058979 108
482 3300029957 Ga0265324_10052976 Ga0265324_100529761 108
483 3300029957 Ga0265324_10291215 Ga0265324_102912152 108
484 3300031235 Ga0265330_10000068 Ga0265330_1000006897 108
485 3300031235 Ga0265330_10003962 Ga0265330_100039629 108
486 3300031235 Ga0265330_10065761 Ga0265330_100657612 108
487 3300031235 Ga0265330_10265117 Ga0265330_102651172 108
488 3300031238 Ga0265332_10001607 Ga0265332_100016074 108
489 3300031238 Ga0265332_10005477 Ga0265332_100054772 108
490 3300031238 Ga0265332_10035759 Ga0265332_100357592 108
491 3300031238 Ga0265332_10041106 Ga0265332_100411062 108
492 3300031239 Ga0265328_10000172 Ga0265328_1000017212 108
493 3300031239 Ga0265328_10000528 Ga0265328_1000052825 108
494 3300031239 Ga0265328_10004363 Ga0265328_100043632 108
495 3300031239 Ga0265328_10187915 Ga0265328_101879151 108
496 3300031240 Ga0265320_10000069 Ga0265320_100000694 108
497 3300031240 Ga0265320_10005252 Ga0265320_100052524 108
498 3300031240 Ga0265320_10017635 Ga0265320_100176355 108
499 3300031240 Ga0265320_10040972 Ga0265320_100409722 108
500 3300031240 Ga0265320_10188685 Ga0265320_101886852 108
501 3300031240 Ga0265320_10476221 Ga0265320_104762212 108
502 3300031241 Ga0265325_10089603 Ga0265325_100896032 108
503 3300031241 Ga0265325_10158897 Ga0265325_101588972 108
504 3300031241 Ga0265325_10176509 Ga0265325_101765092 108
505 3300031241 Ga0265325_10206962 Ga0265325_102069622 108
506 3300031242 Ga0265329_10000733 Ga0265329_1000073329 108
507 3300031242 Ga0265329_10010575 Ga0265329_100105754 108
508 3300031242 Ga0265329_10097232 Ga0265329_100972322 108
509 3300031247 Ga0265340_10007508 Ga0265340_100075084 108
510 3300031247 Ga0265340_10061476 Ga0265340_100614762 108
511 3300031249 Ga0265339_10000001 Ga0265339_10000001270 108
512 3300031249 Ga0265339_10006249 Ga0265339_100062496 108
513 3300031249 Ga0265339_10006835 Ga0265339_1000683514 108
514 3300031249 Ga0265339_10018501 Ga0265339_100185014 108
515 3300031249 Ga0265339_10022740 Ga0265339_100227403 108
516 3300031249 Ga0265339_10032693 Ga0265339_100326935 108
517 3300031249 Ga0265339_10058815 Ga0265339_100588152 108
518 3300031249 Ga0265339_10075283 Ga0265339_100752832 108
519 3300031249 Ga0265339_10147825 Ga0265339_101478253 108
520 3300031250 Ga0265331_10000149 Ga0265331_1000014997 108
521 3300031250 Ga0265331_10001210 Ga0265331_1000121033 108
522 3300031250 Ga0265331_10056308 Ga0265331_100563082 108
523 3300031344 Ga0265316_10006437 Ga0265316_100064374 108
524 3300031344 Ga0265316_10012440 Ga0265316_100124408 108
525 3300031344 Ga0265316_10015836 Ga0265316_1001583612 108
526 3300031344 Ga0265316_10024979 Ga0265316_100249799 108
527 3300031344 Ga0265316_10037888 Ga0265316_100378884 108
528 3300031344 Ga0265316_10076461 Ga0265316_100764614 108
529 3300031344 Ga0265316_10523947 Ga0265316_105239472 108
530 3300031548 Ga0307408_102063440 Ga0307408_1020634402 108
531 3300031595 Ga0265313_10003761 Ga0265313_100037615 108
532 3300031595 Ga0265313_10006146 Ga0265313_100061467 108
533 3300031595 Ga0265313_10035771 Ga0265313_100357713 108
534 3300031595 Ga0265313_10043972 Ga0265313_100439722 108
535 3300031595 Ga0265313_10064585 Ga0265313_100645852 108
536 3300031711 Ga0265314_10000109 Ga0265314_100001094 108
537 3300031711 Ga0265314_10000191 Ga0265314_1000019198 108
538 3300031711 Ga0265314_10001397 Ga0265314_1000139727 108
539 3300031711 Ga0265314_10004534 Ga0265314_100045344 108
540 3300031711 Ga0265314_10012182 Ga0265314_1001218214 108
541 3300031711 Ga0265314_10023062 Ga0265314_100230622 108
542 3300031711 Ga0265314_10074680 Ga0265314_100746803 108
543 3300031711 Ga0265314_10113712 Ga0265314_101137122 108
544 3300031712 Ga0265342_10000812 Ga0265342_100008124 108
545 3300031712 Ga0265342_10001254 Ga0265342_100012544 108
546 3300031712 Ga0265342_10001889 Ga0265342_100018894 108
547 3300031712 Ga0265342_10002136 Ga0265342_100021364 108
548 3300031712 Ga0265342_10004388 Ga0265342_100043889 108
549 3300031712 Ga0265342_10006355 Ga0265342_100063552 108
550 3300031712 Ga0265342_10028395 Ga0265342_100283956 108
551 3300031712 Ga0265342_10029446 Ga0265342_100294467 108
552 3300031712 Ga0265342_10046425 Ga0265342_100464254 108
553 3300031889 Ga0326468_10027368 Ga0326468_100273682 108
554 3300033524 Ga0316592_1128347 Ga0316592_11283472 108
555 3300033528 Ga0316588_1001749 Ga0316588_10017494 108
556 3300033528 Ga0316588_1050233 Ga0316588_10502332 108
557 3300033529 Ga0316587_1001986 Ga0316587_10019862 108
558 3300034818 Ga0373950_0000002 Ga0373950_0000002_1179_1505 108
559 3300034818 Ga0373950_0000319 Ga0373950_0000319_4623_4952 108
560 3300035086 Ga0373934_0015071 Ga0373934_0015071_35_361 108
561 3300035086 Ga0373934_0074325 Ga0373934_0074325_659_988 108
562 3300035086 Ga0373934_0279879 Ga0373934_0279879_23_355 108
563 3300035088 Ga0373940_0185842 Ga0373940_0185842_119_448 108
564 3300035089 Ga0373944_0309337 Ga0373944_0309337_16_345 108
565 3300035111 Ga0373923_0064505 Ga0373923_0064505_242_571 108
566 3300035111 Ga0373923_0276690 Ga0373923_0276690_92_418 108
567 3300035113 Ga0373936_0125773 Ga0373936_0125773_235_564 108
568 3300035116 Ga0373945_0196582 Ga0373945_0196582_488_817 108
569 3300035117 Ga0373953_0007606 Ga0373953_0007606_3272_3601 108
570 3300035118 Ga0373954_0013761 Ga0373954_0013761_921_1250 108
571 3300035118 Ga0373954_0061229 Ga0373954_0061229_697_1029 108
572 3300035118 Ga0373954_0067157 Ga0373954_0067157_1325_1654 108
573 3300035118 Ga0373954_0118115 Ga0373954_0118115_347_676 108
574 3300035118 Ga0373954_0290057 Ga0373954_0290057_379_705 108
575 3300035119 Ga0373956_0024460 Ga0373956_0024460_152_487 108
576 3300035119 Ga0373956_0029287 Ga0373956_0029287_864_1193 108
577 3300035119 Ga0373956_0181043 Ga0373956_0181043_16_345 108
578 3300035119 Ga0373956_0181170 Ga0373956_0181170_264_596 108
579 3300035120 Ga0373957_0050880 Ga0373957_0050880_164_493 108
580 3300035170 Ga0373943_0026949 Ga0373943_0026949_1046_1375 108
581 3300035170 Ga0373943_0218286 Ga0373943_0218286_544_876 108
582 3300035171 Ga0373946_0472468 Ga0373946_0472468_58_387 108
583 3300035172 Ga0373955_0050551 Ga0373955_0050551_1201_1527 108
584 3300035172 Ga0373955_0053472 Ga0373955_0053472_1266_1595 108
585 3300035172 Ga0373955_0077472 Ga0373955_0077472_452_781 108
586 3300035172 Ga0373955_0086843 Ga0373955_0086843_1103_1432 108
587 3300035172 Ga0373955_0376090 Ga0373955_0376090_243_572 108
588 3300035241 Ga0373961_0073517 Ga0373961_0073517_601_930 108
589 3300035410 Ga0373924_0146534 Ga0373924_0146534_643_972 108
590 3300035410 Ga0373924_0215395 Ga0373924_0215395_50_379 108
591 3300035692 Ga0373935_0169727 Ga0373935_0169727_918_1247 108
592 3300035695 Ga0373927_0054262 Ga0373927_0054262_1974_2303 108
593 3300035695 Ga0373927_0489562 Ga0373927_0489562_83_415 108
594 3300035724 Ga0373933_0001189 Ga0373933_0001189_1219_1545 108
595 3300035724 Ga0373933_0083785 Ga0373933_0083785_1108_1440 108
596 3300035724 Ga0373933_0178406 Ga0373933_0178406_287_616 108
597 3300035724 Ga0373933_0437766 Ga0373933_0437766_169_498 108
598 3300035725 Ga0373947_0055815 Ga0373947_0055815_1068_1397 108
599 3300036401 Ga0373937_0013762 Ga0373937_0013762_5144_5476 108
600 3300036401 Ga0373937_0051912 Ga0373937_0051912_660_989 108
601 3300036401 Ga0373937_0058959 Ga0373937_0058959_1743_2072 108
602 3300036401 Ga0373937_0096824 Ga0373937_0096824_606_935 108
603 3300036401 Ga0373937_0118014 Ga0373937_0118014_1228_1554 108
604 3300036401 Ga0373937_1423189 Ga0373937_1423189_27_359 108
605 3300037068 Ga0373925_0117963 Ga0373925_0117963_279_608 108
606 3300037068 Ga0373925_0900369 Ga0373925_0900369_95_424 108
607 3300041458 Ga0451798_0319564 Ga0451798_0319564_194_523 108
608 3300041460 Ga0451802_0662359 Ga0451802_0662359_149_478 108
609 3300041486 Ga0451807_1468954 Ga0451807_1468954_1077_1406 108
610 3300041486 Ga0451807_1832672 Ga0451807_1832672_57_386 108
611 3300041491 Ga0451833_0549793 Ga0451833_0549793_128_457 108
612 3300044684 Ga0466966_0600212 Ga0466966_0600212_158_487 108
613 3300044712 Ga0453684_0085870 Ga0453684_0085870_2315_2647 108
614 3300044712 Ga0453684_0789668 Ga0453684_0789668_403_735 108
615 3300044719 Ga0466971_0068907 Ga0466971_0068907_669_998 108
616 3300045051 Ga0451576_1808345 Ga0451576_1808345_113_445 108
617 3300045976 Ga0466967_0701760 Ga0466967_0701760_300_629 108
618 3300046457 Ga0495590_0292163 Ga0495590_0292163_149_478 108
619 3300046477 Ga0495664_0153025 Ga0495664_0153025_1027_1356 108
620 3300046500 Ga0495596_0361082 Ga0495596_0361082_156_485 108
621 3300046517 Ga0495630_0003551 Ga0495630_0003551_5969_6298 108
622 3300046517 Ga0495630_0140876 Ga0495630_0140876_1125_1457 108
623 3300046517 Ga0495630_0514425 Ga0495630_0514425_384_713 108
624 3300046529 Ga0495652_0258563 Ga0495652_0258563_591_920 108
625 3300046535 Ga0495586_0057737 Ga0495586_0057737_1518_1847 108
626 3300046536 Ga0495587_0096111 Ga0495587_0096111_1247_1576 108
627 3300046536 Ga0495587_0511027 Ga0495587_0511027_48_380 108
628 3300046543 Ga0495645_0229080 Ga0495645_0229080_853_1182 108
629 3300046642 Ga0495634_0000649 Ga0495634_0000649_1137_1466 108
630 3300046663 Ga0495635_0305100 Ga0495635_0305100_83_412 108
631 3300046689 Ga0495613_0308712 Ga0495613_0308712_393_722 108
632 3300046690 Ga0495624_0493552 Ga0495624_0493552_341_673 108
633 3300047319 Ga0495674_0001336 Ga0495674_0001336_22605_22934 108
634 3300047322 Ga0495680_0057650 Ga0495680_0057650_943_1272 108
635 3300047322 Ga0495680_0751946 Ga0495680_0751946_70_402 108
636 3300047471 Ga0495684_0093485 Ga0495684_0093485_799_1128 108
637 3300048903 Ga0496100_0003660 Ga0496100_0003660_7643_7972 108
638 3300048903 Ga0496100_0594571 Ga0496100_0594571_215_544 108
639 3300048904 Ga0496101_1284082 Ga0496101_1284082_175_504 108
640 3300048905 Ga0496102_0937571 Ga0496102_0937571_220_549 108
641 3300048907 Ga0496104_0041250 Ga0496104_0041250_3207_3542 108
642 3300048907 Ga0496104_0169572 Ga0496104_0169572_860_1189 108
643 3300048907 Ga0496104_1482344 Ga0496104_1482344_89_418 108
644 3300048908 Ga0496105_0164714 Ga0496105_0164714_863_1198 108
645 3300048908 Ga0496105_0374951 Ga0496105_0374951_590_919 108
646 3300048908 Ga0496105_0595025 Ga0496105_0595025_109_438 108
647 3300048908 Ga0496105_1094817 Ga0496105_1094817_130_459 108
648 3300048909 Ga0496106_1101387 Ga0496106_1101387_52_381 108
649 3300048910 Ga0496107_0035117 Ga0496107_0035117_1580_1909 108
650 3300048910 Ga0496107_0966826 Ga0496107_0966826_212_541 108
651 3300048910 Ga0496107_1016478 Ga0496107_1016478_220_549 108
652 3300048910 Ga0496107_1357534 Ga0496107_1357534_131_460 108
653 3300048911 Ga0496108_0085584 Ga0496108_0085584_736_1065 108
654 3300048911 Ga0496108_0473517 Ga0496108_0473517_169_498 108
655 3300048911 Ga0496108_0520224 Ga0496108_0520224_414_743 108
656 3300048913 Ga0496110_1491358 Ga0496110_1491358_17_346 108
657 3300048915 Ga0496112_0318677 Ga0496112_0318677_530_862 108
658 3300048915 Ga0496112_0322525 Ga0496112_0322525_409_738 108
659 3300048917 Ga0496114_0000386 Ga0496114_0000386_18327_18656 108
660 3300048917 Ga0496114_0006073 Ga0496114_0006073_1165_1494 108
661 3300048917 Ga0496114_0040273 Ga0496114_0040273_2148_2477 108
662 3300048917 Ga0496114_0258990 Ga0496114_0258990_620_949 108
663 3300048918 Ga0496115_0056627 Ga0496115_0056627_56_385 108
664 3300048918 Ga0496115_0174462 Ga0496115_0174462_763_1092 108
665 3300048918 Ga0496115_0270114 Ga0496115_0270114_46_375 108
666 3300048918 Ga0496115_0293289 Ga0496115_0293289_523_852 108
667 3300049130 Ga0501310_014424 Ga0501310_014424_292_621 108
668 3300049522 Ga0501299_068579 Ga0501299_068579_49_378 108
669 3300049571 Ga0501034_0000037 Ga0501034_0000037_159181_159510 108
670 3300049572 Ga0501036_0038638 Ga0501036_0038638_2559_2888 108
671 3300049572 Ga0501036_0206025 Ga0501036_0206025_653_982 108
672 3300049574 Ga0501038_0656571 Ga0501038_0656571_166_495 108
673 3300049578 Ga0501042_0633636 Ga0501042_0633636_224_553 108
674 3300049579 Ga0501043_0002483 Ga0501043_0002483_1182_1511 108
675 3300049580 Ga0501046_0000751 Ga0501046_0000751_22491_22820 108
676 3300049581 Ga0501047_0000053 Ga0501047_0000053_51253_51582 108
677 3300049582 Ga0501048_0001235 Ga0501048_0001235_667_996 108
678 3300049583 Ga0501067_0003773 Ga0501067_0003773_1805_2134 108
679 3300049583 Ga0501067_0003984 Ga0501067_0003984_2837_3163 108
680 3300049583 Ga0501067_0040666 Ga0501067_0040666_735_1061 108
681 3300049584 Ga0501068_0001718 Ga0501068_0001718_4672_5001 108
682 3300049585 Ga0501069_0075490 Ga0501069_0075490_777_1106 108
683 3300049586 Ga0501070_0005205 Ga0501070_0005205_40_369 108
684 3300049586 Ga0501070_0007053 Ga0501070_0007053_8049_8378 108
685 3300049586 Ga0501070_0777221 Ga0501070_0777221_274_603 108
686 3300049588 Ga0501072_0002806 Ga0501072_0002806_11564_11893 108
687 3300049589 Ga0501073_0003382 Ga0501073_0003382_592_921 108
688 3300049589 Ga0501073_0005323 Ga0501073_0005323_1125_1451 108
689 3300049589 Ga0501073_0090487 Ga0501073_0090487_1139_1468 108
690 3300049589 Ga0501073_0215234 Ga0501073_0215234_411_740 108
691 3300049589 Ga0501073_0294618 Ga0501073_0294618_777_1106 108
692 3300049590 Ga0501074_0022615 Ga0501074_0022615_2289_2618 108
693 3300049590 Ga0501074_0041398 Ga0501074_0041398_2304_2633 108
694 3300049667 Ga0501230_166809 Ga0501230_166809_73_402 108
695 3300049705 Ga0501225_0266137 Ga0501225_0266137_159_488 108
696 3300049741 Ga0501079_0000174 Ga0501079_0000174_15857_16186 108
697 3300049741 Ga0501079_0314223 Ga0501079_0314223_859_1188 108
698 3300049742 Ga0501080_0007066 Ga0501080_0007066_8628_8957 108
699 3300049742 Ga0501080_1777444 Ga0501080_1777444_22_348 108
700 3300049744 Ga0501083_0092319 Ga0501083_0092319_1139_1468 108
701 3300049744 Ga0501083_0463700 Ga0501083_0463700_398_727 108
702 3300050507 nmdc:mga05p37_662727_c1 nmdc:mga05p37_662727_c1_355_684 108
703 3300050511 nmdc:mga08y16_92382_c1 nmdc:mga08y16_92382_c1_1051_1380 108
704 3300050512 nmdc:mga0n895_1036394_c1 nmdc:mga0n895_1036394_c1_371_700 108
705 3300053077 Ga0495601_0034268 Ga0495601_0034268_186_515 108
706 3300053077 Ga0495601_0188118 Ga0495601_0188118_960_1292 108
707 3300053077 Ga0495601_0380331 Ga0495601_0380331_415_744 108
708 3300053084 Ga0495595_0135146 Ga0495595_0135146_798_1127 108
709 3300053085 Ga0495619_0028862 Ga0495619_0028862_1454_1783 108
710 3300053085 Ga0495619_0589775 Ga0495619_0589775_338_670 108
711 3300054114 Ga0501084_0000022 Ga0501084_0000022_98831_99160 108
712 3300054114 Ga0501084_0531397 Ga0501084_0531397_242_577 108
713 3300059477 Ga0587084_144566 Ga0587084_144566_112_441 108
714 3300060346 Ga0587111_0096616 Ga0587111_0096616_78_407 108
715 3300060353 Ga0501082_0006072 Ga0501082_0006072_9020_9349 108
716 3300060353 Ga0501082_0117541 Ga0501082_0117541_1134_1463 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

7

106

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9415 4 94
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9094 1 103
7ohv-assembly1.cif.gz_X nog1-tap associated immature ribosomal particles from s. cerevisiae after rpl2 expression shut down, population c 0.9061 3 98
7ohr-assembly1.cif.gz_X nog1-tap associated immature ribosomal particle population e from s. cerevisiae 0.9058 3 98
7r72-assembly1.cif.gz_X state e1 nucleolar 60s ribosome biogenesis intermediate - spb4 local model 0.9043 3 98
ID Description Score Start End Superfamily
4ukhK00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8974 3 98 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8958 3 102 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8864 3 102 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.878 8 101 3.30.70.330
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8751 2 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1J4VCT9-F1-model_v4 Large ribosomal subunit protein uL23 0.9611 38 105 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3L7QRB5-F1-model_v4 Large ribosomal subunit protein uL23 0.9585 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1JMB6-F1-model_v4 Large ribosomal subunit protein uL23 0.9578 4 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7D5V9Z2-F1-model_v4 Large ribosomal subunit protein uL23 0.9561 4 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E1VV25-F1-model_v4 Large ribosomal subunit protein uL23 0.9552 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
91.81 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map