F477030
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 716 | 317 | 716 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300005365|Ga0070688_100773247|Ga0070688_1007732472 |
| Length | 110 |
| Sequence | MSRPAYQVIRRPLLTEKGTRLRESGGRLPGSVSEEELKPKVFFEVAMDANKIEIKQAVEALFNVKVADVHTTVVRGKEKRVGRYIGRRSNWKRAIVTLSKGQKIDFFEGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 113 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 196 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 201 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 203 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 204 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 246 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 285 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 304 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.67 |
| Metatranscriptomes | 4.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 4.75 |
| Rhizosphere | 93.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006767J43181_103125 | 3300002868 | Bacteria | 8971 |
| 2 | Ga0006763J43179_104103 | 3300002870 | Bacteria | 8906 |
| 3 | Ga0006760J45825_104057 | 3300003158 | Bacteria | 821 |
| 4 | Ga0006759J45824_1006649 | 3300003163 | Bacteria | 16605 |
| 5 | Ga0006759J45824_1093956 | 3300003163 | Bacteria | 540 |
| 6 | Ga0006759J45824_1158952 | 3300003163 | Unclassified | 581 |
| 7 | Ga0006758J48902_1008419 | 3300003300 | Bacteria | 4745 |
| 8 | Ga0006770J48903_1041109 | 3300003305 | Bacteria | 565 |
| 9 | rootH1_10067392 | 3300003323 | Bacteria | 1161 |
| 10 | Ga0032354_1009872 | 3300003693 | Bacteria | 14763 |
| 11 | Ga0058859_11239146 | 3300004798 | Bacteria | 1000 |
| 12 | Ga0058859_11768657 | 3300004798 | Bacteria | 736 |
| 13 | Ga0058859_11779707 | 3300004798 | Bacteria | 633 |
| 14 | Ga0065712_10175385 | 3300005290 | Bacteria | 1220 |
| 15 | Ga0065712_10693493 | 3300005290 | Unclassified | 549 |
| 16 | Ga0065715_10346913 | 3300005293 | Bacteria | 957 |
| 17 | Ga0070658_10111351 | 3300005327 | Bacteria | 2268 |
| 18 | Ga0070676_10278379 | 3300005328 | Bacteria | 1126 |
| 19 | Ga0070676_11102779 | 3300005328 | Unclassified | 600 |
| 20 | Ga0070683_100082061 | 3300005329 | Bacteria | 3019 |
| 21 | Ga0070683_100093535 | 3300005329 | Bacteria | 2824 |
| 22 | Ga0070683_100095923 | 3300005329 | Bacteria | 2789 |
| 23 | Ga0070683_100293889 | 3300005329 | Bacteria | 1545 |
| 24 | Ga0070683_100910515 | 3300005329 | Bacteria | 844 |
| 25 | Ga0070683_100972752 | 3300005329 | Bacteria | 815 |
| 26 | Ga0070683_101273004 | 3300005329 | Bacteria | 707 |
| 27 | Ga0070690_100079405 | 3300005330 | Bacteria | 2145 |
| 28 | Ga0070690_100216563 | 3300005330 | Bacteria | 1340 |
| 29 | Ga0070690_101707513 | 3300005330 | Bacteria | 512 |
| 30 | Ga0070670_100034493 | 3300005331 | Bacteria | 4354 |
| 31 | Ga0070670_100690222 | 3300005331 | Bacteria | 917 |
| 32 | Ga0070670_101540257 | 3300005331 | Bacteria | 611 |
| 33 | Ga0068869_100700486 | 3300005334 | Bacteria | 864 |
| 34 | Ga0068869_101075753 | 3300005334 | Bacteria | 703 |
| 35 | Ga0070666_10254507 | 3300005335 | Bacteria | 1244 |
| 36 | Ga0070666_10319417 | 3300005335 | Bacteria | 1107 |
| 37 | Ga0070680_100078067 | 3300005336 | Bacteria | 2727 |
| 38 | Ga0070680_100997661 | 3300005336 | Bacteria | 723 |
| 39 | Ga0070680_101073878 | 3300005336 | Bacteria | 696 |
| 40 | Ga0070682_100189835 | 3300005337 | Bacteria | 1442 |
| 41 | Ga0070682_100198045 | 3300005337 | Bacteria | 1415 |
| 42 | Ga0070682_100403296 | 3300005337 | Bacteria | 1035 |
| 43 | Ga0070682_100893131 | 3300005337 | Bacteria | 730 |
| 44 | Ga0070682_101378178 | 3300005337 | Unclassified | 602 |
| 45 | Ga0068868_100467322 | 3300005338 | Bacteria | 1100 |
| 46 | Ga0068868_101251073 | 3300005338 | Bacteria | 688 |
| 47 | Ga0068868_102198059 | 3300005338 | Unclassified | 526 |
| 48 | Ga0070660_100562713 | 3300005339 | Unclassified | 951 |
| 49 | Ga0070660_101356042 | 3300005339 | Unclassified | 604 |
| 50 | Ga0070689_100000043 | 3300005340 | Bacteria | 79179 |
| 51 | Ga0070689_100080071 | 3300005340 | Bacteria | 2563 |
| 52 | Ga0070689_100157622 | 3300005340 | Bacteria | 1833 |
| 53 | Ga0070689_100178334 | 3300005340 | Bacteria | 1724 |
| 54 | Ga0070689_100453005 | 3300005340 | Bacteria | 1092 |
| 55 | Ga0070689_100614353 | 3300005340 | Bacteria | 943 |
| 56 | Ga0070689_102141255 | 3300005340 | Bacteria | 512 |
| 57 | Ga0070691_10066982 | 3300005341 | Bacteria | 1736 |
| 58 | Ga0070691_10478747 | 3300005341 | Bacteria | 716 |
| 59 | Ga0070687_100001952 | 3300005343 | Bacteria | 7531 |
| 60 | Ga0070687_100034358 | 3300005343 | Bacteria | 2509 |
| 61 | Ga0070687_100282976 | 3300005343 | Bacteria | 1045 |
| 62 | Ga0070687_101410989 | 3300005343 | Bacteria | 521 |
| 63 | Ga0070661_100586268 | 3300005344 | Bacteria | 900 |
| 64 | Ga0070692_10067654 | 3300005345 | Bacteria | 1896 |
| 65 | Ga0070692_10981398 | 3300005345 | Bacteria | 589 |
| 66 | Ga0070668_100250387 | 3300005347 | Bacteria | 1470 |
| 67 | Ga0070668_101912527 | 3300005347 | Unclassified | 546 |
| 68 | Ga0070669_100066027 | 3300005353 | Bacteria | 2666 |
| 69 | Ga0070675_100235508 | 3300005354 | Bacteria | 1598 |
| 70 | Ga0070675_100246062 | 3300005354 | Bacteria | 1563 |
| 71 | Ga0070671_101116695 | 3300005355 | Bacteria | 693 |
| 72 | Ga0070671_101516481 | 3300005355 | Bacteria | 593 |
| 73 | Ga0070674_100116088 | 3300005356 | Bacteria | 1974 |
| 74 | Ga0070674_101419954 | 3300005356 | Bacteria | 622 |
| 75 | Ga0070673_100036693 | 3300005364 | Bacteria | 3728 |
| 76 | Ga0070673_100091524 | 3300005364 | Bacteria | 2487 |
| 77 | Ga0070673_102040137 | 3300005364 | Bacteria | 545 |
| 78 | Ga0070688_100032408 | 3300005365 | Bacteria | 3150 |
| 79 | Ga0070688_100061965 | 3300005365 | Bacteria | 2367 |
| 80 | Ga0070688_100294589 | 3300005365 | Bacteria | 1171 |
| 81 | Ga0070688_100773247 | 3300005365 | Bacteria | 749 |
| 82 | Ga0070688_100847836 | 3300005365 | Bacteria | 717 |
| 83 | Ga0070688_100936868 | 3300005365 | Bacteria | 685 |
| 84 | Ga0070659_100180238 | 3300005366 | Bacteria | 1733 |
| 85 | Ga0070667_100204537 | 3300005367 | Bacteria | 1753 |
| 86 | Ga0070667_100309483 | 3300005367 | Bacteria | 1424 |
| 87 | Ga0070667_101131486 | 3300005367 | Bacteria | 732 |
| 88 | Ga0070667_102093951 | 3300005367 | Bacteria | 533 |
| 89 | Ga0070709_10272743 | 3300005434 | Bacteria | 1226 |
| 90 | Ga0070709_10792312 | 3300005434 | Bacteria | 743 |
| 91 | Ga0070713_101158800 | 3300005436 | Bacteria | 748 |
| 92 | Ga0070713_101371109 | 3300005436 | Unclassified | 685 |
| 93 | Ga0070710_10149428 | 3300005437 | Bacteria | 1439 |
| 94 | Ga0070701_10077689 | 3300005438 | Bacteria | 1789 |
| 95 | Ga0070701_10873261 | 3300005438 | Bacteria | 619 |
| 96 | Ga0070711_100214813 | 3300005439 | Bacteria | 1492 |
| 97 | Ga0070705_100067352 | 3300005440 | Bacteria | 2151 |
| 98 | Ga0070705_101156657 | 3300005440 | Bacteria | 636 |
| 99 | Ga0070700_100019232 | 3300005441 | Bacteria | 3939 |
| 100 | Ga0070700_100560814 | 3300005441 | Bacteria | 889 |
| 101 | Ga0070700_101329846 | 3300005441 | Unclassified | 605 |
| 102 | Ga0070694_100089893 | 3300005444 | Bacteria | 2152 |
| 103 | Ga0070694_101298826 | 3300005444 | Unclassified | 612 |
| 104 | Ga0070708_101918034 | 3300005445 | Bacteria | 549 |
| 105 | Ga0070678_100061341 | 3300005456 | Bacteria | 2771 |
| 106 | Ga0070678_100745075 | 3300005456 | Bacteria | 886 |
| 107 | Ga0070678_101483080 | 3300005456 | Bacteria | 635 |
| 108 | Ga0070662_100030416 | 3300005457 | Bacteria | 3777 |
| 109 | Ga0070681_10775056 | 3300005458 | Bacteria | 876 |
| 110 | Ga0070681_10947926 | 3300005458 | Bacteria | 780 |
| 111 | Ga0068867_100680719 | 3300005459 | Unclassified | 906 |
| 112 | Ga0068867_100725051 | 3300005459 | Bacteria | 880 |
| 113 | Ga0070685_10052343 | 3300005466 | Bacteria | 2362 |
| 114 | Ga0070685_10109607 | 3300005466 | Bacteria | 1698 |
| 115 | Ga0070685_10160181 | 3300005466 | Bacteria | 1433 |
| 116 | Ga0070685_10477584 | 3300005466 | Bacteria | 878 |
| 117 | Ga0070706_101199227 | 3300005467 | Bacteria | 697 |
| 118 | Ga0070706_102074715 | 3300005467 | Unclassified | 514 |
| 119 | Ga0070698_100648628 | 3300005471 | Bacteria | 997 |
| 120 | Ga0070679_100029036 | 3300005530 | Bacteria | 5455 |
| 121 | Ga0070679_100190634 | 3300005530 | Bacteria | 2019 |
| 122 | Ga0070679_100290785 | 3300005530 | Bacteria | 1585 |
| 123 | Ga0070684_100058335 | 3300005535 | Bacteria | 3374 |
| 124 | Ga0070684_100136595 | 3300005535 | Bacteria | 2215 |
| 125 | Ga0070684_100400359 | 3300005535 | Bacteria | 1265 |
| 126 | Ga0070684_100532982 | 3300005535 | Bacteria | 1089 |
| 127 | Ga0070684_100741356 | 3300005535 | Bacteria | 917 |
| 128 | Ga0070684_101074725 | 3300005535 | Bacteria | 756 |
| 129 | Ga0070684_101811665 | 3300005535 | Unclassified | 576 |
| 130 | Ga0070697_100919961 | 3300005536 | Bacteria | 776 |
| 131 | Ga0070697_101206902 | 3300005536 | Bacteria | 674 |
| 132 | Ga0070697_101650823 | 3300005536 | Bacteria | 573 |
| 133 | Ga0068853_100000004 | 3300005539 | Bacteria | 405732 |
| 134 | Ga0068853_100267348 | 3300005539 | Bacteria | 1574 |
| 135 | Ga0068853_100293961 | 3300005539 | Bacteria | 1500 |
| 136 | Ga0068853_102484884 | 3300005539 | Unclassified | 501 |
| 137 | Ga0070672_100042880 | 3300005543 | Bacteria | 3485 |
| 138 | Ga0070672_100102627 | 3300005543 | Bacteria | 2321 |
| 139 | Ga0070672_100488954 | 3300005543 | Bacteria | 1063 |
| 140 | Ga0070686_100016687 | 3300005544 | Bacteria | 4276 |
| 141 | Ga0070686_100046683 | 3300005544 | Bacteria | 2734 |
| 142 | Ga0070686_100433255 | 3300005544 | Bacteria | 1007 |
| 143 | Ga0070686_100831462 | 3300005544 | Bacteria | 746 |
| 144 | Ga0070695_100032852 | 3300005545 | Bacteria | 3244 |
| 145 | Ga0070696_100669537 | 3300005546 | Bacteria | 843 |
| 146 | Ga0070665_100342825 | 3300005548 | Bacteria | 1499 |
| 147 | Ga0070665_101619982 | 3300005548 | Unclassified | 655 |
| 148 | Ga0070704_100239301 | 3300005549 | Bacteria | 1485 |
| 149 | Ga0068855_100076432 | 3300005563 | Bacteria | 3886 |
| 150 | Ga0068855_100152247 | 3300005563 | Bacteria | 2629 |
| 151 | Ga0068855_100153786 | 3300005563 | Bacteria | 2614 |
| 152 | Ga0068857_100171461 | 3300005577 | Bacteria | 1973 |
| 153 | Ga0068857_101935815 | 3300005577 | Bacteria | 578 |
| 154 | Ga0068857_102428114 | 3300005577 | Archaea | 515 |
| 155 | Ga0068856_100060062 | 3300005614 | Bacteria | 3756 |
| 156 | Ga0068856_100231627 | 3300005614 | Bacteria | 1862 |
| 157 | Ga0068856_100367002 | 3300005614 | Bacteria | 1458 |
| 158 | Ga0070702_100176947 | 3300005615 | Bacteria | 1393 |
| 159 | Ga0070702_100393589 | 3300005615 | Bacteria | 989 |
| 160 | Ga0070702_100845384 | 3300005615 | Bacteria | 712 |
| 161 | Ga0068852_100443584 | 3300005616 | Bacteria | 1284 |
| 162 | Ga0068852_100771108 | 3300005616 | Bacteria | 975 |
| 163 | Ga0068852_101328740 | 3300005616 | Unclassified | 741 |
| 164 | Ga0068859_100042834 | 3300005617 | Bacteria | 4548 |
| 165 | Ga0068859_100180325 | 3300005617 | Bacteria | 2195 |
| 166 | Ga0068864_102184926 | 3300005618 | Bacteria | 560 |
| 167 | Ga0068864_102593756 | 3300005618 | Bacteria | 513 |
| 168 | Ga0068866_10268249 | 3300005718 | Bacteria | 1052 |
| 169 | Ga0068866_10350800 | 3300005718 | Bacteria | 937 |
| 170 | Ga0068861_100046691 | 3300005719 | Bacteria | 3266 |
| 171 | Ga0068863_100316875 | 3300005841 | Bacteria | 1514 |
| 172 | Ga0068863_100492968 | 3300005841 | Bacteria | 1206 |
| 173 | Ga0068863_102415467 | 3300005841 | Bacteria | 535 |
| 174 | Ga0068860_100481748 | 3300005843 | Unclassified | 1237 |
| 175 | Ga0068860_100484640 | 3300005843 | Bacteria | 1233 |
| 176 | Ga0068860_101608691 | 3300005843 | Unclassified | 672 |
| 177 | Ga0068862_101532282 | 3300005844 | Bacteria | 672 |
| 178 | Ga0068862_101736155 | 3300005844 | Bacteria | 633 |
| 179 | Ga0081455_10113380 | 3300005937 | Bacteria | 2150 |
| 180 | Ga0070717_11208333 | 3300006028 | Bacteria | 688 |
| 181 | Ga0070716_100264302 | 3300006173 | Bacteria | 1179 |
| 182 | Ga0070716_100870745 | 3300006173 | Bacteria | 703 |
| 183 | Ga0070712_100331620 | 3300006175 | Bacteria | 1240 |
| 184 | Ga0075366_10549464 | 3300006195 | Bacteria | 715 |
| 185 | Ga0097621_100716854 | 3300006237 | Bacteria | 922 |
| 186 | Ga0097621_101186330 | 3300006237 | Unclassified | 719 |
| 187 | Ga0068871_100672501 | 3300006358 | Bacteria | 947 |
| 188 | Ga0068871_101274853 | 3300006358 | Bacteria | 691 |
| 189 | Ga0068871_101277471 | 3300006358 | Bacteria | 690 |
| 190 | Ga0068871_102006037 | 3300006358 | Bacteria | 551 |
| 191 | Ga0068871_102035268 | 3300006358 | Bacteria | 547 |
| 192 | Ga0075428_102059615 | 3300006844 | Bacteria | 591 |
| 193 | Ga0075433_11428935 | 3300006852 | Bacteria | 598 |
| 194 | Ga0075434_100727321 | 3300006871 | Bacteria | 1010 |
| 195 | Ga0068865_100279850 | 3300006881 | Bacteria | 1328 |
| 196 | Ga0068865_100582500 | 3300006881 | Bacteria | 943 |
| 197 | Ga0068865_100829526 | 3300006881 | Unclassified | 800 |
| 198 | Ga0068865_101252525 | 3300006881 | Bacteria | 658 |
| 199 | Ga0075436_101014650 | 3300006914 | Unclassified | 623 |
| 200 | Ga0097620_100042837 | 3300006931 | Bacteria | 4548 |
| 201 | Ga0097620_100180328 | 3300006931 | Bacteria | 2195 |
| 202 | Ga0105240_10000795 | 3300009093 | Bacteria | 57129 |
| 203 | Ga0105240_10318108 | 3300009093 | Bacteria | 1775 |
| 204 | Ga0105240_10951372 | 3300009093 | Unclassified | 921 |
| 205 | Ga0111539_10165120 | 3300009094 | Bacteria | 2589 |
| 206 | Ga0111539_10563491 | 3300009094 | Bacteria | 1327 |
| 207 | Ga0111539_11404632 | 3300009094 | Bacteria | 810 |
| 208 | Ga0105245_10326263 | 3300009098 | Bacteria | 1514 |
| 209 | Ga0105245_10364874 | 3300009098 | Bacteria | 1434 |
| 210 | Ga0105245_10402423 | 3300009098 | Bacteria | 1368 |
| 211 | Ga0105245_12253441 | 3300009098 | Bacteria | 598 |
| 212 | Ga0105245_12678882 | 3300009098 | Unclassified | 552 |
| 213 | Ga0105247_11095213 | 3300009101 | Bacteria | 628 |
| 214 | Ga0114129_10569212 | 3300009147 | Bacteria | 1471 |
| 215 | Ga0105243_11565369 | 3300009148 | Bacteria | 685 |
| 216 | Ga0105241_10505368 | 3300009174 | Bacteria | 1078 |
| 217 | Ga0105242_10638967 | 3300009176 | Bacteria | 1033 |
| 218 | Ga0105237_10002220 | 3300009545 | Bacteria | 24289 |
| 219 | Ga0105237_10201518 | 3300009545 | Bacteria | 1990 |
| 220 | Ga0105237_11078049 | 3300009545 | Bacteria | 810 |
| 221 | Ga0105237_11492670 | 3300009545 | Bacteria | 683 |
| 222 | Ga0105238_10056048 | 3300009551 | Bacteria | 3954 |
| 223 | Ga0105238_10686083 | 3300009551 | Bacteria | 1036 |
| 224 | Ga0105238_12147164 | 3300009551 | Unclassified | 593 |
| 225 | Ga0105239_10284944 | 3300010375 | Bacteria | 1860 |
| 226 | Ga0105239_11745225 | 3300010375 | Bacteria | 721 |
| 227 | Ga0105239_12755137 | 3300010375 | Bacteria | 574 |
| 228 | Ga0105246_11645796 | 3300011119 | Bacteria | 608 |
| 229 | Ga0105246_12128475 | 3300011119 | Unclassified | 544 |
| 230 | Ga0157371_10325770 | 3300013102 | Bacteria | 1115 |
| 231 | Ga0157374_10054827 | 3300013296 | Bacteria | 3720 |
| 232 | Ga0157374_11075912 | 3300013296 | Bacteria | 824 |
| 233 | Ga0157378_10487709 | 3300013297 | Bacteria | 1229 |
| 234 | Ga0157378_10495841 | 3300013297 | Bacteria | 1219 |
| 235 | Ga0157378_10724834 | 3300013297 | Bacteria | 1015 |
| 236 | Ga0163162_10162216 | 3300013306 | Bacteria | 2357 |
| 237 | Ga0157372_10918100 | 3300013307 | Bacteria | 1015 |
| 238 | Ga0157372_10966444 | 3300013307 | Unclassified | 987 |
| 239 | Ga0157372_12714985 | 3300013307 | Unclassified | 568 |
| 240 | Ga0157375_11266341 | 3300013308 | Bacteria | 866 |
| 241 | Ga0157375_11962180 | 3300013308 | Bacteria | 695 |
| 242 | Ga0163163_11226335 | 3300014325 | Bacteria | 813 |
| 243 | Ga0157380_10983976 | 3300014326 | Bacteria | 876 |
| 244 | Ga0157380_11404115 | 3300014326 | Bacteria | 749 |
| 245 | Ga0157377_10462162 | 3300014745 | Bacteria | 879 |
| 246 | Ga0157379_10164923 | 3300014968 | Bacteria | 2000 |
| 247 | Ga0157379_12035381 | 3300014968 | Bacteria | 568 |
| 248 | Ga0157376_10253275 | 3300014969 | Bacteria | 1646 |
| 249 | Ga0157376_10655572 | 3300014969 | Bacteria | 1050 |
| 250 | Ga0157376_10846268 | 3300014969 | Bacteria | 930 |
| 251 | Ga0206352_10638828 | 3300020078 | Bacteria | 1956 |
| 252 | Ga0206352_11129659 | 3300020078 | Bacteria | 1009 |
| 253 | Ga0213875_10009336 | 3300021388 | Bacteria | 4974 |
| 254 | Ga0207666_1000994 | 3300025271 | Bacteria | 3365 |
| 255 | Ga0207692_10701363 | 3300025898 | Bacteria | 657 |
| 256 | Ga0207688_10588246 | 3300025901 | Bacteria | 701 |
| 257 | Ga0207680_10036485 | 3300025903 | Bacteria | 2831 |
| 258 | Ga0207699_10193517 | 3300025906 | Bacteria | 1374 |
| 259 | Ga0207699_10530758 | 3300025906 | Bacteria | 852 |
| 260 | Ga0207645_10026906 | 3300025907 | Bacteria | 3716 |
| 261 | Ga0207643_10748640 | 3300025908 | Bacteria | 632 |
| 262 | Ga0207643_11083284 | 3300025908 | Unclassified | 517 |
| 263 | Ga0207705_10026045 | 3300025909 | Bacteria | 4173 |
| 264 | Ga0207684_11005027 | 3300025910 | Bacteria | 698 |
| 265 | Ga0207654_10400479 | 3300025911 | Bacteria | 954 |
| 266 | Ga0207707_10055935 | 3300025912 | Bacteria | 3432 |
| 267 | Ga0207707_10433520 | 3300025912 | Bacteria | 1126 |
| 268 | Ga0207707_10659437 | 3300025912 | Unclassified | 881 |
| 269 | Ga0207695_10000834 | 3300025913 | Bacteria | 57039 |
| 270 | Ga0207695_10283316 | 3300025913 | Bacteria | 1551 |
| 271 | Ga0207671_10000510 | 3300025914 | Bacteria | 52543 |
| 272 | Ga0207671_10006782 | 3300025914 | Bacteria | 10121 |
| 273 | Ga0207671_10343405 | 3300025914 | Bacteria | 1183 |
| 274 | Ga0207693_10420783 | 3300025915 | Bacteria | 1044 |
| 275 | Ga0207663_10548379 | 3300025916 | Bacteria | 904 |
| 276 | Ga0207660_10081230 | 3300025917 | Bacteria | 2382 |
| 277 | Ga0207660_11578348 | 3300025917 | Bacteria | 529 |
| 278 | Ga0207662_10000745 | 3300025918 | Bacteria | 14909 |
| 279 | Ga0207662_10057285 | 3300025918 | Bacteria | 2329 |
| 280 | Ga0207662_10080129 | 3300025918 | Bacteria | 1991 |
| 281 | Ga0207662_10184853 | 3300025918 | Bacteria | 1343 |
| 282 | Ga0207657_10184384 | 3300025919 | Bacteria | 1686 |
| 283 | Ga0207657_10651981 | 3300025919 | Unclassified | 819 |
| 284 | Ga0207649_10617610 | 3300025920 | Unclassified | 835 |
| 285 | Ga0207652_10091748 | 3300025921 | Bacteria | 2671 |
| 286 | Ga0207652_10249882 | 3300025921 | Bacteria | 1599 |
| 287 | Ga0207652_11394684 | 3300025921 | Bacteria | 604 |
| 288 | Ga0207652_11482574 | 3300025921 | Bacteria | 582 |
| 289 | Ga0207681_10002742 | 3300025923 | Bacteria | 11146 |
| 290 | Ga0207694_10019794 | 3300025924 | Bacteria | 5092 |
| 291 | Ga0207694_10334653 | 3300025924 | Bacteria | 1251 |
| 292 | Ga0207694_10546681 | 3300025924 | Bacteria | 972 |
| 293 | Ga0207694_10998884 | 3300025924 | Unclassified | 708 |
| 294 | Ga0207650_10331885 | 3300025925 | Bacteria | 1247 |
| 295 | Ga0207650_10412449 | 3300025925 | Bacteria | 1120 |
| 296 | Ga0207659_10178033 | 3300025926 | Bacteria | 1682 |
| 297 | Ga0207687_10080679 | 3300025927 | Bacteria | 2349 |
| 298 | Ga0207687_11208432 | 3300025927 | Bacteria | 650 |
| 299 | Ga0207700_10241544 | 3300025928 | Bacteria | 1539 |
| 300 | Ga0207664_10987838 | 3300025929 | Bacteria | 755 |
| 301 | Ga0207644_10244061 | 3300025931 | Bacteria | 1431 |
| 302 | Ga0207644_11584875 | 3300025931 | Bacteria | 549 |
| 303 | Ga0207644_11717683 | 3300025931 | Bacteria | 526 |
| 304 | Ga0207690_10294826 | 3300025932 | Bacteria | 1267 |
| 305 | Ga0207706_10050162 | 3300025933 | Bacteria | 3689 |
| 306 | Ga0207706_10704768 | 3300025933 | Bacteria | 862 |
| 307 | Ga0207686_10564906 | 3300025934 | Bacteria | 891 |
| 308 | Ga0207670_10000022 | 3300025936 | Bacteria | 145904 |
| 309 | Ga0207670_10033174 | 3300025936 | Bacteria | 3325 |
| 310 | Ga0207670_10038900 | 3300025936 | Bacteria | 3110 |
| 311 | Ga0207670_10583824 | 3300025936 | Bacteria | 916 |
| 312 | Ga0207670_10971512 | 3300025936 | Unclassified | 714 |
| 313 | Ga0207670_11466375 | 3300025936 | Bacteria | 580 |
| 314 | Ga0207670_11731623 | 3300025936 | Bacteria | 532 |
| 315 | Ga0207669_10032783 | 3300025937 | Bacteria | 2922 |
| 316 | Ga0207704_10215606 | 3300025938 | Bacteria | 1416 |
| 317 | Ga0207704_10969184 | 3300025938 | Bacteria | 718 |
| 318 | Ga0207704_11159472 | 3300025938 | Archaea | 658 |
| 319 | Ga0207665_10327042 | 3300025939 | Bacteria | 1152 |
| 320 | Ga0207691_10111430 | 3300025940 | Bacteria | 2433 |
| 321 | Ga0207691_10195137 | 3300025940 | Bacteria | 1764 |
| 322 | Ga0207691_10205570 | 3300025940 | Bacteria | 1712 |
| 323 | Ga0207689_10079744 | 3300025942 | Bacteria | 2690 |
| 324 | Ga0207689_11475473 | 3300025942 | Bacteria | 568 |
| 325 | Ga0207661_10053370 | 3300025944 | Bacteria | 3234 |
| 326 | Ga0207661_10394917 | 3300025944 | Bacteria | 1253 |
| 327 | Ga0207661_10684704 | 3300025944 | Unclassified | 943 |
| 328 | Ga0207661_11074409 | 3300025944 | Bacteria | 741 |
| 329 | Ga0207667_10023566 | 3300025949 | Bacteria | 6777 |
| 330 | Ga0207667_10209758 | 3300025949 | Bacteria | 1997 |
| 331 | Ga0207667_10299139 | 3300025949 | Bacteria | 1644 |
| 332 | Ga0207667_10505733 | 3300025949 | Bacteria | 1225 |
| 333 | Ga0207651_10007125 | 3300025960 | Bacteria | 5937 |
| 334 | Ga0207651_10057682 | 3300025960 | Bacteria | 2679 |
| 335 | Ga0207651_10149277 | 3300025960 | Bacteria | 1817 |
| 336 | Ga0207651_10250285 | 3300025960 | Bacteria | 1449 |
| 337 | Ga0207668_10166349 | 3300025972 | Bacteria | 1724 |
| 338 | Ga0207668_11489344 | 3300025972 | Bacteria | 611 |
| 339 | Ga0207668_12056919 | 3300025972 | Unclassified | 514 |
| 340 | Ga0207640_10144783 | 3300025981 | Bacteria | 1737 |
| 341 | Ga0207658_10301364 | 3300025986 | Bacteria | 1381 |
| 342 | Ga0207658_10629819 | 3300025986 | Bacteria | 965 |
| 343 | Ga0207658_10685249 | 3300025986 | Bacteria | 925 |
| 344 | Ga0207658_11330371 | 3300025986 | Unclassified | 657 |
| 345 | Ga0207677_10134658 | 3300026023 | Bacteria | 1882 |
| 346 | Ga0207677_10205289 | 3300026023 | Bacteria | 1569 |
| 347 | Ga0207677_10417879 | 3300026023 | Bacteria | 1141 |
| 348 | Ga0207639_10000029 | 3300026041 | Bacteria | 195764 |
| 349 | Ga0207639_10005667 | 3300026041 | Bacteria | 8449 |
| 350 | Ga0207639_10042182 | 3300026041 | Bacteria | 3418 |
| 351 | Ga0207708_10012451 | 3300026075 | Bacteria | 6340 |
| 352 | Ga0207708_10801332 | 3300026075 | Bacteria | 811 |
| 353 | Ga0207702_10204836 | 3300026078 | Bacteria | 1831 |
| 354 | Ga0207702_10362040 | 3300026078 | Bacteria | 1390 |
| 355 | Ga0207702_10461801 | 3300026078 | Bacteria | 1233 |
| 356 | Ga0207641_10549601 | 3300026088 | Bacteria | 1126 |
| 357 | Ga0207641_12000603 | 3300026088 | Unclassified | 581 |
| 358 | Ga0207641_12077650 | 3300026088 | Unclassified | 569 |
| 359 | Ga0207648_10011154 | 3300026089 | Bacteria | 8479 |
| 360 | Ga0207648_11346760 | 3300026089 | Bacteria | 671 |
| 361 | Ga0207676_10628970 | 3300026095 | Bacteria | 1034 |
| 362 | Ga0207676_11014416 | 3300026095 | Bacteria | 818 |
| 363 | Ga0207676_11370606 | 3300026095 | Bacteria | 703 |
| 364 | Ga0207676_12115241 | 3300026095 | Bacteria | 561 |
| 365 | Ga0207674_10143954 | 3300026116 | Bacteria | 2343 |
| 366 | Ga0207674_11429596 | 3300026116 | Bacteria | 661 |
| 367 | Ga0207675_100013850 | 3300026118 | Bacteria | 7520 |
| 368 | Ga0207675_100523954 | 3300026118 | Bacteria | 1182 |
| 369 | Ga0207683_10055874 | 3300026121 | Bacteria | 3462 |
| 370 | Ga0207683_10406889 | 3300026121 | Bacteria | 1252 |
| 371 | Ga0207683_11608085 | 3300026121 | Bacteria | 599 |
| 372 | Ga0207698_10740360 | 3300026142 | Bacteria | 981 |
| 373 | Ga0209998_10134052 | 3300027717 | Bacteria | 630 |
| 374 | Ga0209974_10047202 | 3300027876 | Bacteria | 1442 |
| 375 | Ga0207428_10071472 | 3300027907 | Bacteria | 2725 |
| 376 | Ga0268266_11113797 | 3300028379 | Unclassified | 764 |
| 377 | Ga0268265_10053988 | 3300028380 | Bacteria | 3046 |
| 378 | Ga0268265_11176573 | 3300028380 | Bacteria | 764 |
| 379 | Ga0268265_12459148 | 3300028380 | Bacteria | 527 |
| 380 | Ga0268264_11590237 | 3300028381 | Unclassified | 664 |
| 381 | Ga0268264_11795831 | 3300028381 | Bacteria | 623 |
| 382 | Ga0265337_1016213 | 3300028556 | Bacteria | 2415 |
| 383 | Ga0265337_1019764 | 3300028556 | Bacteria | 2118 |
| 384 | Ga0265326_10086852 | 3300028558 | Bacteria | 885 |
| 385 | Ga0265319_1022863 | 3300028563 | Bacteria | 2271 |
| 386 | Ga0265319_1028578 | 3300028563 | Bacteria | 1965 |
| 387 | Ga0265319_1066428 | 3300028563 | Bacteria | 1162 |
| 388 | Ga0265334_10003040 | 3300028573 | Bacteria | 7662 |
| 389 | Ga0265318_10000169 | 3300028577 | Bacteria | 57590 |
| 390 | Ga0265318_10000384 | 3300028577 | Bacteria | 34508 |
| 391 | Ga0265318_10033468 | 3300028577 | Bacteria | 1984 |
| 392 | Ga0265323_10003319 | 3300028653 | Bacteria | 7141 |
| 393 | Ga0265323_10015822 | 3300028653 | Bacteria | 2960 |
| 394 | Ga0265323_10015991 | 3300028653 | Bacteria | 2938 |
| 395 | Ga0265323_10018664 | 3300028653 | Bacteria | 2681 |
| 396 | Ga0265323_10051237 | 3300028653 | Bacteria | 1465 |
| 397 | Ga0265322_10007541 | 3300028654 | Bacteria | 3172 |
| 398 | Ga0265322_10012481 | 3300028654 | Bacteria | 2459 |
| 399 | Ga0265336_10016694 | 3300028666 | Bacteria | 2399 |
| 400 | Ga0265336_10184290 | 3300028666 | Unclassified | 620 |
| 401 | Ga0265336_10201627 | 3300028666 | Unclassified | 591 |
| 402 | Ga0265338_10001810 | 3300028800 | Bacteria | 33582 |
| 403 | Ga0265338_10016967 | 3300028800 | Bacteria | 7878 |
| 404 | Ga0265338_10132703 | 3300028800 | Bacteria | 1963 |
| 405 | Ga0265338_10143543 | 3300028800 | Bacteria | 1866 |
| 406 | Ga0265338_10161608 | 3300028800 | Bacteria | 1729 |
| 407 | Ga0265338_10251224 | 3300028800 | Bacteria | 1304 |
| 408 | Ga0265338_10529671 | 3300028800 | Bacteria | 827 |
| 409 | Ga0265338_10794916 | 3300028800 | Unclassified | 649 |
| 410 | Ga0265324_10005897 | 3300029957 | Bacteria | 5205 |
| 411 | Ga0265324_10052976 | 3300029957 | Bacteria | 1393 |
| 412 | Ga0265324_10291215 | 3300029957 | Unclassified | 555 |
| 413 | Ga0265330_10000068 | 3300031235 | Bacteria | 90225 |
| 414 | Ga0265330_10000541 | 3300031235 | Bacteria | 24732 |
| 415 | Ga0265330_10001334 | 3300031235 | Bacteria | 14415 |
| 416 | Ga0265330_10003962 | 3300031235 | Bacteria | 7608 |
| 417 | Ga0265330_10009350 | 3300031235 | Bacteria | 4660 |
| 418 | Ga0265330_10013183 | 3300031235 | Bacteria | 3855 |
| 419 | Ga0265330_10065761 | 3300031235 | Bacteria | 1573 |
| 420 | Ga0265330_10265117 | 3300031235 | Unclassified | 724 |
| 421 | Ga0265332_10001607 | 3300031238 | Bacteria | 12385 |
| 422 | Ga0265332_10005477 | 3300031238 | Bacteria | 5854 |
| 423 | Ga0265332_10035759 | 3300031238 | Bacteria | 2157 |
| 424 | Ga0265332_10041106 | 3300031238 | Bacteria | 2001 |
| 425 | Ga0265332_10336885 | 3300031238 | Bacteria | 623 |
| 426 | Ga0265328_10000172 | 3300031239 | Bacteria | 29964 |
| 427 | Ga0265328_10000528 | 3300031239 | Bacteria | 17832 |
| 428 | Ga0265328_10004363 | 3300031239 | Bacteria | 6145 |
| 429 | Ga0265328_10005372 | 3300031239 | Bacteria | 5487 |
| 430 | Ga0265328_10187915 | 3300031239 | Unclassified | 782 |
| 431 | Ga0265320_10000069 | 3300031240 | Bacteria | 90253 |
| 432 | Ga0265320_10005252 | 3300031240 | Bacteria | 8348 |
| 433 | Ga0265320_10017635 | 3300031240 | Bacteria | 3957 |
| 434 | Ga0265320_10040972 | 3300031240 | Bacteria | 2305 |
| 435 | Ga0265320_10188685 | 3300031240 | Bacteria | 922 |
| 436 | Ga0265320_10476221 | 3300031240 | Bacteria | 551 |
| 437 | Ga0265325_10089603 | 3300031241 | Bacteria | 1519 |
| 438 | Ga0265325_10158897 | 3300031241 | Unclassified | 1064 |
| 439 | Ga0265325_10176509 | 3300031241 | Bacteria | 997 |
| 440 | Ga0265325_10206962 | 3300031241 | Bacteria | 902 |
| 441 | Ga0265329_10000733 | 3300031242 | Bacteria | 16666 |
| 442 | Ga0265329_10003473 | 3300031242 | Bacteria | 6856 |
| 443 | Ga0265329_10010575 | 3300031242 | Bacteria | 3379 |
| 444 | Ga0265329_10022198 | 3300031242 | Bacteria | 2126 |
| 445 | Ga0265329_10097232 | 3300031242 | Bacteria | 936 |
| 446 | Ga0265329_10151123 | 3300031242 | Bacteria | 752 |
| 447 | Ga0265340_10007508 | 3300031247 | Bacteria | 5918 |
| 448 | Ga0265340_10061476 | 3300031247 | Bacteria | 1796 |
| 449 | Ga0265340_10188620 | 3300031247 | Bacteria | 930 |
| 450 | Ga0265339_10000001 | 3300031249 | Bacteria | 613713 |
| 451 | Ga0265339_10006249 | 3300031249 | Bacteria | 7843 |
| 452 | Ga0265339_10006835 | 3300031249 | Bacteria | 7436 |
| 453 | Ga0265339_10018501 | 3300031249 | Bacteria | 4105 |
| 454 | Ga0265339_10022740 | 3300031249 | Bacteria | 3628 |
| 455 | Ga0265339_10032693 | 3300031249 | Bacteria | 2933 |
| 456 | Ga0265339_10058815 | 3300031249 | Bacteria | 2074 |
| 457 | Ga0265339_10075283 | 3300031249 | Bacteria | 1792 |
| 458 | Ga0265339_10147825 | 3300031249 | Bacteria | 1191 |
| 459 | Ga0265339_10287933 | 3300031249 | Unclassified | 786 |
| 460 | Ga0265331_10000090 | 3300031250 | Bacteria | 123628 |
| 461 | Ga0265331_10000149 | 3300031250 | Bacteria | 90395 |
| 462 | Ga0265331_10001210 | 3300031250 | Bacteria | 19474 |
| 463 | Ga0265331_10056308 | 3300031250 | Bacteria | 1867 |
| 464 | Ga0265316_10000251 | 3300031344 | Bacteria | 61672 |
| 465 | Ga0265316_10000984 | 3300031344 | Bacteria | 30933 |
| 466 | Ga0265316_10006437 | 3300031344 | Bacteria | 11220 |
| 467 | Ga0265316_10010605 | 3300031344 | Bacteria | 8384 |
| 468 | Ga0265316_10012440 | 3300031344 | Bacteria | 7631 |
| 469 | Ga0265316_10015836 | 3300031344 | Bacteria | 6566 |
| 470 | Ga0265316_10024979 | 3300031344 | Bacteria | 4993 |
| 471 | Ga0265316_10037888 | 3300031344 | Bacteria | 3887 |
| 472 | Ga0265316_10058086 | 3300031344 | Bacteria | 3015 |
| 473 | Ga0265316_10068712 | 3300031344 | Bacteria | 2735 |
| 474 | Ga0265316_10076461 | 3300031344 | Bacteria | 2572 |
| 475 | Ga0265316_10346857 | 3300031344 | Bacteria | 1075 |
| 476 | Ga0265316_10523947 | 3300031344 | Unclassified | 845 |
| 477 | Ga0307408_102063440 | 3300031548 | Bacteria | 549 |
| 478 | Ga0265313_10003761 | 3300031595 | Bacteria | 12048 |
| 479 | Ga0265313_10006146 | 3300031595 | Bacteria | 8620 |
| 480 | Ga0265313_10035771 | 3300031595 | Bacteria | 2497 |
| 481 | Ga0265313_10043972 | 3300031595 | Bacteria | 2183 |
| 482 | Ga0265313_10064585 | 3300031595 | Bacteria | 1702 |
| 483 | Ga0316575_10002995 | 3300031665 | Bacteria | 5756 |
| 484 | Ga0316579_10014492 | 3300031691 | Bacteria | 3410 |
| 485 | Ga0265314_10000109 | 3300031711 | Bacteria | 125470 |
| 486 | Ga0265314_10000191 | 3300031711 | Bacteria | 91214 |
| 487 | Ga0265314_10001397 | 3300031711 | Bacteria | 27067 |
| 488 | Ga0265314_10004534 | 3300031711 | Bacteria | 12837 |
| 489 | Ga0265314_10012182 | 3300031711 | Bacteria | 7042 |
| 490 | Ga0265314_10023062 | 3300031711 | Bacteria | 4755 |
| 491 | Ga0265314_10074680 | 3300031711 | Bacteria | 2258 |
| 492 | Ga0265314_10113712 | 3300031711 | Bacteria | 1716 |
| 493 | Ga0265342_10000812 | 3300031712 | Bacteria | 31323 |
| 494 | Ga0265342_10001254 | 3300031712 | Bacteria | 23972 |
| 495 | Ga0265342_10001889 | 3300031712 | Bacteria | 18879 |
| 496 | Ga0265342_10002136 | 3300031712 | Bacteria | 17439 |
| 497 | Ga0265342_10004388 | 3300031712 | Bacteria | 11137 |
| 498 | Ga0265342_10006355 | 3300031712 | Bacteria | 8810 |
| 499 | Ga0265342_10008085 | 3300031712 | Bacteria | 7603 |
| 500 | Ga0265342_10028395 | 3300031712 | Bacteria | 3485 |
| 501 | Ga0265342_10029446 | 3300031712 | Bacteria | 3408 |
| 502 | Ga0265342_10046425 | 3300031712 | Bacteria | 2611 |
| 503 | Ga0265342_10048044 | 3300031712 | Bacteria | 2559 |
| 504 | Ga0265342_10204027 | 3300031712 | Bacteria | 1072 |
| 505 | Ga0316576_10018164 | 3300031727 | Bacteria | 4794 |
| 506 | Ga0316576_10491746 | 3300031727 | Bacteria | 903 |
| 507 | Ga0316578_10033274 | 3300031728 | Bacteria | 2952 |
| 508 | Ga0316578_10794577 | 3300031728 | Bacteria | 549 |
| 509 | Ga0316577_10012472 | 3300031733 | Bacteria | 4630 |
| 510 | Ga0326468_10027368 | 3300031889 | Bacteria | 730 |
| 511 | Ga0316585_10026458 | 3300032137 | Bacteria | 1805 |
| 512 | Ga0316593_10115032 | 3300032168 | Bacteria | 963 |
| 513 | Ga0316593_10222634 | 3300032168 | Unclassified | 701 |
| 514 | Ga0316593_10254773 | 3300032168 | Bacteria | 657 |
| 515 | Ga0316593_10259055 | 3300032168 | Bacteria | 652 |
| 516 | Ga0316592_1128347 | 3300033524 | Bacteria | 591 |
| 517 | Ga0316586_1041122 | 3300033527 | Bacteria | 813 |
| 518 | Ga0316588_1001749 | 3300033528 | Bacteria | 3652 |
| 519 | Ga0316588_1050233 | 3300033528 | Bacteria | 1010 |
| 520 | Ga0316587_1001986 | 3300033529 | Bacteria | 2652 |
| 521 | Ga0316596_1097766 | 3300033541 | Bacteria | 793 |
| 522 | Ga0373950_0000002 | 3300034818 | Bacteria | 933559 |
| 523 | Ga0373950_0000319 | 3300034818 | Bacteria | 6031 |
| 524 | Ga0373934_0015071 | 3300035086 | Bacteria | 2931 |
| 525 | Ga0373934_0074325 | 3300035086 | Bacteria | 1362 |
| 526 | Ga0373934_0279879 | 3300035086 | Bacteria | 691 |
| 527 | Ga0373940_0185842 | 3300035088 | Unclassified | 678 |
| 528 | Ga0373944_0309337 | 3300035089 | Unclassified | 594 |
| 529 | Ga0373923_0064505 | 3300035111 | Bacteria | 1562 |
| 530 | Ga0373923_0276690 | 3300035111 | Unclassified | 790 |
| 531 | Ga0373936_0125773 | 3300035113 | Bacteria | 1099 |
| 532 | Ga0373945_0196582 | 3300035116 | Bacteria | 836 |
| 533 | Ga0373953_0007606 | 3300035117 | Bacteria | 3638 |
| 534 | Ga0373954_0013761 | 3300035118 | Bacteria | 3605 |
| 535 | Ga0373954_0061229 | 3300035118 | Bacteria | 1776 |
| 536 | Ga0373954_0067157 | 3300035118 | Bacteria | 1699 |
| 537 | Ga0373954_0118115 | 3300035118 | Bacteria | 1286 |
| 538 | Ga0373954_0290057 | 3300035118 | Unclassified | 807 |
| 539 | Ga0373956_0024460 | 3300035119 | Bacteria | 2603 |
| 540 | Ga0373956_0029287 | 3300035119 | Bacteria | 2400 |
| 541 | Ga0373956_0181043 | 3300035119 | Bacteria | 996 |
| 542 | Ga0373956_0181170 | 3300035119 | Bacteria | 996 |
| 543 | Ga0373957_0050880 | 3300035120 | Bacteria | 1584 |
| 544 | Ga0373943_0026949 | 3300035170 | Bacteria | 2696 |
| 545 | Ga0373943_0218286 | 3300035170 | Bacteria | 1061 |
| 546 | Ga0373946_0472468 | 3300035171 | Bacteria | 641 |
| 547 | Ga0373955_0050551 | 3300035172 | Bacteria | 2261 |
| 548 | Ga0373955_0053472 | 3300035172 | Bacteria | 2205 |
| 549 | Ga0373955_0077472 | 3300035172 | Bacteria | 1872 |
| 550 | Ga0373955_0086843 | 3300035172 | Bacteria | 1777 |
| 551 | Ga0373955_0376090 | 3300035172 | Bacteria | 862 |
| 552 | Ga0373961_0073517 | 3300035241 | Bacteria | 1062 |
| 553 | Ga0316574_0010007 | 3300035398 | Bacteria | 5335 |
| 554 | Ga0316574_0530920 | 3300035398 | Bacteria | 732 |
| 555 | Ga0373924_0146534 | 3300035410 | Bacteria | 1032 |
| 556 | Ga0373924_0215395 | 3300035410 | Bacteria | 848 |
| 557 | Ga0373935_0169727 | 3300035692 | Bacteria | 1491 |
| 558 | Ga0373927_0054262 | 3300035695 | Bacteria | 2592 |
| 559 | Ga0373927_0489562 | 3300035695 | Bacteria | 813 |
| 560 | Ga0373933_0001189 | 3300035724 | Bacteria | 15436 |
| 561 | Ga0373933_0083785 | 3300035724 | Bacteria | 1958 |
| 562 | Ga0373933_0178406 | 3300035724 | Bacteria | 1354 |
| 563 | Ga0373933_0437766 | 3300035724 | Bacteria | 854 |
| 564 | Ga0373947_0055815 | 3300035725 | Bacteria | 2386 |
| 565 | Ga0373937_0013762 | 3300036401 | Bacteria | 7128 |
| 566 | Ga0373937_0051912 | 3300036401 | Bacteria | 3758 |
| 567 | Ga0373937_0058959 | 3300036401 | Bacteria | 3527 |
| 568 | Ga0373937_0096824 | 3300036401 | Bacteria | 2737 |
| 569 | Ga0373937_0118014 | 3300036401 | Bacteria | 2471 |
| 570 | Ga0373937_0672030 | 3300036401 | Bacteria | 982 |
| 571 | Ga0373937_1423189 | 3300036401 | Bacteria | 641 |
| 572 | Ga0316582_0035019 | 3300036647 | Bacteria | 3096 |
| 573 | Ga0316582_0079277 | 3300036647 | Bacteria | 2141 |
| 574 | Ga0316584_0019219 | 3300036712 | Bacteria | 4937 |
| 575 | Ga0373925_0117963 | 3300037068 | Bacteria | 2057 |
| 576 | Ga0373925_0900369 | 3300037068 | Bacteria | 729 |
| 577 | Ga0395905_0022619 | 3300037471 | Bacteria | 5943 |
| 578 | Ga0436364_1407027 | 3300037853 | Bacteria | 23679 |
| 579 | Ga0436365_0308800 | 3300039437 | Bacteria | 1360 |
| 580 | Ga0436360_0884324 | 3300039438 | Bacteria | 586 |
| 581 | Ga0436362_0347491 | 3300039453 | Bacteria | 1457 |
| 582 | Ga0451798_0319564 | 3300041458 | Bacteria | 833 |
| 583 | Ga0451802_0662359 | 3300041460 | Bacteria | 742 |
| 584 | Ga0451807_1468954 | 3300041486 | Bacteria | 2106 |
| 585 | Ga0451807_1832672 | 3300041486 | Unclassified | 648 |
| 586 | Ga0451833_0549793 | 3300041491 | Bacteria | 524 |
| 587 | Ga0451853_0034047 | 3300041512 | Bacteria | 557 |
| 588 | Ga0439460_0002577 | 3300042461 | Bacteria | 4377 |
| 589 | Ga0451577_0012523 | 3300042876 | Bacteria | 7965 |
| 590 | Ga0451577_0976860 | 3300042876 | Unclassified | 761 |
| 591 | Ga0453683_0007127 | 3300044673 | Bacteria | 7616 |
| 592 | Ga0453683_0258891 | 3300044673 | Bacteria | 1110 |
| 593 | Ga0466966_0600212 | 3300044684 | Bacteria | 663 |
| 594 | Ga0453684_0000116 | 3300044712 | Bacteria | 352304 |
| 595 | Ga0453684_0000295 | 3300044712 | Bacteria | 211570 |
| 596 | Ga0453684_0037288 | 3300044712 | Bacteria | 6674 |
| 597 | Ga0453684_0085870 | 3300044712 | Bacteria | 3908 |
| 598 | Ga0453684_0093912 | 3300044712 | Bacteria | 3693 |
| 599 | Ga0453684_0147058 | 3300044712 | Bacteria | 2805 |
| 600 | Ga0453684_0789668 | 3300044712 | Bacteria | 1025 |
| 601 | Ga0453684_1855622 | 3300044712 | Unclassified | 611 |
| 602 | Ga0466971_0068907 | 3300044719 | Bacteria | 1605 |
| 603 | Ga0451576_0005894 | 3300045051 | Bacteria | 15208 |
| 604 | Ga0451576_0121470 | 3300045051 | Bacteria | 2720 |
| 605 | Ga0451576_1808345 | 3300045051 | Unclassified | 631 |
| 606 | Ga0466967_0701760 | 3300045976 | Bacteria | 1002 |
| 607 | Ga0495590_0292163 | 3300046457 | Unclassified | 612 |
| 608 | Ga0495641_0118286 | 3300046461 | Bacteria | 1182 |
| 609 | Ga0495664_0153025 | 3300046477 | Bacteria | 1399 |
| 610 | Ga0495596_0361082 | 3300046500 | Unclassified | 566 |
| 611 | Ga0495630_0003551 | 3300046517 | Bacteria | 10859 |
| 612 | Ga0495630_0140876 | 3300046517 | Bacteria | 1834 |
| 613 | Ga0495630_0514425 | 3300046517 | Bacteria | 918 |
| 614 | Ga0495652_0258563 | 3300046529 | Bacteria | 1286 |
| 615 | Ga0495586_0057737 | 3300046535 | Bacteria | 2106 |
| 616 | Ga0495587_0096111 | 3300046536 | Bacteria | 1709 |
| 617 | Ga0495587_0511027 | 3300046536 | Bacteria | 664 |
| 618 | Ga0495645_0229080 | 3300046543 | Bacteria | 1246 |
| 619 | Ga0495634_0000649 | 3300046642 | Bacteria | 33746 |
| 620 | Ga0495635_0305100 | 3300046663 | Bacteria | 1067 |
| 621 | Ga0495613_0308712 | 3300046689 | Bacteria | 1094 |
| 622 | Ga0495624_0493552 | 3300046690 | Bacteria | 733 |
| 623 | Ga0495674_0001336 | 3300047319 | Bacteria | 24042 |
| 624 | Ga0495680_0057650 | 3300047322 | Bacteria | 3003 |
| 625 | Ga0495680_0751946 | 3300047322 | Bacteria | 640 |
| 626 | Ga0495684_0093485 | 3300047471 | Bacteria | 2277 |
| 627 | Ga0496100_0003660 | 3300048903 | Bacteria | 8042 |
| 628 | Ga0496100_0594571 | 3300048903 | Bacteria | 859 |
| 629 | Ga0496101_1284082 | 3300048904 | Bacteria | 573 |
| 630 | Ga0496102_0937571 | 3300048905 | Bacteria | 787 |
| 631 | Ga0496104_0041250 | 3300048907 | Bacteria | 4327 |
| 632 | Ga0496104_0169572 | 3300048907 | Bacteria | 2093 |
| 633 | Ga0496104_1482344 | 3300048907 | Bacteria | 581 |
| 634 | Ga0496105_0164714 | 3300048908 | Bacteria | 1819 |
| 635 | Ga0496105_0374951 | 3300048908 | Bacteria | 1133 |
| 636 | Ga0496105_0595025 | 3300048908 | Bacteria | 859 |
| 637 | Ga0496105_1094817 | 3300048908 | Bacteria | 592 |
| 638 | Ga0496106_1101387 | 3300048909 | Bacteria | 622 |
| 639 | Ga0496107_0035117 | 3300048910 | Bacteria | 3594 |
| 640 | Ga0496107_0966826 | 3300048910 | Bacteria | 619 |
| 641 | Ga0496107_1016478 | 3300048910 | Bacteria | 601 |
| 642 | Ga0496107_1357534 | 3300048910 | Bacteria | 507 |
| 643 | Ga0496108_0085584 | 3300048911 | Bacteria | 2676 |
| 644 | Ga0496108_0473517 | 3300048911 | Bacteria | 1094 |
| 645 | Ga0496108_0520224 | 3300048911 | Bacteria | 1039 |
| 646 | Ga0496110_1491358 | 3300048913 | Bacteria | 586 |
| 647 | Ga0496112_0318677 | 3300048915 | Bacteria | 1499 |
| 648 | Ga0496112_0322525 | 3300048915 | Bacteria | 1489 |
| 649 | Ga0496114_0000386 | 3300048917 | Bacteria | 32590 |
| 650 | Ga0496114_0006073 | 3300048917 | Bacteria | 9506 |
| 651 | Ga0496114_0040273 | 3300048917 | Bacteria | 3867 |
| 652 | Ga0496114_0258990 | 3300048917 | Bacteria | 1531 |
| 653 | Ga0496115_0056627 | 3300048918 | Bacteria | 3151 |
| 654 | Ga0496115_0174462 | 3300048918 | Bacteria | 1777 |
| 655 | Ga0496115_0270114 | 3300048918 | Bacteria | 1397 |
| 656 | Ga0496115_0293289 | 3300048918 | Bacteria | 1334 |
| 657 | Ga0501310_014424 | 3300049130 | Bacteria | 928 |
| 658 | Ga0501305_044170 | 3300049161 | Bacteria | 732 |
| 659 | Ga0501307_024699 | 3300049162 | Bacteria | 803 |
| 660 | Ga0501307_041252 | 3300049162 | Bacteria | 671 |
| 661 | Ga0501299_068579 | 3300049522 | Unclassified | 765 |
| 662 | Ga0501314_045656 | 3300049530 | Bacteria | 520 |
| 663 | Ga0501034_0000037 | 3300049571 | Bacteria | 239254 |
| 664 | Ga0501036_0038638 | 3300049572 | Bacteria | 4039 |
| 665 | Ga0501036_0206025 | 3300049572 | Bacteria | 1653 |
| 666 | Ga0501037_1096582 | 3300049573 | Unclassified | 516 |
| 667 | Ga0501038_0656571 | 3300049574 | Bacteria | 789 |
| 668 | Ga0501042_0633636 | 3300049578 | Bacteria | 777 |
| 669 | Ga0501043_0002483 | 3300049579 | Bacteria | 15600 |
| 670 | Ga0501046_0000751 | 3300049580 | Bacteria | 31319 |
| 671 | Ga0501047_0000053 | 3300049581 | Bacteria | 150440 |
| 672 | Ga0501048_0001235 | 3300049582 | Bacteria | 19382 |
| 673 | Ga0501067_0003773 | 3300049583 | Bacteria | 8357 |
| 674 | Ga0501067_0003984 | 3300049583 | Bacteria | 8152 |
| 675 | Ga0501067_0040666 | 3300049583 | Bacteria | 2581 |
| 676 | Ga0501068_0001718 | 3300049584 | Bacteria | 11652 |
| 677 | Ga0501068_0702952 | 3300049584 | Bacteria | 661 |
| 678 | Ga0501069_0075490 | 3300049585 | Bacteria | 1893 |
| 679 | Ga0501070_0005205 | 3300049586 | Bacteria | 11084 |
| 680 | Ga0501070_0007053 | 3300049586 | Bacteria | 9559 |
| 681 | Ga0501070_0777221 | 3300049586 | Bacteria | 753 |
| 682 | Ga0501072_0002806 | 3300049588 | Bacteria | 13074 |
| 683 | Ga0501073_0003382 | 3300049589 | Bacteria | 11991 |
| 684 | Ga0501073_0005323 | 3300049589 | Bacteria | 9649 |
| 685 | Ga0501073_0006261 | 3300049589 | Bacteria | 8870 |
| 686 | Ga0501073_0090487 | 3300049589 | Bacteria | 2126 |
| 687 | Ga0501073_0215234 | 3300049589 | Bacteria | 1327 |
| 688 | Ga0501073_0294618 | 3300049589 | Bacteria | 1119 |
| 689 | Ga0501074_0022615 | 3300049590 | Bacteria | 4570 |
| 690 | Ga0501074_0041398 | 3300049590 | Bacteria | 3335 |
| 691 | Ga0501074_0122318 | 3300049590 | Bacteria | 1861 |
| 692 | Ga0501227_235951 | 3300049665 | Bacteria | 521 |
| 693 | Ga0501230_166809 | 3300049667 | Bacteria | 504 |
| 694 | Ga0501225_0266137 | 3300049705 | Bacteria | 569 |
| 695 | Ga0501079_0000174 | 3300049741 | Bacteria | 36202 |
| 696 | Ga0501079_0314223 | 3300049741 | Bacteria | 1226 |
| 697 | Ga0501080_0007066 | 3300049742 | Bacteria | 10138 |
| 698 | Ga0501080_1777444 | 3300049742 | Unclassified | 518 |
| 699 | Ga0501083_0092319 | 3300049744 | Bacteria | 1998 |
| 700 | Ga0501083_0463700 | 3300049744 | Bacteria | 824 |
| 701 | nmdc:mga05p37_662727_c1 | 3300050507 | Bacteria | 1166 |
| 702 | nmdc:mga08y16_481495_c1 | 3300050511 | Bacteria | 1263 |
| 703 | nmdc:mga08y16_92382_c1 | 3300050511 | Bacteria | 3154 |
| 704 | nmdc:mga0n895_1036394_c1 | 3300050512 | Bacteria | 800 |
| 705 | Ga0495601_0034268 | 3300053077 | Bacteria | 3167 |
| 706 | Ga0495601_0188118 | 3300053077 | Bacteria | 1350 |
| 707 | Ga0495601_0380331 | 3300053077 | Bacteria | 916 |
| 708 | Ga0495595_0135146 | 3300053084 | Bacteria | 1207 |
| 709 | Ga0495619_0028862 | 3300053085 | Bacteria | 3580 |
| 710 | Ga0495619_0589775 | 3300053085 | Bacteria | 761 |
| 711 | Ga0501084_0000022 | 3300054114 | Bacteria | 145804 |
| 712 | Ga0501084_0531397 | 3300054114 | Bacteria | 994 |
| 713 | Ga0587084_144566 | 3300059477 | Unclassified | 518 |
| 714 | Ga0587111_0096616 | 3300060346 | Bacteria | 730 |
| 715 | Ga0501082_0006072 | 3300060353 | Bacteria | 10487 |
| 716 | Ga0501082_0117541 | 3300060353 | Bacteria | 2303 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005444 | Ga0070694_100089893 | Ga0070694_1000898932 | 86 |
| 2 | 3300005545 | Ga0070695_100032852 | Ga0070695_1000328526 | 86 |
| 3 | 3300005549 | Ga0070704_100239301 | Ga0070704_1002393012 | 86 |
| 4 | 3300049584 | Ga0501068_0702952 | Ga0501068_0702952_22_291 | 89 |
| 5 | 3300025986 | Ga0207658_11330371 | Ga0207658_113303712 | 90 |
| 6 | 3300042876 | Ga0451577_0012523 | Ga0451577_0012523_4530_4808 | 91 |
| 7 | 3300044673 | Ga0453683_0007127 | Ga0453683_0007127_4888_5166 | 91 |
| 8 | 3300044712 | Ga0453684_0000295 | Ga0453684_0000295_111398_111676 | 91 |
| 9 | 3300045051 | Ga0451576_0005894 | Ga0451576_0005894_1944_2222 | 91 |
| 10 | 3300032168 | Ga0316593_10115032 | Ga0316593_101150322 | 92 |
| 11 | 3300005290 | Ga0065712_10693493 | Ga0065712_106934931 | 93 |
| 12 | 3300005340 | Ga0070689_100453005 | Ga0070689_1004530052 | 93 |
| 13 | 3300005340 | Ga0070689_102141255 | Ga0070689_1021412551 | 93 |
| 14 | 3300005367 | Ga0070667_101131486 | Ga0070667_1011314862 | 93 |
| 15 | 3300005539 | Ga0068853_100000004 | Ga0068853_10000000496 | 93 |
| 16 | 3300006195 | Ga0075366_10549464 | Ga0075366_105494642 | 93 |
| 17 | 3300011119 | Ga0105246_11645796 | Ga0105246_116457961 | 93 |
| 18 | 3300025936 | Ga0207670_11731623 | Ga0207670_117316231 | 93 |
| 19 | 3300026041 | Ga0207639_10000029 | Ga0207639_10000029100 | 93 |
| 20 | 3300026095 | Ga0207676_11014416 | Ga0207676_110144162 | 93 |
| 21 | 3300037471 | Ga0395905_0022619 | Ga0395905_0022619_4025_4309 | 93 |
| 22 | 3300041512 | Ga0451853_0034047 | Ga0451853_0034047_100_384 | 93 |
| 23 | 3300044673 | Ga0453683_0258891 | Ga0453683_0258891_92_376 | 93 |
| 24 | 3300049161 | Ga0501305_044170 | Ga0501305_044170_415_699 | 93 |
| 25 | 3300049162 | Ga0501307_024699 | Ga0501307_024699_417_701 | 93 |
| 26 | 3300049162 | Ga0501307_041252 | Ga0501307_041252_343_627 | 93 |
| 27 | 3300049530 | Ga0501314_045656 | Ga0501314_045656_73_357 | 93 |
| 28 | 3300049665 | Ga0501227_235951 | Ga0501227_235951_196_480 | 93 |
| 29 | 3300005345 | Ga0070692_10981398 | Ga0070692_109813981 | 94 |
| 30 | 3300005536 | Ga0070697_100919961 | Ga0070697_1009199612 | 94 |
| 31 | 3300005536 | Ga0070697_101206902 | Ga0070697_1012069022 | 94 |
| 32 | 3300005546 | Ga0070696_100669537 | Ga0070696_1006695372 | 94 |
| 33 | 3300031239 | Ga0265328_10005372 | Ga0265328_100053725 | 94 |
| 34 | 3300031250 | Ga0265331_10000090 | Ga0265331_100000905 | 94 |
| 35 | 3300039437 | Ga0436365_0308800 | Ga0436365_0308800_239_571 | 94 |
| 36 | 3300039438 | Ga0436360_0884324 | Ga0436360_0884324_79_393 | 94 |
| 37 | 3300039453 | Ga0436362_0347491 | Ga0436362_0347491_158_484 | 94 |
| 38 | 3300044712 | Ga0453684_0147058 | Ga0453684_0147058_2218_2550 | 94 |
| 39 | 3300005343 | Ga0070687_100001952 | Ga0070687_10000195212 | 96 |
| 40 | 3300009094 | Ga0111539_10563491 | Ga0111539_105634912 | 96 |
| 41 | 3300021388 | Ga0213875_10009336 | Ga0213875_100093367 | 96 |
| 42 | 3300025918 | Ga0207662_10000745 | Ga0207662_1000074512 | 96 |
| 43 | 3300025939 | Ga0207665_10327042 | Ga0207665_103270422 | 96 |
| 44 | 3300031665 | Ga0316575_10002995 | Ga0316575_1000299510 | 96 |
| 45 | 3300031691 | Ga0316579_10014492 | Ga0316579_100144926 | 96 |
| 46 | 3300031727 | Ga0316576_10018164 | Ga0316576_100181645 | 96 |
| 47 | 3300031727 | Ga0316576_10491746 | Ga0316576_104917462 | 96 |
| 48 | 3300031728 | Ga0316578_10033274 | Ga0316578_100332742 | 96 |
| 49 | 3300031728 | Ga0316578_10794577 | Ga0316578_107945771 | 96 |
| 50 | 3300031733 | Ga0316577_10012472 | Ga0316577_100124726 | 96 |
| 51 | 3300032137 | Ga0316585_10026458 | Ga0316585_100264581 | 96 |
| 52 | 3300032168 | Ga0316593_10222634 | Ga0316593_102226342 | 96 |
| 53 | 3300032168 | Ga0316593_10254773 | Ga0316593_102547732 | 96 |
| 54 | 3300032168 | Ga0316593_10259055 | Ga0316593_102590552 | 96 |
| 55 | 3300033527 | Ga0316586_1041122 | Ga0316586_10411222 | 96 |
| 56 | 3300033541 | Ga0316596_1097766 | Ga0316596_10977662 | 96 |
| 57 | 3300035398 | Ga0316574_0010007 | Ga0316574_0010007_1738_2028 | 96 |
| 58 | 3300035398 | Ga0316574_0530920 | Ga0316574_0530920_85_375 | 96 |
| 59 | 3300036647 | Ga0316582_0035019 | Ga0316582_0035019_583_873 | 96 |
| 60 | 3300036647 | Ga0316582_0079277 | Ga0316582_0079277_1639_1929 | 96 |
| 61 | 3300036712 | Ga0316584_0019219 | Ga0316584_0019219_4047_4337 | 96 |
| 62 | 3300037853 | Ga0436364_1407027 | Ga0436364_1407027_6792_7082 | 96 |
| 63 | 3300042461 | Ga0439460_0002577 | Ga0439460_0002577_465_773 | 96 |
| 64 | 3300049573 | Ga0501037_1096582 | Ga0501037_1096582_84_404 | 96 |
| 65 | 3300050511 | nmdc:mga08y16_481495_c1 | nmdc:mga08y16_481495_c1_773_1063 | 96 |
| 66 | 3300013297 | Ga0157378_10495841 | Ga0157378_104958412 | 106 |
| 67 | 3300036401 | Ga0373937_0672030 | Ga0373937_0672030_288_611 | 106 |
| 68 | 3300049589 | Ga0501073_0006261 | Ga0501073_0006261_3848_4171 | 106 |
| 69 | 3300049590 | Ga0501074_0122318 | Ga0501074_0122318_1125_1448 | 106 |
| 70 | 3300005365 | Ga0070688_100773247 | Ga0070688_1007732472 | 107 |
| 71 | 3300028558 | Ga0265326_10086852 | Ga0265326_100868522 | 107 |
| 72 | 3300028573 | Ga0265334_10003040 | Ga0265334_100030404 | 107 |
| 73 | 3300028653 | Ga0265323_10015822 | Ga0265323_100158224 | 107 |
| 74 | 3300028653 | Ga0265323_10018664 | Ga0265323_100186643 | 107 |
| 75 | 3300028800 | Ga0265338_10016967 | Ga0265338_100169674 | 107 |
| 76 | 3300028800 | Ga0265338_10132703 | Ga0265338_101327033 | 107 |
| 77 | 3300031235 | Ga0265330_10000541 | Ga0265330_1000054131 | 107 |
| 78 | 3300031235 | Ga0265330_10001334 | Ga0265330_100013343 | 107 |
| 79 | 3300031235 | Ga0265330_10009350 | Ga0265330_100093509 | 107 |
| 80 | 3300031235 | Ga0265330_10013183 | Ga0265330_100131834 | 107 |
| 81 | 3300031238 | Ga0265332_10336885 | Ga0265332_103368852 | 107 |
| 82 | 3300031242 | Ga0265329_10003473 | Ga0265329_1000347314 | 107 |
| 83 | 3300031242 | Ga0265329_10022198 | Ga0265329_100221983 | 107 |
| 84 | 3300031242 | Ga0265329_10151123 | Ga0265329_101511231 | 107 |
| 85 | 3300031247 | Ga0265340_10188620 | Ga0265340_101886202 | 107 |
| 86 | 3300031249 | Ga0265339_10287933 | Ga0265339_102879332 | 107 |
| 87 | 3300031344 | Ga0265316_10000251 | Ga0265316_100002514 | 107 |
| 88 | 3300031344 | Ga0265316_10000984 | Ga0265316_1000098438 | 107 |
| 89 | 3300031344 | Ga0265316_10010605 | Ga0265316_100106058 | 107 |
| 90 | 3300031344 | Ga0265316_10058086 | Ga0265316_100580863 | 107 |
| 91 | 3300031344 | Ga0265316_10068712 | Ga0265316_100687123 | 107 |
| 92 | 3300031344 | Ga0265316_10346857 | Ga0265316_103468572 | 107 |
| 93 | 3300031712 | Ga0265342_10008085 | Ga0265342_100080853 | 107 |
| 94 | 3300031712 | Ga0265342_10048044 | Ga0265342_100480444 | 107 |
| 95 | 3300031712 | Ga0265342_10204027 | Ga0265342_102040271 | 107 |
| 96 | 3300042876 | Ga0451577_0976860 | Ga0451577_0976860_76_405 | 107 |
| 97 | 3300044712 | Ga0453684_0000116 | Ga0453684_0000116_247304_247633 | 107 |
| 98 | 3300044712 | Ga0453684_0037288 | Ga0453684_0037288_2133_2462 | 107 |
| 99 | 3300044712 | Ga0453684_0093912 | Ga0453684_0093912_1866_2195 | 107 |
| 100 | 3300044712 | Ga0453684_1855622 | Ga0453684_1855622_112_441 | 107 |
| 101 | 3300045051 | Ga0451576_0121470 | Ga0451576_0121470_1248_1577 | 107 |
| 102 | 3300046461 | Ga0495641_0118286 | Ga0495641_0118286_776_1102 | 107 |
| 103 | 3300002868 | Ga0006767J43181_103125 | Ga0006767J43181_1031252 | 108 |
| 104 | 3300002870 | Ga0006763J43179_104103 | Ga0006763J43179_1041032 | 108 |
| 105 | 3300003158 | Ga0006760J45825_104057 | Ga0006760J45825_1040572 | 108 |
| 106 | 3300003163 | Ga0006759J45824_1006649 | Ga0006759J45824_10066494 | 108 |
| 107 | 3300003163 | Ga0006759J45824_1093956 | Ga0006759J45824_10939562 | 108 |
| 108 | 3300003163 | Ga0006759J45824_1158952 | Ga0006759J45824_11589522 | 108 |
| 109 | 3300003300 | Ga0006758J48902_1008419 | Ga0006758J48902_10084192 | 108 |
| 110 | 3300003305 | Ga0006770J48903_1041109 | Ga0006770J48903_10411092 | 108 |
| 111 | 3300003323 | rootH1_10067392 | rootH1_100673923 | 108 |
| 112 | 3300003693 | Ga0032354_1009872 | Ga0032354_10098723 | 108 |
| 113 | 3300004798 | Ga0058859_11239146 | Ga0058859_112391462 | 108 |
| 114 | 3300004798 | Ga0058859_11768657 | Ga0058859_117686572 | 108 |
| 115 | 3300004798 | Ga0058859_11779707 | Ga0058859_117797072 | 108 |
| 116 | 3300005290 | Ga0065712_10175385 | Ga0065712_101753852 | 108 |
| 117 | 3300005293 | Ga0065715_10346913 | Ga0065715_103469132 | 108 |
| 118 | 3300005327 | Ga0070658_10111351 | Ga0070658_101113514 | 108 |
| 119 | 3300005328 | Ga0070676_10278379 | Ga0070676_102783792 | 108 |
| 120 | 3300005328 | Ga0070676_11102779 | Ga0070676_111027792 | 108 |
| 121 | 3300005329 | Ga0070683_100082061 | Ga0070683_1000820613 | 108 |
| 122 | 3300005329 | Ga0070683_100093535 | Ga0070683_1000935354 | 108 |
| 123 | 3300005329 | Ga0070683_100095923 | Ga0070683_1000959232 | 108 |
| 124 | 3300005329 | Ga0070683_100293889 | Ga0070683_1002938891 | 108 |
| 125 | 3300005329 | Ga0070683_100910515 | Ga0070683_1009105152 | 108 |
| 126 | 3300005329 | Ga0070683_100972752 | Ga0070683_1009727522 | 108 |
| 127 | 3300005329 | Ga0070683_101273004 | Ga0070683_1012730042 | 108 |
| 128 | 3300005330 | Ga0070690_100079405 | Ga0070690_1000794054 | 108 |
| 129 | 3300005330 | Ga0070690_100216563 | Ga0070690_1002165632 | 108 |
| 130 | 3300005330 | Ga0070690_101707513 | Ga0070690_1017075132 | 108 |
| 131 | 3300005331 | Ga0070670_100034493 | Ga0070670_1000344935 | 108 |
| 132 | 3300005331 | Ga0070670_100690222 | Ga0070670_1006902222 | 108 |
| 133 | 3300005331 | Ga0070670_101540257 | Ga0070670_1015402571 | 108 |
| 134 | 3300005334 | Ga0068869_100700486 | Ga0068869_1007004862 | 108 |
| 135 | 3300005334 | Ga0068869_101075753 | Ga0068869_1010757532 | 108 |
| 136 | 3300005335 | Ga0070666_10254507 | Ga0070666_102545072 | 108 |
| 137 | 3300005335 | Ga0070666_10319417 | Ga0070666_103194172 | 108 |
| 138 | 3300005336 | Ga0070680_100078067 | Ga0070680_1000780674 | 108 |
| 139 | 3300005336 | Ga0070680_100997661 | Ga0070680_1009976611 | 108 |
| 140 | 3300005336 | Ga0070680_101073878 | Ga0070680_1010738781 | 108 |
| 141 | 3300005337 | Ga0070682_100189835 | Ga0070682_1001898352 | 108 |
| 142 | 3300005337 | Ga0070682_100198045 | Ga0070682_1001980452 | 108 |
| 143 | 3300005337 | Ga0070682_100403296 | Ga0070682_1004032962 | 108 |
| 144 | 3300005337 | Ga0070682_100893131 | Ga0070682_1008931312 | 108 |
| 145 | 3300005337 | Ga0070682_101378178 | Ga0070682_1013781781 | 108 |
| 146 | 3300005338 | Ga0068868_100467322 | Ga0068868_1004673221 | 108 |
| 147 | 3300005338 | Ga0068868_101251073 | Ga0068868_1012510731 | 108 |
| 148 | 3300005338 | Ga0068868_102198059 | Ga0068868_1021980591 | 108 |
| 149 | 3300005339 | Ga0070660_100562713 | Ga0070660_1005627132 | 108 |
| 150 | 3300005339 | Ga0070660_101356042 | Ga0070660_1013560422 | 108 |
| 151 | 3300005340 | Ga0070689_100000043 | Ga0070689_1000000434 | 108 |
| 152 | 3300005340 | Ga0070689_100080071 | Ga0070689_1000800712 | 108 |
| 153 | 3300005340 | Ga0070689_100157622 | Ga0070689_1001576224 | 108 |
| 154 | 3300005340 | Ga0070689_100178334 | Ga0070689_1001783341 | 108 |
| 155 | 3300005340 | Ga0070689_100614353 | Ga0070689_1006143532 | 108 |
| 156 | 3300005341 | Ga0070691_10066982 | Ga0070691_100669823 | 108 |
| 157 | 3300005341 | Ga0070691_10478747 | Ga0070691_104787472 | 108 |
| 158 | 3300005343 | Ga0070687_100034358 | Ga0070687_1000343584 | 108 |
| 159 | 3300005343 | Ga0070687_100282976 | Ga0070687_1002829762 | 108 |
| 160 | 3300005343 | Ga0070687_101410989 | Ga0070687_1014109891 | 108 |
| 161 | 3300005344 | Ga0070661_100586268 | Ga0070661_1005862681 | 108 |
| 162 | 3300005345 | Ga0070692_10067654 | Ga0070692_100676542 | 108 |
| 163 | 3300005347 | Ga0070668_100250387 | Ga0070668_1002503873 | 108 |
| 164 | 3300005347 | Ga0070668_101912527 | Ga0070668_1019125271 | 108 |
| 165 | 3300005353 | Ga0070669_100066027 | Ga0070669_1000660273 | 108 |
| 166 | 3300005354 | Ga0070675_100235508 | Ga0070675_1002355083 | 108 |
| 167 | 3300005354 | Ga0070675_100246062 | Ga0070675_1002460622 | 108 |
| 168 | 3300005355 | Ga0070671_101116695 | Ga0070671_1011166952 | 108 |
| 169 | 3300005355 | Ga0070671_101516481 | Ga0070671_1015164812 | 108 |
| 170 | 3300005356 | Ga0070674_100116088 | Ga0070674_1001160884 | 108 |
| 171 | 3300005356 | Ga0070674_101419954 | Ga0070674_1014199541 | 108 |
| 172 | 3300005364 | Ga0070673_100036693 | Ga0070673_1000366935 | 108 |
| 173 | 3300005364 | Ga0070673_100091524 | Ga0070673_1000915243 | 108 |
| 174 | 3300005364 | Ga0070673_102040137 | Ga0070673_1020401372 | 108 |
| 175 | 3300005365 | Ga0070688_100032408 | Ga0070688_1000324081 | 108 |
| 176 | 3300005365 | Ga0070688_100061965 | Ga0070688_1000619654 | 108 |
| 177 | 3300005365 | Ga0070688_100294589 | Ga0070688_1002945891 | 108 |
| 178 | 3300005365 | Ga0070688_100847836 | Ga0070688_1008478362 | 108 |
| 179 | 3300005365 | Ga0070688_100936868 | Ga0070688_1009368682 | 108 |
| 180 | 3300005366 | Ga0070659_100180238 | Ga0070659_1001802384 | 108 |
| 181 | 3300005367 | Ga0070667_100204537 | Ga0070667_1002045372 | 108 |
| 182 | 3300005367 | Ga0070667_100309483 | Ga0070667_1003094832 | 108 |
| 183 | 3300005367 | Ga0070667_102093951 | Ga0070667_1020939511 | 108 |
| 184 | 3300005434 | Ga0070709_10272743 | Ga0070709_102727432 | 108 |
| 185 | 3300005434 | Ga0070709_10792312 | Ga0070709_107923122 | 108 |
| 186 | 3300005436 | Ga0070713_101158800 | Ga0070713_1011588001 | 108 |
| 187 | 3300005436 | Ga0070713_101371109 | Ga0070713_1013711091 | 108 |
| 188 | 3300005437 | Ga0070710_10149428 | Ga0070710_101494281 | 108 |
| 189 | 3300005438 | Ga0070701_10077689 | Ga0070701_100776893 | 108 |
| 190 | 3300005438 | Ga0070701_10873261 | Ga0070701_108732612 | 108 |
| 191 | 3300005439 | Ga0070711_100214813 | Ga0070711_1002148133 | 108 |
| 192 | 3300005440 | Ga0070705_100067352 | Ga0070705_1000673522 | 108 |
| 193 | 3300005440 | Ga0070705_101156657 | Ga0070705_1011566571 | 108 |
| 194 | 3300005441 | Ga0070700_100019232 | Ga0070700_1000192327 | 108 |
| 195 | 3300005441 | Ga0070700_100560814 | Ga0070700_1005608142 | 108 |
| 196 | 3300005441 | Ga0070700_101329846 | Ga0070700_1013298462 | 108 |
| 197 | 3300005444 | Ga0070694_101298826 | Ga0070694_1012988262 | 108 |
| 198 | 3300005445 | Ga0070708_101918034 | Ga0070708_1019180342 | 108 |
| 199 | 3300005456 | Ga0070678_100061341 | Ga0070678_1000613414 | 108 |
| 200 | 3300005456 | Ga0070678_100745075 | Ga0070678_1007450752 | 108 |
| 201 | 3300005456 | Ga0070678_101483080 | Ga0070678_1014830802 | 108 |
| 202 | 3300005457 | Ga0070662_100030416 | Ga0070662_1000304163 | 108 |
| 203 | 3300005458 | Ga0070681_10775056 | Ga0070681_107750562 | 108 |
| 204 | 3300005458 | Ga0070681_10947926 | Ga0070681_109479262 | 108 |
| 205 | 3300005459 | Ga0068867_100680719 | Ga0068867_1006807192 | 108 |
| 206 | 3300005459 | Ga0068867_100725051 | Ga0068867_1007250512 | 108 |
| 207 | 3300005466 | Ga0070685_10052343 | Ga0070685_100523434 | 108 |
| 208 | 3300005466 | Ga0070685_10109607 | Ga0070685_101096072 | 108 |
| 209 | 3300005466 | Ga0070685_10160181 | Ga0070685_101601811 | 108 |
| 210 | 3300005466 | Ga0070685_10477584 | Ga0070685_104775842 | 108 |
| 211 | 3300005467 | Ga0070706_101199227 | Ga0070706_1011992272 | 108 |
| 212 | 3300005467 | Ga0070706_102074715 | Ga0070706_1020747152 | 108 |
| 213 | 3300005471 | Ga0070698_100648628 | Ga0070698_1006486282 | 108 |
| 214 | 3300005530 | Ga0070679_100029036 | Ga0070679_1000290364 | 108 |
| 215 | 3300005530 | Ga0070679_100190634 | Ga0070679_1001906341 | 108 |
| 216 | 3300005530 | Ga0070679_100290785 | Ga0070679_1002907854 | 108 |
| 217 | 3300005535 | Ga0070684_100058335 | Ga0070684_1000583353 | 108 |
| 218 | 3300005535 | Ga0070684_100136595 | Ga0070684_1001365952 | 108 |
| 219 | 3300005535 | Ga0070684_100400359 | Ga0070684_1004003592 | 108 |
| 220 | 3300005535 | Ga0070684_100532982 | Ga0070684_1005329822 | 108 |
| 221 | 3300005535 | Ga0070684_100741356 | Ga0070684_1007413562 | 108 |
| 222 | 3300005535 | Ga0070684_101074725 | Ga0070684_1010747252 | 108 |
| 223 | 3300005535 | Ga0070684_101811665 | Ga0070684_1018116652 | 108 |
| 224 | 3300005536 | Ga0070697_101650823 | Ga0070697_1016508231 | 108 |
| 225 | 3300005539 | Ga0068853_100267348 | Ga0068853_1002673482 | 108 |
| 226 | 3300005539 | Ga0068853_100293961 | Ga0068853_1002939611 | 108 |
| 227 | 3300005539 | Ga0068853_102484884 | Ga0068853_1024848842 | 108 |
| 228 | 3300005543 | Ga0070672_100042880 | Ga0070672_1000428804 | 108 |
| 229 | 3300005543 | Ga0070672_100102627 | Ga0070672_1001026274 | 108 |
| 230 | 3300005543 | Ga0070672_100488954 | Ga0070672_1004889542 | 108 |
| 231 | 3300005544 | Ga0070686_100016687 | Ga0070686_1000166874 | 108 |
| 232 | 3300005544 | Ga0070686_100046683 | Ga0070686_1000466834 | 108 |
| 233 | 3300005544 | Ga0070686_100433255 | Ga0070686_1004332551 | 108 |
| 234 | 3300005544 | Ga0070686_100831462 | Ga0070686_1008314621 | 108 |
| 235 | 3300005548 | Ga0070665_100342825 | Ga0070665_1003428253 | 108 |
| 236 | 3300005548 | Ga0070665_101619982 | Ga0070665_1016199822 | 108 |
| 237 | 3300005563 | Ga0068855_100076432 | Ga0068855_1000764322 | 108 |
| 238 | 3300005563 | Ga0068855_100152247 | Ga0068855_1001522473 | 108 |
| 239 | 3300005563 | Ga0068855_100153786 | Ga0068855_1001537862 | 108 |
| 240 | 3300005577 | Ga0068857_100171461 | Ga0068857_1001714612 | 108 |
| 241 | 3300005577 | Ga0068857_101935815 | Ga0068857_1019358151 | 108 |
| 242 | 3300005577 | Ga0068857_102428114 | Ga0068857_1024281142 | 108 |
| 243 | 3300005614 | Ga0068856_100060062 | Ga0068856_1000600622 | 108 |
| 244 | 3300005614 | Ga0068856_100231627 | Ga0068856_1002316274 | 108 |
| 245 | 3300005614 | Ga0068856_100367002 | Ga0068856_1003670022 | 108 |
| 246 | 3300005615 | Ga0070702_100176947 | Ga0070702_1001769472 | 108 |
| 247 | 3300005615 | Ga0070702_100393589 | Ga0070702_1003935891 | 108 |
| 248 | 3300005615 | Ga0070702_100845384 | Ga0070702_1008453841 | 108 |
| 249 | 3300005616 | Ga0068852_100443584 | Ga0068852_1004435843 | 108 |
| 250 | 3300005616 | Ga0068852_100771108 | Ga0068852_1007711082 | 108 |
| 251 | 3300005616 | Ga0068852_101328740 | Ga0068852_1013287402 | 108 |
| 252 | 3300005617 | Ga0068859_100042834 | Ga0068859_1000428344 | 108 |
| 253 | 3300005617 | Ga0068859_100180325 | Ga0068859_1001803253 | 108 |
| 254 | 3300005618 | Ga0068864_102184926 | Ga0068864_1021849262 | 108 |
| 255 | 3300005618 | Ga0068864_102593756 | Ga0068864_1025937561 | 108 |
| 256 | 3300005718 | Ga0068866_10268249 | Ga0068866_102682492 | 108 |
| 257 | 3300005718 | Ga0068866_10350800 | Ga0068866_103508002 | 108 |
| 258 | 3300005719 | Ga0068861_100046691 | Ga0068861_1000466912 | 108 |
| 259 | 3300005841 | Ga0068863_100316875 | Ga0068863_1003168751 | 108 |
| 260 | 3300005841 | Ga0068863_100492968 | Ga0068863_1004929682 | 108 |
| 261 | 3300005841 | Ga0068863_102415467 | Ga0068863_1024154671 | 108 |
| 262 | 3300005843 | Ga0068860_100481748 | Ga0068860_1004817482 | 108 |
| 263 | 3300005843 | Ga0068860_100484640 | Ga0068860_1004846402 | 108 |
| 264 | 3300005843 | Ga0068860_101608691 | Ga0068860_1016086911 | 108 |
| 265 | 3300005844 | Ga0068862_101532282 | Ga0068862_1015322822 | 108 |
| 266 | 3300005844 | Ga0068862_101736155 | Ga0068862_1017361551 | 108 |
| 267 | 3300005937 | Ga0081455_10113380 | Ga0081455_101133802 | 108 |
| 268 | 3300006028 | Ga0070717_11208333 | Ga0070717_112083332 | 108 |
| 269 | 3300006173 | Ga0070716_100264302 | Ga0070716_1002643022 | 108 |
| 270 | 3300006173 | Ga0070716_100870745 | Ga0070716_1008707452 | 108 |
| 271 | 3300006175 | Ga0070712_100331620 | Ga0070712_1003316202 | 108 |
| 272 | 3300006237 | Ga0097621_100716854 | Ga0097621_1007168541 | 108 |
| 273 | 3300006237 | Ga0097621_101186330 | Ga0097621_1011863301 | 108 |
| 274 | 3300006358 | Ga0068871_100672501 | Ga0068871_1006725012 | 108 |
| 275 | 3300006358 | Ga0068871_101274853 | Ga0068871_1012748532 | 108 |
| 276 | 3300006358 | Ga0068871_101277471 | Ga0068871_1012774712 | 108 |
| 277 | 3300006358 | Ga0068871_102006037 | Ga0068871_1020060371 | 108 |
| 278 | 3300006358 | Ga0068871_102035268 | Ga0068871_1020352682 | 108 |
| 279 | 3300006844 | Ga0075428_102059615 | Ga0075428_1020596152 | 108 |
| 280 | 3300006852 | Ga0075433_11428935 | Ga0075433_114289352 | 108 |
| 281 | 3300006871 | Ga0075434_100727321 | Ga0075434_1007273211 | 108 |
| 282 | 3300006881 | Ga0068865_100279850 | Ga0068865_1002798502 | 108 |
| 283 | 3300006881 | Ga0068865_100582500 | Ga0068865_1005825002 | 108 |
| 284 | 3300006881 | Ga0068865_100829526 | Ga0068865_1008295262 | 108 |
| 285 | 3300006881 | Ga0068865_101252525 | Ga0068865_1012525251 | 108 |
| 286 | 3300006914 | Ga0075436_101014650 | Ga0075436_1010146501 | 108 |
| 287 | 3300006931 | Ga0097620_100042837 | Ga0097620_1000428374 | 108 |
| 288 | 3300006931 | Ga0097620_100180328 | Ga0097620_1001803283 | 108 |
| 289 | 3300009093 | Ga0105240_10000795 | Ga0105240_100007958 | 108 |
| 290 | 3300009093 | Ga0105240_10318108 | Ga0105240_103181083 | 108 |
| 291 | 3300009093 | Ga0105240_10951372 | Ga0105240_109513722 | 108 |
| 292 | 3300009094 | Ga0111539_10165120 | Ga0111539_101651205 | 108 |
| 293 | 3300009094 | Ga0111539_11404632 | Ga0111539_114046321 | 108 |
| 294 | 3300009098 | Ga0105245_10326263 | Ga0105245_103262632 | 108 |
| 295 | 3300009098 | Ga0105245_10364874 | Ga0105245_103648742 | 108 |
| 296 | 3300009098 | Ga0105245_10402423 | Ga0105245_104024233 | 108 |
| 297 | 3300009098 | Ga0105245_12253441 | Ga0105245_122534411 | 108 |
| 298 | 3300009098 | Ga0105245_12678882 | Ga0105245_126788822 | 108 |
| 299 | 3300009101 | Ga0105247_11095213 | Ga0105247_110952132 | 108 |
| 300 | 3300009147 | Ga0114129_10569212 | Ga0114129_105692122 | 108 |
| 301 | 3300009148 | Ga0105243_11565369 | Ga0105243_115653691 | 108 |
| 302 | 3300009174 | Ga0105241_10505368 | Ga0105241_105053682 | 108 |
| 303 | 3300009176 | Ga0105242_10638967 | Ga0105242_106389672 | 108 |
| 304 | 3300009545 | Ga0105237_10002220 | Ga0105237_1000222037 | 108 |
| 305 | 3300009545 | Ga0105237_10201518 | Ga0105237_102015182 | 108 |
| 306 | 3300009545 | Ga0105237_11078049 | Ga0105237_110780492 | 108 |
| 307 | 3300009545 | Ga0105237_11492670 | Ga0105237_114926701 | 108 |
| 308 | 3300009551 | Ga0105238_10056048 | Ga0105238_100560486 | 108 |
| 309 | 3300009551 | Ga0105238_10686083 | Ga0105238_106860832 | 108 |
| 310 | 3300009551 | Ga0105238_12147164 | Ga0105238_121471642 | 108 |
| 311 | 3300010375 | Ga0105239_10284944 | Ga0105239_102849443 | 108 |
| 312 | 3300010375 | Ga0105239_11745225 | Ga0105239_117452252 | 108 |
| 313 | 3300010375 | Ga0105239_12755137 | Ga0105239_127551372 | 108 |
| 314 | 3300011119 | Ga0105246_12128475 | Ga0105246_121284751 | 108 |
| 315 | 3300013102 | Ga0157371_10325770 | Ga0157371_103257702 | 108 |
| 316 | 3300013296 | Ga0157374_10054827 | Ga0157374_100548272 | 108 |
| 317 | 3300013296 | Ga0157374_11075912 | Ga0157374_110759122 | 108 |
| 318 | 3300013297 | Ga0157378_10487709 | Ga0157378_104877091 | 108 |
| 319 | 3300013297 | Ga0157378_10724834 | Ga0157378_107248342 | 108 |
| 320 | 3300013306 | Ga0163162_10162216 | Ga0163162_101622163 | 108 |
| 321 | 3300013307 | Ga0157372_10918100 | Ga0157372_109181002 | 108 |
| 322 | 3300013307 | Ga0157372_10966444 | Ga0157372_109664442 | 108 |
| 323 | 3300013307 | Ga0157372_12714985 | Ga0157372_127149852 | 108 |
| 324 | 3300013308 | Ga0157375_11266341 | Ga0157375_112663412 | 108 |
| 325 | 3300013308 | Ga0157375_11962180 | Ga0157375_119621802 | 108 |
| 326 | 3300014325 | Ga0163163_11226335 | Ga0163163_112263352 | 108 |
| 327 | 3300014326 | Ga0157380_10983976 | Ga0157380_109839762 | 108 |
| 328 | 3300014326 | Ga0157380_11404115 | Ga0157380_114041152 | 108 |
| 329 | 3300014745 | Ga0157377_10462162 | Ga0157377_104621622 | 108 |
| 330 | 3300014968 | Ga0157379_10164923 | Ga0157379_101649234 | 108 |
| 331 | 3300014968 | Ga0157379_12035381 | Ga0157379_120353811 | 108 |
| 332 | 3300014969 | Ga0157376_10253275 | Ga0157376_102532754 | 108 |
| 333 | 3300014969 | Ga0157376_10655572 | Ga0157376_106555722 | 108 |
| 334 | 3300014969 | Ga0157376_10846268 | Ga0157376_108462682 | 108 |
| 335 | 3300020078 | Ga0206352_10638828 | Ga0206352_106388282 | 108 |
| 336 | 3300020078 | Ga0206352_11129659 | Ga0206352_111296592 | 108 |
| 337 | 3300025271 | Ga0207666_1000994 | Ga0207666_10009945 | 108 |
| 338 | 3300025898 | Ga0207692_10701363 | Ga0207692_107013632 | 108 |
| 339 | 3300025901 | Ga0207688_10588246 | Ga0207688_105882462 | 108 |
| 340 | 3300025903 | Ga0207680_10036485 | Ga0207680_100364853 | 108 |
| 341 | 3300025906 | Ga0207699_10193517 | Ga0207699_101935172 | 108 |
| 342 | 3300025906 | Ga0207699_10530758 | Ga0207699_105307582 | 108 |
| 343 | 3300025907 | Ga0207645_10026906 | Ga0207645_100269066 | 108 |
| 344 | 3300025908 | Ga0207643_10748640 | Ga0207643_107486401 | 108 |
| 345 | 3300025908 | Ga0207643_11083284 | Ga0207643_110832842 | 108 |
| 346 | 3300025909 | Ga0207705_10026045 | Ga0207705_100260456 | 108 |
| 347 | 3300025910 | Ga0207684_11005027 | Ga0207684_110050272 | 108 |
| 348 | 3300025911 | Ga0207654_10400479 | Ga0207654_104004792 | 108 |
| 349 | 3300025912 | Ga0207707_10055935 | Ga0207707_100559352 | 108 |
| 350 | 3300025912 | Ga0207707_10433520 | Ga0207707_104335202 | 108 |
| 351 | 3300025912 | Ga0207707_10659437 | Ga0207707_106594372 | 108 |
| 352 | 3300025913 | Ga0207695_10000834 | Ga0207695_1000083432 | 108 |
| 353 | 3300025913 | Ga0207695_10283316 | Ga0207695_102833162 | 108 |
| 354 | 3300025914 | Ga0207671_10000510 | Ga0207671_1000051030 | 108 |
| 355 | 3300025914 | Ga0207671_10006782 | Ga0207671_1000678217 | 108 |
| 356 | 3300025914 | Ga0207671_10343405 | Ga0207671_103434052 | 108 |
| 357 | 3300025915 | Ga0207693_10420783 | Ga0207693_104207832 | 108 |
| 358 | 3300025916 | Ga0207663_10548379 | Ga0207663_105483792 | 108 |
| 359 | 3300025917 | Ga0207660_10081230 | Ga0207660_100812302 | 108 |
| 360 | 3300025917 | Ga0207660_11578348 | Ga0207660_115783481 | 108 |
| 361 | 3300025918 | Ga0207662_10057285 | Ga0207662_100572853 | 108 |
| 362 | 3300025918 | Ga0207662_10080129 | Ga0207662_100801292 | 108 |
| 363 | 3300025918 | Ga0207662_10184853 | Ga0207662_101848532 | 108 |
| 364 | 3300025919 | Ga0207657_10184384 | Ga0207657_101843842 | 108 |
| 365 | 3300025919 | Ga0207657_10651981 | Ga0207657_106519812 | 108 |
| 366 | 3300025920 | Ga0207649_10617610 | Ga0207649_106176102 | 108 |
| 367 | 3300025921 | Ga0207652_10091748 | Ga0207652_100917481 | 108 |
| 368 | 3300025921 | Ga0207652_10249882 | Ga0207652_102498821 | 108 |
| 369 | 3300025921 | Ga0207652_11394684 | Ga0207652_113946842 | 108 |
| 370 | 3300025921 | Ga0207652_11482574 | Ga0207652_114825742 | 108 |
| 371 | 3300025923 | Ga0207681_10002742 | Ga0207681_1000274220 | 108 |
| 372 | 3300025924 | Ga0207694_10019794 | Ga0207694_100197949 | 108 |
| 373 | 3300025924 | Ga0207694_10334653 | Ga0207694_103346532 | 108 |
| 374 | 3300025924 | Ga0207694_10546681 | Ga0207694_105466812 | 108 |
| 375 | 3300025924 | Ga0207694_10998884 | Ga0207694_109988842 | 108 |
| 376 | 3300025925 | Ga0207650_10331885 | Ga0207650_103318852 | 108 |
| 377 | 3300025925 | Ga0207650_10412449 | Ga0207650_104124492 | 108 |
| 378 | 3300025926 | Ga0207659_10178033 | Ga0207659_101780333 | 108 |
| 379 | 3300025927 | Ga0207687_10080679 | Ga0207687_100806795 | 108 |
| 380 | 3300025927 | Ga0207687_11208432 | Ga0207687_112084322 | 108 |
| 381 | 3300025928 | Ga0207700_10241544 | Ga0207700_102415442 | 108 |
| 382 | 3300025929 | Ga0207664_10987838 | Ga0207664_109878382 | 108 |
| 383 | 3300025931 | Ga0207644_10244061 | Ga0207644_102440612 | 108 |
| 384 | 3300025931 | Ga0207644_11584875 | Ga0207644_115848752 | 108 |
| 385 | 3300025931 | Ga0207644_11717683 | Ga0207644_117176832 | 108 |
| 386 | 3300025932 | Ga0207690_10294826 | Ga0207690_102948263 | 108 |
| 387 | 3300025933 | Ga0207706_10050162 | Ga0207706_100501624 | 108 |
| 388 | 3300025933 | Ga0207706_10704768 | Ga0207706_107047682 | 108 |
| 389 | 3300025934 | Ga0207686_10564906 | Ga0207686_105649062 | 108 |
| 390 | 3300025936 | Ga0207670_10000022 | Ga0207670_10000022134 | 108 |
| 391 | 3300025936 | Ga0207670_10033174 | Ga0207670_100331742 | 108 |
| 392 | 3300025936 | Ga0207670_10038900 | Ga0207670_100389005 | 108 |
| 393 | 3300025936 | Ga0207670_10583824 | Ga0207670_105838242 | 108 |
| 394 | 3300025936 | Ga0207670_10971512 | Ga0207670_109715122 | 108 |
| 395 | 3300025936 | Ga0207670_11466375 | Ga0207670_114663751 | 108 |
| 396 | 3300025937 | Ga0207669_10032783 | Ga0207669_100327834 | 108 |
| 397 | 3300025938 | Ga0207704_10215606 | Ga0207704_102156063 | 108 |
| 398 | 3300025938 | Ga0207704_10969184 | Ga0207704_109691841 | 108 |
| 399 | 3300025938 | Ga0207704_11159472 | Ga0207704_111594722 | 108 |
| 400 | 3300025940 | Ga0207691_10111430 | Ga0207691_101114302 | 108 |
| 401 | 3300025940 | Ga0207691_10195137 | Ga0207691_101951372 | 108 |
| 402 | 3300025940 | Ga0207691_10205570 | Ga0207691_102055702 | 108 |
| 403 | 3300025942 | Ga0207689_10079744 | Ga0207689_100797444 | 108 |
| 404 | 3300025942 | Ga0207689_11475473 | Ga0207689_114754732 | 108 |
| 405 | 3300025944 | Ga0207661_10053370 | Ga0207661_100533704 | 108 |
| 406 | 3300025944 | Ga0207661_10394917 | Ga0207661_103949172 | 108 |
| 407 | 3300025944 | Ga0207661_10684704 | Ga0207661_106847042 | 108 |
| 408 | 3300025944 | Ga0207661_11074409 | Ga0207661_110744092 | 108 |
| 409 | 3300025949 | Ga0207667_10023566 | Ga0207667_1002356611 | 108 |
| 410 | 3300025949 | Ga0207667_10209758 | Ga0207667_102097584 | 108 |
| 411 | 3300025949 | Ga0207667_10299139 | Ga0207667_102991394 | 108 |
| 412 | 3300025949 | Ga0207667_10505733 | Ga0207667_105057331 | 108 |
| 413 | 3300025960 | Ga0207651_10007125 | Ga0207651_100071254 | 108 |
| 414 | 3300025960 | Ga0207651_10057682 | Ga0207651_100576824 | 108 |
| 415 | 3300025960 | Ga0207651_10149277 | Ga0207651_101492773 | 108 |
| 416 | 3300025960 | Ga0207651_10250285 | Ga0207651_102502852 | 108 |
| 417 | 3300025972 | Ga0207668_10166349 | Ga0207668_101663492 | 108 |
| 418 | 3300025972 | Ga0207668_11489344 | Ga0207668_114893441 | 108 |
| 419 | 3300025972 | Ga0207668_12056919 | Ga0207668_120569192 | 108 |
| 420 | 3300025981 | Ga0207640_10144783 | Ga0207640_101447832 | 108 |
| 421 | 3300025986 | Ga0207658_10301364 | Ga0207658_103013642 | 108 |
| 422 | 3300025986 | Ga0207658_10629819 | Ga0207658_106298191 | 108 |
| 423 | 3300025986 | Ga0207658_10685249 | Ga0207658_106852492 | 108 |
| 424 | 3300026023 | Ga0207677_10134658 | Ga0207677_101346581 | 108 |
| 425 | 3300026023 | Ga0207677_10205289 | Ga0207677_102052893 | 108 |
| 426 | 3300026023 | Ga0207677_10417879 | Ga0207677_104178792 | 108 |
| 427 | 3300026041 | Ga0207639_10005667 | Ga0207639_1000566716 | 108 |
| 428 | 3300026041 | Ga0207639_10042182 | Ga0207639_100421821 | 108 |
| 429 | 3300026075 | Ga0207708_10012451 | Ga0207708_100124514 | 108 |
| 430 | 3300026075 | Ga0207708_10801332 | Ga0207708_108013322 | 108 |
| 431 | 3300026078 | Ga0207702_10204836 | Ga0207702_102048362 | 108 |
| 432 | 3300026078 | Ga0207702_10362040 | Ga0207702_103620402 | 108 |
| 433 | 3300026078 | Ga0207702_10461801 | Ga0207702_104618012 | 108 |
| 434 | 3300026088 | Ga0207641_10549601 | Ga0207641_105496012 | 108 |
| 435 | 3300026088 | Ga0207641_12000603 | Ga0207641_120006032 | 108 |
| 436 | 3300026088 | Ga0207641_12077650 | Ga0207641_120776502 | 108 |
| 437 | 3300026089 | Ga0207648_10011154 | Ga0207648_1001115418 | 108 |
| 438 | 3300026089 | Ga0207648_11346760 | Ga0207648_113467601 | 108 |
| 439 | 3300026095 | Ga0207676_10628970 | Ga0207676_106289702 | 108 |
| 440 | 3300026095 | Ga0207676_11370606 | Ga0207676_113706062 | 108 |
| 441 | 3300026095 | Ga0207676_12115241 | Ga0207676_121152411 | 108 |
| 442 | 3300026116 | Ga0207674_10143954 | Ga0207674_101439542 | 108 |
| 443 | 3300026116 | Ga0207674_11429596 | Ga0207674_114295962 | 108 |
| 444 | 3300026118 | Ga0207675_100013850 | Ga0207675_10001385015 | 108 |
| 445 | 3300026118 | Ga0207675_100523954 | Ga0207675_1005239542 | 108 |
| 446 | 3300026121 | Ga0207683_10055874 | Ga0207683_100558745 | 108 |
| 447 | 3300026121 | Ga0207683_10406889 | Ga0207683_104068893 | 108 |
| 448 | 3300026121 | Ga0207683_11608085 | Ga0207683_116080851 | 108 |
| 449 | 3300026142 | Ga0207698_10740360 | Ga0207698_107403602 | 108 |
| 450 | 3300027717 | Ga0209998_10134052 | Ga0209998_101340521 | 108 |
| 451 | 3300027876 | Ga0209974_10047202 | Ga0209974_100472022 | 108 |
| 452 | 3300027907 | Ga0207428_10071472 | Ga0207428_100714722 | 108 |
| 453 | 3300028379 | Ga0268266_11113797 | Ga0268266_111137972 | 108 |
| 454 | 3300028380 | Ga0268265_10053988 | Ga0268265_100539885 | 108 |
| 455 | 3300028380 | Ga0268265_11176573 | Ga0268265_111765732 | 108 |
| 456 | 3300028380 | Ga0268265_12459148 | Ga0268265_124591482 | 108 |
| 457 | 3300028381 | Ga0268264_11590237 | Ga0268264_115902372 | 108 |
| 458 | 3300028381 | Ga0268264_11795831 | Ga0268264_117958312 | 108 |
| 459 | 3300028556 | Ga0265337_1016213 | Ga0265337_10162133 | 108 |
| 460 | 3300028556 | Ga0265337_1019764 | Ga0265337_10197642 | 108 |
| 461 | 3300028563 | Ga0265319_1022863 | Ga0265319_10228633 | 108 |
| 462 | 3300028563 | Ga0265319_1028578 | Ga0265319_10285785 | 108 |
| 463 | 3300028563 | Ga0265319_1066428 | Ga0265319_10664282 | 108 |
| 464 | 3300028577 | Ga0265318_10000169 | Ga0265318_100001694 | 108 |
| 465 | 3300028577 | Ga0265318_10000384 | Ga0265318_1000038412 | 108 |
| 466 | 3300028577 | Ga0265318_10033468 | Ga0265318_100334684 | 108 |
| 467 | 3300028653 | Ga0265323_10003319 | Ga0265323_100033197 | 108 |
| 468 | 3300028653 | Ga0265323_10015991 | Ga0265323_100159914 | 108 |
| 469 | 3300028653 | Ga0265323_10051237 | Ga0265323_100512373 | 108 |
| 470 | 3300028654 | Ga0265322_10007541 | Ga0265322_100075416 | 108 |
| 471 | 3300028654 | Ga0265322_10012481 | Ga0265322_100124815 | 108 |
| 472 | 3300028666 | Ga0265336_10016694 | Ga0265336_100166944 | 108 |
| 473 | 3300028666 | Ga0265336_10184290 | Ga0265336_101842902 | 108 |
| 474 | 3300028666 | Ga0265336_10201627 | Ga0265336_102016271 | 108 |
| 475 | 3300028800 | Ga0265338_10001810 | Ga0265338_1000181010 | 108 |
| 476 | 3300028800 | Ga0265338_10143543 | Ga0265338_101435432 | 108 |
| 477 | 3300028800 | Ga0265338_10161608 | Ga0265338_101616081 | 108 |
| 478 | 3300028800 | Ga0265338_10251224 | Ga0265338_102512242 | 108 |
| 479 | 3300028800 | Ga0265338_10529671 | Ga0265338_105296712 | 108 |
| 480 | 3300028800 | Ga0265338_10794916 | Ga0265338_107949162 | 108 |
| 481 | 3300029957 | Ga0265324_10005897 | Ga0265324_100058979 | 108 |
| 482 | 3300029957 | Ga0265324_10052976 | Ga0265324_100529761 | 108 |
| 483 | 3300029957 | Ga0265324_10291215 | Ga0265324_102912152 | 108 |
| 484 | 3300031235 | Ga0265330_10000068 | Ga0265330_1000006897 | 108 |
| 485 | 3300031235 | Ga0265330_10003962 | Ga0265330_100039629 | 108 |
| 486 | 3300031235 | Ga0265330_10065761 | Ga0265330_100657612 | 108 |
| 487 | 3300031235 | Ga0265330_10265117 | Ga0265330_102651172 | 108 |
| 488 | 3300031238 | Ga0265332_10001607 | Ga0265332_100016074 | 108 |
| 489 | 3300031238 | Ga0265332_10005477 | Ga0265332_100054772 | 108 |
| 490 | 3300031238 | Ga0265332_10035759 | Ga0265332_100357592 | 108 |
| 491 | 3300031238 | Ga0265332_10041106 | Ga0265332_100411062 | 108 |
| 492 | 3300031239 | Ga0265328_10000172 | Ga0265328_1000017212 | 108 |
| 493 | 3300031239 | Ga0265328_10000528 | Ga0265328_1000052825 | 108 |
| 494 | 3300031239 | Ga0265328_10004363 | Ga0265328_100043632 | 108 |
| 495 | 3300031239 | Ga0265328_10187915 | Ga0265328_101879151 | 108 |
| 496 | 3300031240 | Ga0265320_10000069 | Ga0265320_100000694 | 108 |
| 497 | 3300031240 | Ga0265320_10005252 | Ga0265320_100052524 | 108 |
| 498 | 3300031240 | Ga0265320_10017635 | Ga0265320_100176355 | 108 |
| 499 | 3300031240 | Ga0265320_10040972 | Ga0265320_100409722 | 108 |
| 500 | 3300031240 | Ga0265320_10188685 | Ga0265320_101886852 | 108 |
| 501 | 3300031240 | Ga0265320_10476221 | Ga0265320_104762212 | 108 |
| 502 | 3300031241 | Ga0265325_10089603 | Ga0265325_100896032 | 108 |
| 503 | 3300031241 | Ga0265325_10158897 | Ga0265325_101588972 | 108 |
| 504 | 3300031241 | Ga0265325_10176509 | Ga0265325_101765092 | 108 |
| 505 | 3300031241 | Ga0265325_10206962 | Ga0265325_102069622 | 108 |
| 506 | 3300031242 | Ga0265329_10000733 | Ga0265329_1000073329 | 108 |
| 507 | 3300031242 | Ga0265329_10010575 | Ga0265329_100105754 | 108 |
| 508 | 3300031242 | Ga0265329_10097232 | Ga0265329_100972322 | 108 |
| 509 | 3300031247 | Ga0265340_10007508 | Ga0265340_100075084 | 108 |
| 510 | 3300031247 | Ga0265340_10061476 | Ga0265340_100614762 | 108 |
| 511 | 3300031249 | Ga0265339_10000001 | Ga0265339_10000001270 | 108 |
| 512 | 3300031249 | Ga0265339_10006249 | Ga0265339_100062496 | 108 |
| 513 | 3300031249 | Ga0265339_10006835 | Ga0265339_1000683514 | 108 |
| 514 | 3300031249 | Ga0265339_10018501 | Ga0265339_100185014 | 108 |
| 515 | 3300031249 | Ga0265339_10022740 | Ga0265339_100227403 | 108 |
| 516 | 3300031249 | Ga0265339_10032693 | Ga0265339_100326935 | 108 |
| 517 | 3300031249 | Ga0265339_10058815 | Ga0265339_100588152 | 108 |
| 518 | 3300031249 | Ga0265339_10075283 | Ga0265339_100752832 | 108 |
| 519 | 3300031249 | Ga0265339_10147825 | Ga0265339_101478253 | 108 |
| 520 | 3300031250 | Ga0265331_10000149 | Ga0265331_1000014997 | 108 |
| 521 | 3300031250 | Ga0265331_10001210 | Ga0265331_1000121033 | 108 |
| 522 | 3300031250 | Ga0265331_10056308 | Ga0265331_100563082 | 108 |
| 523 | 3300031344 | Ga0265316_10006437 | Ga0265316_100064374 | 108 |
| 524 | 3300031344 | Ga0265316_10012440 | Ga0265316_100124408 | 108 |
| 525 | 3300031344 | Ga0265316_10015836 | Ga0265316_1001583612 | 108 |
| 526 | 3300031344 | Ga0265316_10024979 | Ga0265316_100249799 | 108 |
| 527 | 3300031344 | Ga0265316_10037888 | Ga0265316_100378884 | 108 |
| 528 | 3300031344 | Ga0265316_10076461 | Ga0265316_100764614 | 108 |
| 529 | 3300031344 | Ga0265316_10523947 | Ga0265316_105239472 | 108 |
| 530 | 3300031548 | Ga0307408_102063440 | Ga0307408_1020634402 | 108 |
| 531 | 3300031595 | Ga0265313_10003761 | Ga0265313_100037615 | 108 |
| 532 | 3300031595 | Ga0265313_10006146 | Ga0265313_100061467 | 108 |
| 533 | 3300031595 | Ga0265313_10035771 | Ga0265313_100357713 | 108 |
| 534 | 3300031595 | Ga0265313_10043972 | Ga0265313_100439722 | 108 |
| 535 | 3300031595 | Ga0265313_10064585 | Ga0265313_100645852 | 108 |
| 536 | 3300031711 | Ga0265314_10000109 | Ga0265314_100001094 | 108 |
| 537 | 3300031711 | Ga0265314_10000191 | Ga0265314_1000019198 | 108 |
| 538 | 3300031711 | Ga0265314_10001397 | Ga0265314_1000139727 | 108 |
| 539 | 3300031711 | Ga0265314_10004534 | Ga0265314_100045344 | 108 |
| 540 | 3300031711 | Ga0265314_10012182 | Ga0265314_1001218214 | 108 |
| 541 | 3300031711 | Ga0265314_10023062 | Ga0265314_100230622 | 108 |
| 542 | 3300031711 | Ga0265314_10074680 | Ga0265314_100746803 | 108 |
| 543 | 3300031711 | Ga0265314_10113712 | Ga0265314_101137122 | 108 |
| 544 | 3300031712 | Ga0265342_10000812 | Ga0265342_100008124 | 108 |
| 545 | 3300031712 | Ga0265342_10001254 | Ga0265342_100012544 | 108 |
| 546 | 3300031712 | Ga0265342_10001889 | Ga0265342_100018894 | 108 |
| 547 | 3300031712 | Ga0265342_10002136 | Ga0265342_100021364 | 108 |
| 548 | 3300031712 | Ga0265342_10004388 | Ga0265342_100043889 | 108 |
| 549 | 3300031712 | Ga0265342_10006355 | Ga0265342_100063552 | 108 |
| 550 | 3300031712 | Ga0265342_10028395 | Ga0265342_100283956 | 108 |
| 551 | 3300031712 | Ga0265342_10029446 | Ga0265342_100294467 | 108 |
| 552 | 3300031712 | Ga0265342_10046425 | Ga0265342_100464254 | 108 |
| 553 | 3300031889 | Ga0326468_10027368 | Ga0326468_100273682 | 108 |
| 554 | 3300033524 | Ga0316592_1128347 | Ga0316592_11283472 | 108 |
| 555 | 3300033528 | Ga0316588_1001749 | Ga0316588_10017494 | 108 |
| 556 | 3300033528 | Ga0316588_1050233 | Ga0316588_10502332 | 108 |
| 557 | 3300033529 | Ga0316587_1001986 | Ga0316587_10019862 | 108 |
| 558 | 3300034818 | Ga0373950_0000002 | Ga0373950_0000002_1179_1505 | 108 |
| 559 | 3300034818 | Ga0373950_0000319 | Ga0373950_0000319_4623_4952 | 108 |
| 560 | 3300035086 | Ga0373934_0015071 | Ga0373934_0015071_35_361 | 108 |
| 561 | 3300035086 | Ga0373934_0074325 | Ga0373934_0074325_659_988 | 108 |
| 562 | 3300035086 | Ga0373934_0279879 | Ga0373934_0279879_23_355 | 108 |
| 563 | 3300035088 | Ga0373940_0185842 | Ga0373940_0185842_119_448 | 108 |
| 564 | 3300035089 | Ga0373944_0309337 | Ga0373944_0309337_16_345 | 108 |
| 565 | 3300035111 | Ga0373923_0064505 | Ga0373923_0064505_242_571 | 108 |
| 566 | 3300035111 | Ga0373923_0276690 | Ga0373923_0276690_92_418 | 108 |
| 567 | 3300035113 | Ga0373936_0125773 | Ga0373936_0125773_235_564 | 108 |
| 568 | 3300035116 | Ga0373945_0196582 | Ga0373945_0196582_488_817 | 108 |
| 569 | 3300035117 | Ga0373953_0007606 | Ga0373953_0007606_3272_3601 | 108 |
| 570 | 3300035118 | Ga0373954_0013761 | Ga0373954_0013761_921_1250 | 108 |
| 571 | 3300035118 | Ga0373954_0061229 | Ga0373954_0061229_697_1029 | 108 |
| 572 | 3300035118 | Ga0373954_0067157 | Ga0373954_0067157_1325_1654 | 108 |
| 573 | 3300035118 | Ga0373954_0118115 | Ga0373954_0118115_347_676 | 108 |
| 574 | 3300035118 | Ga0373954_0290057 | Ga0373954_0290057_379_705 | 108 |
| 575 | 3300035119 | Ga0373956_0024460 | Ga0373956_0024460_152_487 | 108 |
| 576 | 3300035119 | Ga0373956_0029287 | Ga0373956_0029287_864_1193 | 108 |
| 577 | 3300035119 | Ga0373956_0181043 | Ga0373956_0181043_16_345 | 108 |
| 578 | 3300035119 | Ga0373956_0181170 | Ga0373956_0181170_264_596 | 108 |
| 579 | 3300035120 | Ga0373957_0050880 | Ga0373957_0050880_164_493 | 108 |
| 580 | 3300035170 | Ga0373943_0026949 | Ga0373943_0026949_1046_1375 | 108 |
| 581 | 3300035170 | Ga0373943_0218286 | Ga0373943_0218286_544_876 | 108 |
| 582 | 3300035171 | Ga0373946_0472468 | Ga0373946_0472468_58_387 | 108 |
| 583 | 3300035172 | Ga0373955_0050551 | Ga0373955_0050551_1201_1527 | 108 |
| 584 | 3300035172 | Ga0373955_0053472 | Ga0373955_0053472_1266_1595 | 108 |
| 585 | 3300035172 | Ga0373955_0077472 | Ga0373955_0077472_452_781 | 108 |
| 586 | 3300035172 | Ga0373955_0086843 | Ga0373955_0086843_1103_1432 | 108 |
| 587 | 3300035172 | Ga0373955_0376090 | Ga0373955_0376090_243_572 | 108 |
| 588 | 3300035241 | Ga0373961_0073517 | Ga0373961_0073517_601_930 | 108 |
| 589 | 3300035410 | Ga0373924_0146534 | Ga0373924_0146534_643_972 | 108 |
| 590 | 3300035410 | Ga0373924_0215395 | Ga0373924_0215395_50_379 | 108 |
| 591 | 3300035692 | Ga0373935_0169727 | Ga0373935_0169727_918_1247 | 108 |
| 592 | 3300035695 | Ga0373927_0054262 | Ga0373927_0054262_1974_2303 | 108 |
| 593 | 3300035695 | Ga0373927_0489562 | Ga0373927_0489562_83_415 | 108 |
| 594 | 3300035724 | Ga0373933_0001189 | Ga0373933_0001189_1219_1545 | 108 |
| 595 | 3300035724 | Ga0373933_0083785 | Ga0373933_0083785_1108_1440 | 108 |
| 596 | 3300035724 | Ga0373933_0178406 | Ga0373933_0178406_287_616 | 108 |
| 597 | 3300035724 | Ga0373933_0437766 | Ga0373933_0437766_169_498 | 108 |
| 598 | 3300035725 | Ga0373947_0055815 | Ga0373947_0055815_1068_1397 | 108 |
| 599 | 3300036401 | Ga0373937_0013762 | Ga0373937_0013762_5144_5476 | 108 |
| 600 | 3300036401 | Ga0373937_0051912 | Ga0373937_0051912_660_989 | 108 |
| 601 | 3300036401 | Ga0373937_0058959 | Ga0373937_0058959_1743_2072 | 108 |
| 602 | 3300036401 | Ga0373937_0096824 | Ga0373937_0096824_606_935 | 108 |
| 603 | 3300036401 | Ga0373937_0118014 | Ga0373937_0118014_1228_1554 | 108 |
| 604 | 3300036401 | Ga0373937_1423189 | Ga0373937_1423189_27_359 | 108 |
| 605 | 3300037068 | Ga0373925_0117963 | Ga0373925_0117963_279_608 | 108 |
| 606 | 3300037068 | Ga0373925_0900369 | Ga0373925_0900369_95_424 | 108 |
| 607 | 3300041458 | Ga0451798_0319564 | Ga0451798_0319564_194_523 | 108 |
| 608 | 3300041460 | Ga0451802_0662359 | Ga0451802_0662359_149_478 | 108 |
| 609 | 3300041486 | Ga0451807_1468954 | Ga0451807_1468954_1077_1406 | 108 |
| 610 | 3300041486 | Ga0451807_1832672 | Ga0451807_1832672_57_386 | 108 |
| 611 | 3300041491 | Ga0451833_0549793 | Ga0451833_0549793_128_457 | 108 |
| 612 | 3300044684 | Ga0466966_0600212 | Ga0466966_0600212_158_487 | 108 |
| 613 | 3300044712 | Ga0453684_0085870 | Ga0453684_0085870_2315_2647 | 108 |
| 614 | 3300044712 | Ga0453684_0789668 | Ga0453684_0789668_403_735 | 108 |
| 615 | 3300044719 | Ga0466971_0068907 | Ga0466971_0068907_669_998 | 108 |
| 616 | 3300045051 | Ga0451576_1808345 | Ga0451576_1808345_113_445 | 108 |
| 617 | 3300045976 | Ga0466967_0701760 | Ga0466967_0701760_300_629 | 108 |
| 618 | 3300046457 | Ga0495590_0292163 | Ga0495590_0292163_149_478 | 108 |
| 619 | 3300046477 | Ga0495664_0153025 | Ga0495664_0153025_1027_1356 | 108 |
| 620 | 3300046500 | Ga0495596_0361082 | Ga0495596_0361082_156_485 | 108 |
| 621 | 3300046517 | Ga0495630_0003551 | Ga0495630_0003551_5969_6298 | 108 |
| 622 | 3300046517 | Ga0495630_0140876 | Ga0495630_0140876_1125_1457 | 108 |
| 623 | 3300046517 | Ga0495630_0514425 | Ga0495630_0514425_384_713 | 108 |
| 624 | 3300046529 | Ga0495652_0258563 | Ga0495652_0258563_591_920 | 108 |
| 625 | 3300046535 | Ga0495586_0057737 | Ga0495586_0057737_1518_1847 | 108 |
| 626 | 3300046536 | Ga0495587_0096111 | Ga0495587_0096111_1247_1576 | 108 |
| 627 | 3300046536 | Ga0495587_0511027 | Ga0495587_0511027_48_380 | 108 |
| 628 | 3300046543 | Ga0495645_0229080 | Ga0495645_0229080_853_1182 | 108 |
| 629 | 3300046642 | Ga0495634_0000649 | Ga0495634_0000649_1137_1466 | 108 |
| 630 | 3300046663 | Ga0495635_0305100 | Ga0495635_0305100_83_412 | 108 |
| 631 | 3300046689 | Ga0495613_0308712 | Ga0495613_0308712_393_722 | 108 |
| 632 | 3300046690 | Ga0495624_0493552 | Ga0495624_0493552_341_673 | 108 |
| 633 | 3300047319 | Ga0495674_0001336 | Ga0495674_0001336_22605_22934 | 108 |
| 634 | 3300047322 | Ga0495680_0057650 | Ga0495680_0057650_943_1272 | 108 |
| 635 | 3300047322 | Ga0495680_0751946 | Ga0495680_0751946_70_402 | 108 |
| 636 | 3300047471 | Ga0495684_0093485 | Ga0495684_0093485_799_1128 | 108 |
| 637 | 3300048903 | Ga0496100_0003660 | Ga0496100_0003660_7643_7972 | 108 |
| 638 | 3300048903 | Ga0496100_0594571 | Ga0496100_0594571_215_544 | 108 |
| 639 | 3300048904 | Ga0496101_1284082 | Ga0496101_1284082_175_504 | 108 |
| 640 | 3300048905 | Ga0496102_0937571 | Ga0496102_0937571_220_549 | 108 |
| 641 | 3300048907 | Ga0496104_0041250 | Ga0496104_0041250_3207_3542 | 108 |
| 642 | 3300048907 | Ga0496104_0169572 | Ga0496104_0169572_860_1189 | 108 |
| 643 | 3300048907 | Ga0496104_1482344 | Ga0496104_1482344_89_418 | 108 |
| 644 | 3300048908 | Ga0496105_0164714 | Ga0496105_0164714_863_1198 | 108 |
| 645 | 3300048908 | Ga0496105_0374951 | Ga0496105_0374951_590_919 | 108 |
| 646 | 3300048908 | Ga0496105_0595025 | Ga0496105_0595025_109_438 | 108 |
| 647 | 3300048908 | Ga0496105_1094817 | Ga0496105_1094817_130_459 | 108 |
| 648 | 3300048909 | Ga0496106_1101387 | Ga0496106_1101387_52_381 | 108 |
| 649 | 3300048910 | Ga0496107_0035117 | Ga0496107_0035117_1580_1909 | 108 |
| 650 | 3300048910 | Ga0496107_0966826 | Ga0496107_0966826_212_541 | 108 |
| 651 | 3300048910 | Ga0496107_1016478 | Ga0496107_1016478_220_549 | 108 |
| 652 | 3300048910 | Ga0496107_1357534 | Ga0496107_1357534_131_460 | 108 |
| 653 | 3300048911 | Ga0496108_0085584 | Ga0496108_0085584_736_1065 | 108 |
| 654 | 3300048911 | Ga0496108_0473517 | Ga0496108_0473517_169_498 | 108 |
| 655 | 3300048911 | Ga0496108_0520224 | Ga0496108_0520224_414_743 | 108 |
| 656 | 3300048913 | Ga0496110_1491358 | Ga0496110_1491358_17_346 | 108 |
| 657 | 3300048915 | Ga0496112_0318677 | Ga0496112_0318677_530_862 | 108 |
| 658 | 3300048915 | Ga0496112_0322525 | Ga0496112_0322525_409_738 | 108 |
| 659 | 3300048917 | Ga0496114_0000386 | Ga0496114_0000386_18327_18656 | 108 |
| 660 | 3300048917 | Ga0496114_0006073 | Ga0496114_0006073_1165_1494 | 108 |
| 661 | 3300048917 | Ga0496114_0040273 | Ga0496114_0040273_2148_2477 | 108 |
| 662 | 3300048917 | Ga0496114_0258990 | Ga0496114_0258990_620_949 | 108 |
| 663 | 3300048918 | Ga0496115_0056627 | Ga0496115_0056627_56_385 | 108 |
| 664 | 3300048918 | Ga0496115_0174462 | Ga0496115_0174462_763_1092 | 108 |
| 665 | 3300048918 | Ga0496115_0270114 | Ga0496115_0270114_46_375 | 108 |
| 666 | 3300048918 | Ga0496115_0293289 | Ga0496115_0293289_523_852 | 108 |
| 667 | 3300049130 | Ga0501310_014424 | Ga0501310_014424_292_621 | 108 |
| 668 | 3300049522 | Ga0501299_068579 | Ga0501299_068579_49_378 | 108 |
| 669 | 3300049571 | Ga0501034_0000037 | Ga0501034_0000037_159181_159510 | 108 |
| 670 | 3300049572 | Ga0501036_0038638 | Ga0501036_0038638_2559_2888 | 108 |
| 671 | 3300049572 | Ga0501036_0206025 | Ga0501036_0206025_653_982 | 108 |
| 672 | 3300049574 | Ga0501038_0656571 | Ga0501038_0656571_166_495 | 108 |
| 673 | 3300049578 | Ga0501042_0633636 | Ga0501042_0633636_224_553 | 108 |
| 674 | 3300049579 | Ga0501043_0002483 | Ga0501043_0002483_1182_1511 | 108 |
| 675 | 3300049580 | Ga0501046_0000751 | Ga0501046_0000751_22491_22820 | 108 |
| 676 | 3300049581 | Ga0501047_0000053 | Ga0501047_0000053_51253_51582 | 108 |
| 677 | 3300049582 | Ga0501048_0001235 | Ga0501048_0001235_667_996 | 108 |
| 678 | 3300049583 | Ga0501067_0003773 | Ga0501067_0003773_1805_2134 | 108 |
| 679 | 3300049583 | Ga0501067_0003984 | Ga0501067_0003984_2837_3163 | 108 |
| 680 | 3300049583 | Ga0501067_0040666 | Ga0501067_0040666_735_1061 | 108 |
| 681 | 3300049584 | Ga0501068_0001718 | Ga0501068_0001718_4672_5001 | 108 |
| 682 | 3300049585 | Ga0501069_0075490 | Ga0501069_0075490_777_1106 | 108 |
| 683 | 3300049586 | Ga0501070_0005205 | Ga0501070_0005205_40_369 | 108 |
| 684 | 3300049586 | Ga0501070_0007053 | Ga0501070_0007053_8049_8378 | 108 |
| 685 | 3300049586 | Ga0501070_0777221 | Ga0501070_0777221_274_603 | 108 |
| 686 | 3300049588 | Ga0501072_0002806 | Ga0501072_0002806_11564_11893 | 108 |
| 687 | 3300049589 | Ga0501073_0003382 | Ga0501073_0003382_592_921 | 108 |
| 688 | 3300049589 | Ga0501073_0005323 | Ga0501073_0005323_1125_1451 | 108 |
| 689 | 3300049589 | Ga0501073_0090487 | Ga0501073_0090487_1139_1468 | 108 |
| 690 | 3300049589 | Ga0501073_0215234 | Ga0501073_0215234_411_740 | 108 |
| 691 | 3300049589 | Ga0501073_0294618 | Ga0501073_0294618_777_1106 | 108 |
| 692 | 3300049590 | Ga0501074_0022615 | Ga0501074_0022615_2289_2618 | 108 |
| 693 | 3300049590 | Ga0501074_0041398 | Ga0501074_0041398_2304_2633 | 108 |
| 694 | 3300049667 | Ga0501230_166809 | Ga0501230_166809_73_402 | 108 |
| 695 | 3300049705 | Ga0501225_0266137 | Ga0501225_0266137_159_488 | 108 |
| 696 | 3300049741 | Ga0501079_0000174 | Ga0501079_0000174_15857_16186 | 108 |
| 697 | 3300049741 | Ga0501079_0314223 | Ga0501079_0314223_859_1188 | 108 |
| 698 | 3300049742 | Ga0501080_0007066 | Ga0501080_0007066_8628_8957 | 108 |
| 699 | 3300049742 | Ga0501080_1777444 | Ga0501080_1777444_22_348 | 108 |
| 700 | 3300049744 | Ga0501083_0092319 | Ga0501083_0092319_1139_1468 | 108 |
| 701 | 3300049744 | Ga0501083_0463700 | Ga0501083_0463700_398_727 | 108 |
| 702 | 3300050507 | nmdc:mga05p37_662727_c1 | nmdc:mga05p37_662727_c1_355_684 | 108 |
| 703 | 3300050511 | nmdc:mga08y16_92382_c1 | nmdc:mga08y16_92382_c1_1051_1380 | 108 |
| 704 | 3300050512 | nmdc:mga0n895_1036394_c1 | nmdc:mga0n895_1036394_c1_371_700 | 108 |
| 705 | 3300053077 | Ga0495601_0034268 | Ga0495601_0034268_186_515 | 108 |
| 706 | 3300053077 | Ga0495601_0188118 | Ga0495601_0188118_960_1292 | 108 |
| 707 | 3300053077 | Ga0495601_0380331 | Ga0495601_0380331_415_744 | 108 |
| 708 | 3300053084 | Ga0495595_0135146 | Ga0495595_0135146_798_1127 | 108 |
| 709 | 3300053085 | Ga0495619_0028862 | Ga0495619_0028862_1454_1783 | 108 |
| 710 | 3300053085 | Ga0495619_0589775 | Ga0495619_0589775_338_670 | 108 |
| 711 | 3300054114 | Ga0501084_0000022 | Ga0501084_0000022_98831_99160 | 108 |
| 712 | 3300054114 | Ga0501084_0531397 | Ga0501084_0531397_242_577 | 108 |
| 713 | 3300059477 | Ga0587084_144566 | Ga0587084_144566_112_441 | 108 |
| 714 | 3300060346 | Ga0587111_0096616 | Ga0587111_0096616_78_407 | 108 |
| 715 | 3300060353 | Ga0501082_0006072 | Ga0501082_0006072_9020_9349 | 108 |
| 716 | 3300060353 | Ga0501082_0117541 | Ga0501082_0117541_1134_1463 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9415 | 4 | 94 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9094 | 1 | 103 |
| 7ohv-assembly1.cif.gz_X | nog1-tap associated immature ribosomal particles from s. cerevisiae after rpl2 expression shut down, population c | 0.9061 | 3 | 98 |
| 7ohr-assembly1.cif.gz_X | nog1-tap associated immature ribosomal particle population e from s. cerevisiae | 0.9058 | 3 | 98 |
| 7r72-assembly1.cif.gz_X | state e1 nucleolar 60s ribosome biogenesis intermediate - spb4 local model | 0.9043 | 3 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ukhK00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8974 | 3 | 98 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8958 | 3 | 102 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8864 | 3 | 102 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.878 | 8 | 101 | 3.30.70.330 |
| af_P54016_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8751 | 2 | 99 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1J4VCT9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9611 | 38 | 105 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A3L7QRB5-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9585 | 1 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G1JMB6-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9578 | 4 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7D5V9Z2-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9561 | 4 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E1VV25-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9552 | 1 | 103 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar