F477003

General Info

Members Datasets Scaffolds Average Seq Length
715 304 1430 108

Family's Representative Sequence

Representative Sequence 3300041408|Ga0439453_0036289|Ga0439453_0036289_35_436
Length 133
Sequence MIDNCTLRFRMPGSNCQLSIINEVVMLVITTNTAEGHHISKYMGVVSGEAILGANIFKDLFAGIRDIVGGRSAAYERELRSARDIAISEMCEEASAMGANAVIGVDLDYENISVGRGGGMLMVSASGTAVVID

Samples

Sample ID Description Type Environment
1 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
164 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
191 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
192 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
199 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
270 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
271 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
276 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
297 2508501050 Microvirga lupini Lut6 Isolate Nodule
298 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
299 2773857925 Microvirga vignae BR3299 Isolate Unclassified
300 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
301 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
302 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
303 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
304 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0.42
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0.56
Rhizoplane 2.38
Rhizosphere 92.87
Stem 0
Stem Tuber 0
Unclassified 3.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439453_0036289 3300041408 Bacteria 952
2 SwRhRL2b_contig_1421729 2162886007 Bacteria 883
3 SwRhRL2b_contig_684236 2162886007 Bacteria 884
4 SwRhRL2b_contig_999301 2162886007 Bacteria 1550
5 Ga0058692_1006280 3300003856 Bacteria 3282
6 Ga0065712_10004986 3300005290 Bacteria 8332
7 Ga0065712_10070735 3300005290 Bacteria 5754
8 Ga0065712_10094626 3300005290 Bacteria 2248
9 Ga0065715_10016199 3300005293 Bacteria 2825
10 Ga0065715_10097490 3300005293 Bacteria 3697
11 Ga0065715_10226456 3300005293 Bacteria 1251
12 Ga0065707_10019392 3300005295 Bacteria 1566
13 Ga0065707_10981736 3300005295 Bacteria 544
14 Ga0070676_10077795 3300005328 Bacteria 2006
15 Ga0070676_10311955 3300005328 Bacteria 1070
16 Ga0070676_11609782 3300005328 Bacteria 502
17 Ga0070690_100075912 3300005330 Bacteria 2191
18 Ga0070690_100132875 3300005330 Bacteria 1682
19 Ga0070670_100016217 3300005331 Bacteria 6397
20 Ga0070670_100717641 3300005331 Bacteria 900
21 Ga0070677_10018279 3300005333 Bacteria 2523
22 Ga0070677_10143795 3300005333 Bacteria 1103
23 Ga0070677_10730705 3300005333 Bacteria 560
24 Ga0068869_100057487 3300005334 Bacteria 2840
25 Ga0068869_100919983 3300005334 Bacteria 758
26 Ga0070666_10134345 3300005335 Bacteria 1720
27 Ga0070680_100114472 3300005336 Bacteria 2247
28 Ga0070680_101737751 3300005336 Bacteria 541
29 Ga0070682_100669118 3300005337 Bacteria 829
30 Ga0068868_100250367 3300005338 Bacteria 1491
31 Ga0068868_100386535 3300005338 Bacteria 1205
32 Ga0068868_101374583 3300005338 Bacteria 658
33 Ga0070660_101702711 3300005339 Bacteria 537
34 Ga0070689_100041640 3300005340 Bacteria 3526
35 Ga0070689_100268250 3300005340 Bacteria 1412
36 Ga0070689_100407526 3300005340 Bacteria 1150
37 Ga0070689_100677543 3300005340 Bacteria 899
38 Ga0070689_101157797 3300005340 Bacteria 693
39 Ga0070687_100046433 3300005343 Bacteria 2223
40 Ga0070687_100514464 3300005343 Bacteria 808
41 Ga0070661_101375003 3300005344 Bacteria 593
42 Ga0070661_101720767 3300005344 Bacteria 531
43 Ga0070692_10039949 3300005345 Bacteria 2397
44 Ga0070692_10699469 3300005345 Bacteria 682
45 Ga0070692_11296283 3300005345 Bacteria 522
46 Ga0070668_100024254 3300005347 Bacteria 4594
47 Ga0070668_100048320 3300005347 Bacteria 3272
48 Ga0070668_100234458 3300005347 Bacteria 1518
49 Ga0070668_100661563 3300005347 Bacteria 918
50 Ga0070668_101134309 3300005347 Bacteria 707
51 Ga0070668_101812666 3300005347 Bacteria 561
52 Ga0070669_100015947 3300005353 Bacteria 5359
53 Ga0070669_100082473 3300005353 Bacteria 2397
54 Ga0070669_100154670 3300005353 Bacteria 1777
55 Ga0070669_100154684 3300005353 Bacteria 1777
56 Ga0070669_100212601 3300005353 Bacteria 1526
57 Ga0070669_100517975 3300005353 Bacteria 991
58 Ga0070669_101236617 3300005353 Bacteria 646
59 Ga0070675_100026213 3300005354 Bacteria 4676
60 Ga0070675_100087201 3300005354 Bacteria 2610
61 Ga0070675_100104196 3300005354 Bacteria 2393
62 Ga0070675_100156086 3300005354 Bacteria 1959
63 Ga0070675_100549821 3300005354 Bacteria 1044
64 Ga0070675_100788903 3300005354 Bacteria 868
65 Ga0070675_101522241 3300005354 Unclassified 617
66 Ga0070671_100567218 3300005355 Bacteria 979
67 Ga0070674_100046191 3300005356 Bacteria 2978
68 Ga0070674_100131736 3300005356 Bacteria 1865
69 Ga0070674_100343290 3300005356 Bacteria 1204
70 Ga0070674_100364925 3300005356 Bacteria 1170
71 Ga0070674_100843385 3300005356 Bacteria 794
72 Ga0070673_100007649 3300005364 Bacteria 7146
73 Ga0070673_100023727 3300005364 Bacteria 4486
74 Ga0070673_100521096 3300005364 Bacteria 1077
75 Ga0070688_100015907 3300005365 Bacteria 4290
76 Ga0070688_100315607 3300005365 Bacteria 1134
77 Ga0070688_101175179 3300005365 Bacteria 616
78 Ga0070659_100075646 3300005366 Bacteria 2684
79 Ga0070667_100348196 3300005367 Bacteria 1341
80 Ga0070667_100805954 3300005367 Bacteria 872
81 Ga0070667_101315672 3300005367 Bacteria 677
82 Ga0070701_10011897 3300005438 Bacteria 3907
83 Ga0070701_10150492 3300005438 Bacteria 1339
84 Ga0070705_101084060 3300005440 Bacteria 654
85 Ga0070700_100041287 3300005441 Bacteria 2827
86 Ga0070700_100050059 3300005441 Bacteria 2596
87 Ga0070700_100174043 3300005441 Bacteria 1493
88 Ga0070694_100019585 3300005444 Bacteria 4306
89 Ga0070694_100947295 3300005444 Bacteria 713
90 Ga0070694_101441491 3300005444 Bacteria 582
91 Ga0070694_101501788 3300005444 Bacteria 570
92 Ga0070708_100455564 3300005445 Bacteria 1207
93 Ga0070663_100281306 3300005455 Bacteria 1326
94 Ga0070663_100825620 3300005455 Bacteria 796
95 Ga0070678_100768727 3300005456 Bacteria 872
96 Ga0070678_101141752 3300005456 Bacteria 721
97 Ga0070681_10051297 3300005458 Bacteria 4114
98 Ga0070681_10736649 3300005458 Bacteria 902
99 Ga0070685_10335584 3300005466 Bacteria 1029
100 Ga0070685_10345652 3300005466 Bacteria 1015
101 Ga0070706_100073067 3300005467 Bacteria 3173
102 Ga0070707_100061426 3300005468 Bacteria 3603
103 Ga0070698_100034190 3300005471 Bacteria 5265
104 Ga0070698_101271358 3300005471 Bacteria 686
105 Ga0070699_100130705 3300005518 Bacteria 2213
106 Ga0070679_100081088 3300005530 Bacteria 3234
107 Ga0070679_100271813 3300005530 Bacteria 1649
108 Ga0070684_101048333 3300005535 Bacteria 766
109 Ga0070697_100088783 3300005536 Bacteria 2553
110 Ga0068853_101250533 3300005539 Bacteria 717
111 Ga0070672_100032938 3300005543 Bacteria 3918
112 Ga0070672_100239226 3300005543 Bacteria 1527
113 Ga0070672_101452270 3300005543 Bacteria 614
114 Ga0070695_100016647 3300005545 Bacteria 4453
115 Ga0070695_101421771 3300005545 Bacteria 576
116 Ga0070696_100044169 3300005546 Bacteria 3085
117 Ga0070696_100377855 3300005546 Bacteria 1103
118 Ga0070693_100072559 3300005547 Bacteria 2031
119 Ga0070665_100159353 3300005548 Bacteria 2258
120 Ga0070665_101070807 3300005548 Bacteria 818
121 Ga0070704_100096482 3300005549 Bacteria 2217
122 Ga0070704_100311371 3300005549 Bacteria 1316
123 Ga0070704_100585604 3300005549 Bacteria 979
124 Ga0070704_102249463 3300005549 Bacteria 507
125 Ga0070664_100199808 3300005564 Bacteria 1784
126 Ga0070664_100689479 3300005564 Bacteria 951
127 Ga0070664_100952287 3300005564 Bacteria 806
128 Ga0068857_100043638 3300005577 Bacteria 3977
129 Ga0068857_100108607 3300005577 Bacteria 2493
130 Ga0068857_101316457 3300005577 Bacteria 701
131 Ga0068854_100184485 3300005578 Bacteria 1631
132 Ga0068854_101260574 3300005578 Bacteria 664
133 Ga0070702_100610670 3300005615 Bacteria 819
134 Ga0068852_100780095 3300005616 Bacteria 969
135 Ga0068859_100108429 3300005617 Bacteria 2838
136 Ga0068859_100146839 3300005617 Bacteria 2433
137 Ga0068859_100795036 3300005617 Bacteria 1034
138 Ga0068859_102192058 3300005617 Bacteria 610
139 Ga0068864_100738560 3300005618 Bacteria 964
140 Ga0068866_10513656 3300005718 Bacteria 795
141 Ga0068861_100023548 3300005719 Unclassified 4442
142 Ga0068861_100136222 3300005719 Bacteria 1998
143 Ga0068870_10613058 3300005840 Bacteria 741
144 Ga0068870_11049006 3300005840 Bacteria 584
145 Ga0068870_11253772 3300005840 Bacteria 539
146 Ga0068870_11293005 3300005840 Bacteria 531
147 Ga0068863_100306848 3300005841 Bacteria 1540
148 Ga0068863_101511139 3300005841 Bacteria 680
149 Ga0068858_100030292 3300005842 Bacteria 5024
150 Ga0068858_100740087 3300005842 Bacteria 958
151 Ga0068858_102464150 3300005842 Unclassified 514
152 Ga0068860_100278008 3300005843 Bacteria 1635
153 Ga0068862_100009135 3300005844 Bacteria 8205
154 Ga0068862_100085919 3300005844 Bacteria 2734
155 Ga0068862_100244014 3300005844 Bacteria 1634
156 Ga0068862_100810185 3300005844 Bacteria 915
157 Ga0068862_101399693 3300005844 Bacteria 703
158 Ga0068862_101825409 3300005844 Unclassified 617
159 Ga0081538_10166491 3300005981 Bacteria 969
160 Ga0075365_10569516 3300006038 Bacteria 801
161 Ga0075364_10604826 3300006051 Bacteria 749
162 Ga0075362_10078159 3300006177 Bacteria 1521
163 Ga0075362_10200876 3300006177 Bacteria 970
164 Ga0075362_10392763 3300006177 Bacteria 699
165 Ga0075366_10253917 3300006195 Bacteria 1073
166 Ga0068871_100455858 3300006358 Bacteria 1147
167 Ga0075428_100036605 3300006844 Bacteria 5404
168 Ga0075428_100792063 3300006844 Bacteria 1008
169 Ga0075428_101045345 3300006844 Bacteria 864
170 Ga0075430_100448148 3300006846 Unclassified 1065
171 Ga0075431_100024308 3300006847 Bacteria 6207
172 Ga0075431_100116718 3300006847 Bacteria 2754
173 Ga0075431_100715046 3300006847 Bacteria 979
174 Ga0075434_100160757 3300006871 Bacteria 2266
175 Ga0075434_101993455 3300006871 Bacteria 586
176 Ga0075429_100246513 3300006880 Bacteria 1564
177 Ga0068865_100163091 3300006881 Bacteria 1702
178 Ga0068865_100552965 3300006881 Bacteria 967
179 Ga0097620_100108428 3300006931 Bacteria 2838
180 Ga0097620_100146842 3300006931 Bacteria 2433
181 Ga0097620_100795061 3300006931 Bacteria 1034
182 Ga0097620_102191623 3300006931 Bacteria 610
183 Ga0075435_100000792 3300007076 Bacteria 19649
184 Ga0075435_100092692 3300007076 Bacteria 2495
185 Ga0111539_10012573 3300009094 Bacteria 10607
186 Ga0111539_10014583 3300009094 Bacteria 9810
187 Ga0111539_10017954 3300009094 Bacteria 8763
188 Ga0111539_10038079 3300009094 Bacteria 5802
189 Ga0111539_11203410 3300009094 Bacteria 880
190 Ga0111539_11279579 3300009094 Bacteria 851
191 Ga0105245_10048297 3300009098 Bacteria 3807
192 Ga0105245_10767714 3300009098 Bacteria 1001
193 Ga0105245_11000140 3300009098 Bacteria 880
194 Ga0105247_10304320 3300009101 Bacteria 1107
195 Ga0114129_10005325 3300009147 Bacteria 18160
196 Ga0114129_10070627 3300009147 Bacteria 4869
197 Ga0114129_10222467 3300009147 Bacteria 2546
198 Ga0114129_10763939 3300009147 Bacteria 1236
199 Ga0114129_11252754 3300009147 Bacteria 921
200 Ga0114129_11287240 3300009147 Bacteria 907
201 Ga0114129_11921062 3300009147 Unclassified 717
202 Ga0114129_12261743 3300009147 Bacteria 653
203 Ga0105243_10089108 3300009148 Bacteria 2536
204 Ga0105243_10207013 3300009148 Bacteria 1724
205 Ga0105241_10019274 3300009174 Bacteria 5031
206 Ga0105241_10117042 3300009174 Bacteria 2141
207 Ga0105242_10724120 3300009176 Bacteria 976
208 Ga0105242_10938218 3300009176 Bacteria 868
209 Ga0105242_12141170 3300009176 Bacteria 604
210 Ga0105242_13270924 3300009176 Bacteria 503
211 Ga0105248_10037776 3300009177 Bacteria 5404
212 Ga0105248_10113685 3300009177 Bacteria 3053
213 Ga0105238_12579397 3300009551 Bacteria 544
214 Ga0105238_13006115 3300009551 Bacteria 506
215 Ga0105249_10080976 3300009553 Bacteria 3017
216 Ga0105249_10162566 3300009553 Bacteria 2159
217 Ga0105249_11098823 3300009553 Bacteria 865
218 Ga0105249_12246117 3300009553 Bacteria 618
219 Ga0105249_13117168 3300009553 Bacteria 533
220 Ga0105239_11029391 3300010375 Bacteria 947
221 Ga0105239_11881227 3300010375 Bacteria 694
222 Ga0157338_1024724 3300012515 Bacteria 726
223 Ga0157370_10168872 3300013104 Bacteria 2034
224 Ga0157370_12019517 3300013104 Bacteria 517
225 Ga0157374_10259808 3300013296 Bacteria 1710
226 Ga0157374_11475403 3300013296 Bacteria 703
227 Ga0157378_10561561 3300013297 Bacteria 1148
228 Ga0163162_10248242 3300013306 Bacteria 1912
229 Ga0163162_11063834 3300013306 Bacteria 916
230 Ga0163162_11889583 3300013306 Bacteria 683
231 Ga0157372_12145996 3300013307 Unclassified 642
232 Ga0157375_10030134 3300013308 Bacteria 5112
233 Ga0157375_10728931 3300013308 Bacteria 1144
234 Ga0157375_10787327 3300013308 Bacteria 1100
235 Ga0157375_13135540 3300013308 Bacteria 551
236 Ga0163163_11176328 3300014325 Bacteria 829
237 Ga0157380_10006843 3300014326 Bacteria 8059
238 Ga0157380_10011149 3300014326 Bacteria 6486
239 Ga0157380_10094526 3300014326 Bacteria 2474
240 Ga0157380_10112712 3300014326 Bacteria 2289
241 Ga0157380_10307428 3300014326 Bacteria 1463
242 Ga0157380_10474753 3300014326 Bacteria 1208
243 Ga0157380_10918668 3300014326 Bacteria 903
244 Ga0157380_10937735 3300014326 Bacteria 895
245 Ga0157380_11120257 3300014326 Bacteria 827
246 Ga0157377_10002502 3300014745 Bacteria 8138
247 Ga0157377_10344695 3300014745 Bacteria 997
248 Ga0163161_10638153 3300017792 Bacteria 881
249 Ga0209675_1018436 3300025291 Bacteria 1954
250 Ga0209676_1028411 3300025292 Bacteria 1742
251 Ga0209050_1057054 3300025298 Bacteria 947
252 Ga0207697_10061699 3300025315 Bacteria 1560
253 Ga0207653_10014319 3300025885 Bacteria 2489
254 Ga0207682_10349716 3300025893 Bacteria 696
255 Ga0207688_10103279 3300025901 Bacteria 1648
256 Ga0207688_10492385 3300025901 Bacteria 767
257 Ga0207680_10170863 3300025903 Bacteria 1464
258 Ga0207647_10495665 3300025904 Bacteria 681
259 Ga0207645_10014205 3300025907 Bacteria 5333
260 Ga0207645_10026501 3300025907 Bacteria 3745
261 Ga0207645_10095154 3300025907 Bacteria 1918
262 Ga0207645_10460760 3300025907 Bacteria 859
263 Ga0207643_10001861 3300025908 Bacteria 11668
264 Ga0207643_10634200 3300025908 Bacteria 689
265 Ga0207654_10677468 3300025911 Bacteria 740
266 Ga0207707_10531941 3300025912 Bacteria 1000
267 Ga0207660_10324243 3300025917 Bacteria 1231
268 Ga0207660_10715158 3300025917 Bacteria 817
269 Ga0207662_10029612 3300025918 Bacteria 3173
270 Ga0207662_10281207 3300025918 Bacteria 1101
271 Ga0207657_11047182 3300025919 Bacteria 625
272 Ga0207649_10914339 3300025920 Bacteria 688
273 Ga0207652_10199925 3300025921 Bacteria 1799
274 Ga0207652_10858850 3300025921 Bacteria 803
275 Ga0207646_10184701 3300025922 Bacteria 1883
276 Ga0207681_10038225 3300025923 Bacteria 3178
277 Ga0207681_10136308 3300025923 Bacteria 1822
278 Ga0207681_10240304 3300025923 Bacteria 1409
279 Ga0207681_10270202 3300025923 Bacteria 1334
280 Ga0207681_10896890 3300025923 Bacteria 742
281 Ga0207650_10094140 3300025925 Bacteria 2294
282 Ga0207650_10139963 3300025925 Bacteria 1901
283 Ga0207650_10146784 3300025925 Bacteria 1858
284 Ga0207659_10051570 3300025926 Bacteria 2927
285 Ga0207659_10150242 3300025926 Bacteria 1818
286 Ga0207659_10277172 3300025926 Bacteria 1370
287 Ga0207659_10464678 3300025926 Bacteria 1067
288 Ga0207644_10694168 3300025931 Bacteria 848
289 Ga0207690_10228229 3300025932 Bacteria 1428
290 Ga0207706_10051547 3300025933 Bacteria 3634
291 Ga0207706_10145169 3300025933 Bacteria 2087
292 Ga0207706_11268378 3300025933 Bacteria 610
293 Ga0207686_11392734 3300025934 Bacteria 577
294 Ga0207709_10156774 3300025935 Bacteria 1583
295 Ga0207709_11648701 3300025935 Bacteria 533
296 Ga0207670_10154120 3300025936 Bacteria 1708
297 Ga0207669_10308550 3300025937 Bacteria 1206
298 Ga0207669_10650665 3300025937 Bacteria 862
299 Ga0207669_10752029 3300025937 Unclassified 805
300 Ga0207669_10825341 3300025937 Bacteria 770
301 Ga0207704_10429634 3300025938 Bacteria 1049
302 Ga0207691_10047709 3300025940 Bacteria 3929
303 Ga0207691_10048247 3300025940 Bacteria 3905
304 Ga0207689_10029911 3300025942 Bacteria 4542
305 Ga0207689_10037828 3300025942 Bacteria 3999
306 Ga0207679_10946075 3300025945 Unclassified 789
307 Ga0207679_10948555 3300025945 Bacteria 788
308 Ga0207651_10215254 3300025960 Bacteria 1549
309 Ga0207651_10382510 3300025960 Bacteria 1193
310 Ga0207651_10817640 3300025960 Bacteria 827
311 Ga0207651_11058045 3300025960 Bacteria 726
312 Ga0207712_10134538 3300025961 Bacteria 1889
313 Ga0207712_10758262 3300025961 Bacteria 851
314 Ga0207668_10056441 3300025972 Bacteria 2735
315 Ga0207668_10111298 3300025972 Bacteria 2055
316 Ga0207668_10212019 3300025972 Bacteria 1550
317 Ga0207668_10527833 3300025972 Bacteria 1019
318 Ga0207668_11172008 3300025972 Bacteria 690
319 Ga0207668_11355995 3300025972 Bacteria 641
320 Ga0207640_12160373 3300025981 Bacteria 505
321 Ga0207658_10323811 3300025986 Bacteria 1335
322 Ga0207658_10392160 3300025986 Bacteria 1218
323 Ga0207677_10109295 3300026023 Bacteria 2055
324 Ga0207677_10144804 3300026023 Bacteria 1825
325 Ga0207703_10067144 3300026035 Bacteria 2951
326 Ga0207639_11567305 3300026041 Bacteria 618
327 Ga0207678_10507476 3300026067 Bacteria 1052
328 Ga0207708_10014564 3300026075 Bacteria 5884
329 Ga0207708_10079337 3300026075 Bacteria 2522
330 Ga0207708_10176591 3300026075 Bacteria 1694
331 Ga0207641_10045325 3300026088 Bacteria 3703
332 Ga0207648_10011235 3300026089 Bacteria 8442
333 Ga0207648_10136627 3300026089 Bacteria 2159
334 Ga0207648_10707051 3300026089 Bacteria 934
335 Ga0207676_12251048 3300026095 Bacteria 543
336 Ga0207674_10012217 3300026116 Bacteria 9605
337 Ga0207674_10102973 3300026116 Bacteria 2834
338 Ga0207674_10964471 3300026116 Bacteria 821
339 Ga0207675_100000124 3300026118 Bacteria 63805
340 Ga0207675_100035215 3300026118 Bacteria 4670
341 Ga0207675_101173777 3300026118 Bacteria 788
342 Ga0207675_101543168 3300026118 Bacteria 685
343 Ga0207675_101557716 3300026118 Bacteria 681
344 Ga0207675_101936163 3300026118 Bacteria 608
345 Ga0207683_10469730 3300026121 Bacteria 1160
346 Ga0207698_10881460 3300026142 Bacteria 901
347 Ga0209999_1108304 3300027543 Bacteria 543
348 Ga0209970_1016880 3300027614 Bacteria 1220
349 Ga0209971_1088365 3300027682 Bacteria 756
350 Ga0209998_10026940 3300027717 Bacteria 1257
351 Ga0209974_10121126 3300027876 Bacteria 927
352 Ga0207428_10002981 3300027907 Bacteria 16729
353 Ga0207428_10045477 3300027907 Bacteria 3535
354 Ga0207428_10053575 3300027907 Bacteria 3216
355 Ga0207428_10208007 3300027907 Bacteria 1471
356 Ga0268266_10071749 3300028379 Bacteria 3002
357 Ga0268266_10319088 3300028379 Bacteria 1454
358 Ga0268265_10094194 3300028380 Bacteria 2401
359 Ga0268265_10245097 3300028380 Bacteria 1584
360 Ga0268265_10266709 3300028380 Bacteria 1525
361 Ga0268265_10416703 3300028380 Bacteria 1246
362 Ga0268265_11088622 3300028380 Bacteria 793
363 Ga0268264_10973594 3300028381 Bacteria 854
364 Ga0307408_100044927 3300031548 Bacteria 3152
365 Ga0307408_100363887 3300031548 Bacteria 1231
366 Ga0307408_100486806 3300031548 Bacteria 1077
367 Ga0316575_10223255 3300031665 Bacteria 787
368 Ga0316579_10209389 3300031691 Bacteria 943
369 Ga0316576_10020700 3300031727 Bacteria 4537
370 Ga0307405_10213506 3300031731 Bacteria 1410
371 Ga0307405_10251247 3300031731 Bacteria 1316
372 Ga0307405_11365749 3300031731 Bacteria 618
373 Ga0307405_11959634 3300031731 Bacteria 523
374 Ga0316577_10601743 3300031733 Bacteria 625
375 Ga0307413_10012189 3300031824 Bacteria 4269
376 Ga0307413_10022302 3300031824 Bacteria 3410
377 Ga0307413_10154526 3300031824 Bacteria 1603
378 Ga0307413_10215595 3300031824 Bacteria 1398
379 Ga0307413_10255222 3300031824 Bacteria 1303
380 Ga0307413_10804922 3300031824 Bacteria 790
381 Ga0307410_10100481 3300031852 Bacteria 2072
382 Ga0307410_10101683 3300031852 Bacteria 2061
383 Ga0307410_10113584 3300031852 Bacteria 1963
384 Ga0307410_10206081 3300031852 Bacteria 1504
385 Ga0307410_10230418 3300031852 Unclassified 1430
386 Ga0307410_10586404 3300031852 Bacteria 928
387 Ga0307406_10019197 3300031901 Bacteria 4010
388 Ga0307406_10023124 3300031901 Bacteria 3696
389 Ga0307406_10243562 3300031901 Bacteria 1350
390 Ga0307406_10292176 3300031901 Bacteria 1248
391 Ga0307406_10443826 3300031901 Bacteria 1039
392 Ga0307406_11211486 3300031901 Bacteria 656
393 Ga0307407_10100708 3300031903 Bacteria 1792
394 Ga0307407_10116380 3300031903 Bacteria 1687
395 Ga0307407_10427272 3300031903 Bacteria 956
396 Ga0307407_10884213 3300031903 Bacteria 684
397 Ga0307412_10061591 3300031911 Bacteria 2523
398 Ga0307412_10639176 3300031911 Bacteria 906
399 Ga0307412_11267391 3300031911 Bacteria 662
400 Ga0307409_100056359 3300031995 Bacteria 3039
401 Ga0307409_100104786 3300031995 Bacteria 2356
402 Ga0307409_100212034 3300031995 Bacteria 1741
403 Ga0307409_100290009 3300031995 Bacteria 1517
404 Ga0307409_100472936 3300031995 Bacteria 1214
405 Ga0307409_100500838 3300031995 Bacteria 1183
406 Ga0307416_100043428 3300032002 Bacteria 3520
407 Ga0307416_100124491 3300032002 Bacteria 2306
408 Ga0307416_100145851 3300032002 Bacteria 2161
409 Ga0307416_100689779 3300032002 Bacteria 1109
410 Ga0307416_101112359 3300032002 Bacteria 895
411 Ga0307416_102547629 3300032002 Bacteria 610
412 Ga0307416_102580988 3300032002 Bacteria 606
413 Ga0307416_103127917 3300032002 Bacteria 554
414 Ga0307414_10037547 3300032004 Bacteria 3245
415 Ga0307414_10169225 3300032004 Bacteria 1745
416 Ga0307414_10244606 3300032004 Bacteria 1487
417 Ga0307414_10859078 3300032004 Bacteria 830
418 Ga0307414_11634922 3300032004 Bacteria 600
419 Ga0307411_10046418 3300032005 Bacteria 2800
420 Ga0307411_10054783 3300032005 Bacteria 2620
421 Ga0307411_10307869 3300032005 Bacteria 1273
422 Ga0307411_11459754 3300032005 Bacteria 627
423 Ga0307415_100052651 3300032126 Bacteria 2769
424 Ga0307415_100068705 3300032126 Bacteria 2481
425 Ga0307415_100199881 3300032126 Bacteria 1585
426 Ga0307415_100858136 3300032126 Bacteria 834
427 Ga0307415_101797755 3300032126 Bacteria 593
428 Ga0307415_102225903 3300032126 Bacteria 537
429 Ga0316583_10071931 3300032133 Bacteria 1210
430 Ga0316593_10024061 3300032168 Bacteria 1928
431 Ga0316593_10184836 3300032168 Bacteria 767
432 Ga0373930_0202038 3300034816 Bacteria 518
433 Ga0373940_0264048 3300035088 Bacteria 584
434 Ga0373939_0117479 3300035114 Bacteria 934
435 Ga0373961_0267209 3300035241 Bacteria 624
436 Ga0373961_0276580 3300035241 Bacteria 615
437 Ga0316574_0061629 3300035398 Bacteria 2356
438 Ga0316574_1004499 3300035398 Bacteria 502
439 Ga0373931_0041802 3300035691 Bacteria 2409
440 Ga0316582_0030218 3300036647 Bacteria 3299
441 Ga0316582_0166360 3300036647 Bacteria 1495
442 Ga0316582_0452353 3300036647 Bacteria 885
443 Ga0316584_0171975 3300036712 Bacteria 1606
444 Ga0316584_0680989 3300036712 Bacteria 706
445 Ga0395900_0544527 3300037418 Bacteria 1106
446 Ga0395898_0655345 3300037466 Bacteria 992
447 Ga0316581_0156753 3300037588 Bacteria 702
448 Ga0439438_154039 3300041405 Bacteria 548
449 Ga0439461_0177192 3300041410 Bacteria 563
450 Ga0439466_0137519 3300041411 Bacteria 750
451 Ga0439465_0106251 3300041413 Bacteria 973
452 Ga0439465_0203638 3300041413 Bacteria 722
453 Ga0451795_0874052 3300041456 Bacteria 823
454 Ga0451804_0532822 3300041463 Bacteria 602
455 Ga0451807_0239030 3300041486 Bacteria 806
456 Ga0451841_1423195 3300041498 Bacteria 584
457 Ga0451855_1617122 3300041511 Bacteria 2176
458 Ga0451855_1634399 3300041511 Bacteria 1852
459 Ga0451853_0934038 3300041512 Bacteria 539
460 Ga0439431_0064943 3300041997 Bacteria 965
461 Ga0439433_0221066 3300041999 Bacteria 505
462 Ga0439449_0326510 3300042007 Bacteria 580
463 Ga0450894_022689 3300042131 Bacteria 851
464 Ga0439446_0029939 3300042156 Bacteria 1572
465 Ga0439446_0061538 3300042156 Bacteria 1136
466 Ga0439446_0212558 3300042156 Bacteria 656
467 Ga0439446_0300493 3300042156 Bacteria 563
468 Ga0439434_0060274 3300042435 Bacteria 1186
469 Ga0439434_0182225 3300042435 Bacteria 704
470 Ga0439435_0000833 3300042436 Bacteria 5262
471 Ga0439444_0064739 3300042437 Bacteria 770
472 Ga0439460_0121078 3300042461 Bacteria 856
473 Ga0451577_0025707 3300042876 Bacteria 5341
474 Ga0451577_0187623 3300042876 Unclassified 1865
475 Ga0451577_0371721 3300042876 Unclassified 1297
476 Ga0451577_0384578 3300042876 Bacteria 1274
477 Ga0451577_0459593 3300042876 Bacteria 1156
478 Ga0451577_0541323 3300042876 Bacteria 1057
479 Ga0451577_0903110 3300042876 Bacteria 795
480 Ga0453683_0788599 3300044673 Bacteria 625
481 Ga0466965_0778310 3300044683 Bacteria 553
482 Ga0453684_0001141 3300044712 Bacteria 82874
483 Ga0453684_0110810 3300044712 Bacteria 3335
484 Ga0453684_0119318 3300044712 Bacteria 3188
485 Ga0453684_0234121 3300044712 Unclassified 2118
486 Ga0451576_0654452 3300045051 Unclassified 1104
487 Ga0466967_0133535 3300045976 Bacteria 2306
488 Ga0495629_0223480 3300046459 Bacteria 1299
489 Ga0495629_1028663 3300046459 Bacteria 535
490 Ga0495641_0096316 3300046461 Bacteria 1321
491 Ga0495654_0403379 3300046530 Unclassified 543
492 Ga0495621_0003477 3300046539 Bacteria 4348
493 Ga0495668_0148820 3300046616 Bacteria 1282
494 Ga0495634_0773042 3300046642 Bacteria 549
495 Ga0495625_0769885 3300046660 Bacteria 562
496 Ga0495658_0232394 3300046683 Bacteria 1157
497 Ga0495671_0439171 3300046692 Bacteria 624
498 Ga0495676_0482070 3300047321 Bacteria 816
499 Ga0496101_0782173 3300048904 Bacteria 753
500 Ga0496101_1306746 3300048904 Bacteria 567
501 Ga0496102_0250002 3300048905 Bacteria 1672
502 Ga0496102_0543272 3300048905 Bacteria 1085
503 Ga0496103_0579218 3300048906 Bacteria 716
504 Ga0496108_0000682 3300048911 Bacteria 26248
505 Ga0496108_0243703 3300048911 Bacteria 1564
506 Ga0496108_0698292 3300048911 Bacteria 880
507 Ga0496109_0505514 3300048912 Bacteria 1141
508 Ga0496109_0793711 3300048912 Bacteria 885
509 Ga0496110_0137105 3300048913 Bacteria 2212
510 Ga0496110_1053102 3300048913 Bacteria 721
511 Ga0496111_0203355 3300048914 Bacteria 1472
512 Ga0496111_0477277 3300048914 Bacteria 919
513 Ga0496118_0272121 3300048921 Bacteria 948
514 Ga0496121_0001234 3300048924 Bacteria 44361
515 Ga0496123_0122848 3300048926 Bacteria 1456
516 Ga0496125_0025414 3300048928 Bacteria 5422
517 Ga0496126_0005110 3300048929 Bacteria 15210
518 Ga0501317_067990 3300049533 Bacteria 596
519 Ga0501031_0489566 3300049568 Bacteria 793
520 Ga0501031_0553139 3300049568 Unclassified 741
521 Ga0501031_0826358 3300049568 Bacteria 594
522 Ga0501031_0928753 3300049568 Bacteria 557
523 Ga0501032_0952139 3300049569 Bacteria 540
524 Ga0501033_0001374 3300049570 Bacteria 21696
525 Ga0501033_0170544 3300049570 Bacteria 1563
526 Ga0501033_0454201 3300049570 Bacteria 890
527 Ga0501033_1040522 3300049570 Bacteria 546
528 Ga0501033_1113775 3300049570 Bacteria 525
529 Ga0501034_0783124 3300049571 Unclassified 847
530 Ga0501036_0091584 3300049572 Bacteria 2568
531 Ga0501036_0227375 3300049572 Bacteria 1566
532 Ga0501036_0433837 3300049572 Bacteria 1095
533 Ga0501036_0509395 3300049572 Bacteria 1001
534 Ga0501036_1273705 3300049572 Unclassified 598
535 Ga0501037_0129047 3300049573 Bacteria 1814
536 Ga0501038_0175116 3300049574 Bacteria 1734
537 Ga0501038_0794449 3300049574 Bacteria 704
538 Ga0501039_0031091 3300049575 Bacteria 4116
539 Ga0501039_0548507 3300049575 Unclassified 907
540 Ga0501039_0958714 3300049575 Bacteria 665
541 Ga0501040_0019515 3300049576 Bacteria 4509
542 Ga0501040_0041766 3300049576 Bacteria 3124
543 Ga0501040_0127191 3300049576 Bacteria 1790
544 Ga0501040_0145728 3300049576 Bacteria 1669
545 Ga0501040_0177437 3300049576 Bacteria 1509
546 Ga0501040_0601596 3300049576 Bacteria 794
547 Ga0501040_0905793 3300049576 Bacteria 639
548 Ga0501041_0020783 3300049577 Bacteria 3928
549 Ga0501041_0121826 3300049577 Bacteria 1621
550 Ga0501041_0153088 3300049577 Bacteria 1440
551 Ga0501041_0323300 3300049577 Bacteria 973
552 Ga0501041_0378980 3300049577 Bacteria 895
553 Ga0501041_0481918 3300049577 Bacteria 788
554 Ga0501041_0860551 3300049577 Unclassified 582
555 Ga0501041_1125987 3300049577 Unclassified 506
556 Ga0501042_0004686 3300049578 Bacteria 8724
557 Ga0501042_0102895 3300049578 Bacteria 2054
558 Ga0501042_0164627 3300049578 Bacteria 1600
559 Ga0501042_0557667 3300049578 Bacteria 833
560 Ga0501042_0725153 3300049578 Bacteria 723
561 Ga0501043_0402244 3300049579 Bacteria 1035
562 Ga0501046_0046457 3300049580 Bacteria 3446
563 Ga0501046_0308068 3300049580 Bacteria 1155
564 Ga0501046_0926504 3300049580 Bacteria 607
565 Ga0501048_0128923 3300049582 Bacteria 1789
566 Ga0501048_0150997 3300049582 Bacteria 1643
567 Ga0501048_0185160 3300049582 Bacteria 1476
568 Ga0501048_0305878 3300049582 Bacteria 1131
569 Ga0501048_0352597 3300049582 Bacteria 1049
570 Ga0501048_1014962 3300049582 Bacteria 597
571 Ga0501048_1268830 3300049582 Unclassified 530
572 Ga0501067_0543490 3300049583 Bacteria 650
573 Ga0501067_0666491 3300049583 Bacteria 584
574 Ga0501068_0039957 3300049584 Bacteria 2815
575 Ga0501068_0727526 3300049584 Bacteria 649
576 Ga0501069_0208794 3300049585 Bacteria 1133
577 Ga0501071_0025152 3300049587 Bacteria 4169
578 Ga0501071_0358459 3300049587 Bacteria 1110
579 Ga0501071_0695294 3300049587 Bacteria 783
580 Ga0501071_0940627 3300049587 Bacteria 667
581 Ga0501072_0212784 3300049588 Bacteria 1540
582 Ga0501072_0329392 3300049588 Bacteria 1213
583 Ga0501072_0800018 3300049588 Bacteria 738
584 Ga0501073_0000503 3300049589 Bacteria 27315
585 Ga0501073_0399207 3300049589 Bacteria 950
586 Ga0501073_0574183 3300049589 Bacteria 779
587 Ga0501074_0023899 3300049590 Bacteria 4441
588 Ga0501074_0049215 3300049590 Bacteria 3043
589 Ga0501074_0280968 3300049590 Bacteria 1183
590 Ga0501074_0590368 3300049590 Bacteria 786
591 Ga0501075_0012280 3300049591 Bacteria 6083
592 Ga0501075_0106634 3300049591 Bacteria 2129
593 Ga0501075_0226601 3300049591 Bacteria 1425
594 Ga0501075_0268579 3300049591 Bacteria 1300
595 Ga0501075_0293837 3300049591 Bacteria 1238
596 Ga0501075_0378832 3300049591 Bacteria 1079
597 Ga0501075_0476578 3300049591 Bacteria 952
598 Ga0501075_1093771 3300049591 Bacteria 605
599 Ga0501075_1356375 3300049591 Bacteria 539
600 Ga0501075_1530952 3300049591 Bacteria 505
601 Ga0501076_0032757 3300049592 Bacteria 4057
602 Ga0501076_0067166 3300049592 Bacteria 2863
603 Ga0501076_0349212 3300049592 Bacteria 1215
604 Ga0501076_0417383 3300049592 Bacteria 1104
605 Ga0501076_0485834 3300049592 Bacteria 1018
606 Ga0501076_0756430 3300049592 Bacteria 802
607 Ga0501076_0799623 3300049592 Bacteria 778
608 Ga0501076_1661858 3300049592 Bacteria 524
609 Ga0501076_1726762 3300049592 Bacteria 513
610 Ga0501077_0018711 3300049593 Bacteria 4381
611 Ga0501077_0068595 3300049593 Bacteria 2248
612 Ga0501077_0168048 3300049593 Bacteria 1394
613 Ga0501077_0227472 3300049593 Bacteria 1186
614 Ga0501077_0240873 3300049593 Bacteria 1150
615 Ga0501077_0248078 3300049593 Bacteria 1132
616 Ga0501221_179282 3300049704 Bacteria 578
617 Ga0501225_0035487 3300049705 Bacteria 1373
618 Ga0501079_0033171 3300049741 Bacteria 3971
619 Ga0501079_0051938 3300049741 Bacteria 3165
620 Ga0501079_0067094 3300049741 Bacteria 2769
621 Ga0501079_0157324 3300049741 Bacteria 1771
622 Ga0501080_0213591 3300049742 Bacteria 1767
623 Ga0501080_0620723 3300049742 Bacteria 958
624 Ga0501080_1490260 3300049742 Unclassified 575
625 Ga0501081_0041651 3300049743 Bacteria 3146
626 Ga0501081_0154702 3300049743 Bacteria 1649
627 Ga0501081_0164746 3300049743 Bacteria 1598
628 Ga0501081_0469220 3300049743 Bacteria 936
629 Ga0501081_1096695 3300049743 Bacteria 602
630 Ga0501081_1511022 3300049743 Bacteria 510
631 Ga0501081_1537530 3300049743 Bacteria 506
632 Ga0501083_0388857 3300049744 Bacteria 907
633 Ga0501263_089938 3300049760 Bacteria 517
634 Ga0501266_072899 3300049763 Bacteria 570
635 Ga0501267_033953 3300049764 Bacteria 612
636 Ga0501268_011063 3300049765 Bacteria 1417
637 Ga0501035_0027384 3300049822 Bacteria 5210
638 Ga0501035_0729233 3300049822 Bacteria 797
639 Ga0501035_1165141 3300049822 Bacteria 599
640 Ga0501035_1169170 3300049822 Bacteria 598
641 Ga0501045_0029889 3300049824 Bacteria 3940
642 Ga0501045_0047836 3300049824 Bacteria 3116
643 Ga0501045_0072798 3300049824 Bacteria 2530
644 Ga0501045_0139580 3300049824 Bacteria 1802
645 Ga0501045_0223136 3300049824 Bacteria 1403
646 Ga0501045_0238967 3300049824 Bacteria 1352
647 Ga0501045_0385780 3300049824 Bacteria 1043
648 Ga0501045_0575696 3300049824 Bacteria 834
649 Ga0501045_0674621 3300049824 Unclassified 763
650 Ga0501212_007103 3300049851 Bacteria 1527
651 nmdc:mga03683_285609_c1 3300050489 Bacteria 772
652 nmdc:mga00v17_729240_c1 3300050491 Bacteria 634
653 nmdc:mga0k408_461092_c1 3300050493 Bacteria 754
654 nmdc:mga06z11_530861_c1 3300050494 Bacteria 714
655 nmdc:mga07m45_82819_c1 3300050496 Bacteria 1832
656 nmdc:mga05p37_1344528_c1 3300050507 Bacteria 724
657 nmdc:mga05p37_1520613_c1 3300050507 Bacteria 665
658 nmdc:mga05p37_200966_c1 3300050507 Bacteria 2063
659 nmdc:mga05p37_37964_c1 3300050507 Bacteria 5907
660 nmdc:mga05p37_731421_c1 3300050507 Bacteria 1094
661 nmdc:mga09592_1229285_c1 3300050508 Unclassified 618
662 nmdc:mga06r32_1895894_c1 3300050510 Bacteria 530
663 nmdc:mga06r32_26127_c1 3300050510 Bacteria 5440
664 nmdc:mga06r32_685800_c1 3300050510 Bacteria 991
665 nmdc:mga08y16_2020729_c1 3300050511 Bacteria 525
666 nmdc:mga08y16_33353_c1 3300050511 Bacteria 5407
667 nmdc:mga08y16_34948_c1 3300050511 Bacteria 5281
668 nmdc:mga08y16_41914_c1 3300050511 Bacteria 4795
669 nmdc:mga0n895_224571_c1 3300050512 Bacteria 1906
670 nmdc:mga0n895_553756_c1 3300050512 Bacteria 1156
671 nmdc:mga0rr50_138651_c1 3300050513 Bacteria 1955
672 nmdc:mga0rr50_79923_c1 3300050513 Bacteria 2519
673 nmdc:mga08x19_663134_c1 3300050514 Bacteria 740
674 Ga0500646_0084980 3300053090 Bacteria 971
675 Ga0500555_002117 3300053103 Bacteria 5809
676 Ga0500555_009332 3300053103 Bacteria 2806
677 Ga0501084_0056529 3300054114 Bacteria 3283
678 Ga0501084_0109545 3300054114 Bacteria 2320
679 Ga0501084_0113443 3300054114 Bacteria 2278
680 Ga0501084_0130724 3300054114 Bacteria 2114
681 Ga0501084_0139972 3300054114 Bacteria 2038
682 Ga0501084_0481508 3300054114 Bacteria 1049
683 Ga0501084_0483956 3300054114 Bacteria 1046
684 Ga0501084_1176323 3300054114 Bacteria 643
685 Ga0590071_000490 3300059421 Bacteria 11563
686 Ga0590071_009584 3300059421 Bacteria 2274
687 Ga0590071_013624 3300059421 Bacteria 1904
688 Ga0590071_159148 3300059421 Bacteria 588
689 Ga0590074_005933 3300059423 Bacteria 2028
690 Ga0590075_017317 3300059424 Bacteria 1775
691 Ga0590075_045278 3300059424 Bacteria 1127
692 Ga0590075_047623 3300059424 Bacteria 1099
693 Ga0590075_053747 3300059424 Archaea 1034
694 Ga0590075_070888 3300059424 Bacteria 901
695 Ga0590077_031057 3300059426 Bacteria 1166
696 Ga0501082_0002645 3300060353 Bacteria 15671
697 Ga0501082_0015965 3300060353 Bacteria 6459
698 Ga0501082_0031453 3300060353 Bacteria 4577
699 Ga0501082_0131909 3300060353 Bacteria 2168
700 Ga0501082_0877830 3300060353 Bacteria 785
701 Ga0501082_0896940 3300060353 Bacteria 775
702 Ga0530510_0047815 3300061734 Bacteria 3092
703 Ga0530510_0140486 3300061734 Bacteria 1779
704 Ga0530510_0215025 3300061734 Bacteria 1428
705 Ga0530510_0302918 3300061734 Bacteria 1196
706 Ga0530510_0613369 3300061734 Bacteria 828
707 Ga0530510_1376840 3300061734 Bacteria 541
708 2508734755 2508501050 Bacteria 9633614
709 2509079362 2508501114 Bacteria 7082538
710 2774871832 2773857925 Bacteria 6472445
711 2776257615 2775506901 Bacteria 9631051
712 2835318417 2835312727 Bacteria 7413381
713 2882459047 2882456835 Bacteria 6863978
714 2894234218 2894232714 Bacteria 8834183
715 2995395388 2995392953 Bacteria 4539380
716 Ga0439453_0036289
717 SwRhRL2b_contig_1421729
718 SwRhRL2b_contig_684236
719 SwRhRL2b_contig_999301
720 Ga0058692_1006280
721 Ga0065712_10004986
722 Ga0065712_10070735
723 Ga0065712_10094626
724 Ga0065715_10016199
725 Ga0065715_10097490
726 Ga0065715_10226456
727 Ga0065707_10019392
728 Ga0065707_10981736
729 Ga0070676_10077795
730 Ga0070676_10311955
731 Ga0070676_11609782
732 Ga0070690_100075912
733 Ga0070690_100132875
734 Ga0070670_100016217
735 Ga0070670_100717641
736 Ga0070677_10018279
737 Ga0070677_10143795
738 Ga0070677_10730705
739 Ga0068869_100057487
740 Ga0068869_100919983
741 Ga0070666_10134345
742 Ga0070680_100114472
743 Ga0070680_101737751
744 Ga0070682_100669118
745 Ga0068868_100250367
746 Ga0068868_100386535
747 Ga0068868_101374583
748 Ga0070660_101702711
749 Ga0070689_100041640
750 Ga0070689_100268250
751 Ga0070689_100407526
752 Ga0070689_100677543
753 Ga0070689_101157797
754 Ga0070687_100046433
755 Ga0070687_100514464
756 Ga0070661_101375003
757 Ga0070661_101720767
758 Ga0070692_10039949
759 Ga0070692_10699469
760 Ga0070692_11296283
761 Ga0070668_100024254
762 Ga0070668_100048320
763 Ga0070668_100234458
764 Ga0070668_100661563
765 Ga0070668_101134309
766 Ga0070668_101812666
767 Ga0070669_100015947
768 Ga0070669_100082473
769 Ga0070669_100154670
770 Ga0070669_100154684
771 Ga0070669_100212601
772 Ga0070669_100517975
773 Ga0070669_101236617
774 Ga0070675_100026213
775 Ga0070675_100087201
776 Ga0070675_100104196
777 Ga0070675_100156086
778 Ga0070675_100549821
779 Ga0070675_100788903
780 Ga0070675_101522241
781 Ga0070671_100567218
782 Ga0070674_100046191
783 Ga0070674_100131736
784 Ga0070674_100343290
785 Ga0070674_100364925
786 Ga0070674_100843385
787 Ga0070673_100007649
788 Ga0070673_100023727
789 Ga0070673_100521096
790 Ga0070688_100015907
791 Ga0070688_100315607
792 Ga0070688_101175179
793 Ga0070659_100075646
794 Ga0070667_100348196
795 Ga0070667_100805954
796 Ga0070667_101315672
797 Ga0070701_10011897
798 Ga0070701_10150492
799 Ga0070705_101084060
800 Ga0070700_100041287
801 Ga0070700_100050059
802 Ga0070700_100174043
803 Ga0070694_100019585
804 Ga0070694_100947295
805 Ga0070694_101441491
806 Ga0070694_101501788
807 Ga0070708_100455564
808 Ga0070663_100281306
809 Ga0070663_100825620
810 Ga0070678_100768727
811 Ga0070678_101141752
812 Ga0070681_10051297
813 Ga0070681_10736649
814 Ga0070685_10335584
815 Ga0070685_10345652
816 Ga0070706_100073067
817 Ga0070707_100061426
818 Ga0070698_100034190
819 Ga0070698_101271358
820 Ga0070699_100130705
821 Ga0070679_100081088
822 Ga0070679_100271813
823 Ga0070684_101048333
824 Ga0070697_100088783
825 Ga0068853_101250533
826 Ga0070672_100032938
827 Ga0070672_100239226
828 Ga0070672_101452270
829 Ga0070695_100016647
830 Ga0070695_101421771
831 Ga0070696_100044169
832 Ga0070696_100377855
833 Ga0070693_100072559
834 Ga0070665_100159353
835 Ga0070665_101070807
836 Ga0070704_100096482
837 Ga0070704_100311371
838 Ga0070704_100585604
839 Ga0070704_102249463
840 Ga0070664_100199808
841 Ga0070664_100689479
842 Ga0070664_100952287
843 Ga0068857_100043638
844 Ga0068857_100108607
845 Ga0068857_101316457
846 Ga0068854_100184485
847 Ga0068854_101260574
848 Ga0070702_100610670
849 Ga0068852_100780095
850 Ga0068859_100108429
851 Ga0068859_100146839
852 Ga0068859_100795036
853 Ga0068859_102192058
854 Ga0068864_100738560
855 Ga0068866_10513656
856 Ga0068861_100023548
857 Ga0068861_100136222
858 Ga0068870_10613058
859 Ga0068870_11049006
860 Ga0068870_11253772
861 Ga0068870_11293005
862 Ga0068863_100306848
863 Ga0068863_101511139
864 Ga0068858_100030292
865 Ga0068858_100740087
866 Ga0068858_102464150
867 Ga0068860_100278008
868 Ga0068862_100009135
869 Ga0068862_100085919
870 Ga0068862_100244014
871 Ga0068862_100810185
872 Ga0068862_101399693
873 Ga0068862_101825409
874 Ga0081538_10166491
875 Ga0075365_10569516
876 Ga0075364_10604826
877 Ga0075362_10078159
878 Ga0075362_10200876
879 Ga0075362_10392763
880 Ga0075366_10253917
881 Ga0068871_100455858
882 Ga0075428_100036605
883 Ga0075428_100792063
884 Ga0075428_101045345
885 Ga0075430_100448148
886 Ga0075431_100024308
887 Ga0075431_100116718
888 Ga0075431_100715046
889 Ga0075434_100160757
890 Ga0075434_101993455
891 Ga0075429_100246513
892 Ga0068865_100163091
893 Ga0068865_100552965
894 Ga0097620_100108428
895 Ga0097620_100146842
896 Ga0097620_100795061
897 Ga0097620_102191623
898 Ga0075435_100000792
899 Ga0075435_100092692
900 Ga0111539_10012573
901 Ga0111539_10014583
902 Ga0111539_10017954
903 Ga0111539_10038079
904 Ga0111539_11203410
905 Ga0111539_11279579
906 Ga0105245_10048297
907 Ga0105245_10767714
908 Ga0105245_11000140
909 Ga0105247_10304320
910 Ga0114129_10005325
911 Ga0114129_10070627
912 Ga0114129_10222467
913 Ga0114129_10763939
914 Ga0114129_11252754
915 Ga0114129_11287240
916 Ga0114129_11921062
917 Ga0114129_12261743
918 Ga0105243_10089108
919 Ga0105243_10207013
920 Ga0105241_10019274
921 Ga0105241_10117042
922 Ga0105242_10724120
923 Ga0105242_10938218
924 Ga0105242_12141170
925 Ga0105242_13270924
926 Ga0105248_10037776
927 Ga0105248_10113685
928 Ga0105238_12579397
929 Ga0105238_13006115
930 Ga0105249_10080976
931 Ga0105249_10162566
932 Ga0105249_11098823
933 Ga0105249_12246117
934 Ga0105249_13117168
935 Ga0105239_11029391
936 Ga0105239_11881227
937 Ga0157338_1024724
938 Ga0157370_10168872
939 Ga0157370_12019517
940 Ga0157374_10259808
941 Ga0157374_11475403
942 Ga0157378_10561561
943 Ga0163162_10248242
944 Ga0163162_11063834
945 Ga0163162_11889583
946 Ga0157372_12145996
947 Ga0157375_10030134
948 Ga0157375_10728931
949 Ga0157375_10787327
950 Ga0157375_13135540
951 Ga0163163_11176328
952 Ga0157380_10006843
953 Ga0157380_10011149
954 Ga0157380_10094526
955 Ga0157380_10112712
956 Ga0157380_10307428
957 Ga0157380_10474753
958 Ga0157380_10918668
959 Ga0157380_10937735
960 Ga0157380_11120257
961 Ga0157377_10002502
962 Ga0157377_10344695
963 Ga0163161_10638153
964 Ga0209675_1018436
965 Ga0209676_1028411
966 Ga0209050_1057054
967 Ga0207697_10061699
968 Ga0207653_10014319
969 Ga0207682_10349716
970 Ga0207688_10103279
971 Ga0207688_10492385
972 Ga0207680_10170863
973 Ga0207647_10495665
974 Ga0207645_10014205
975 Ga0207645_10026501
976 Ga0207645_10095154
977 Ga0207645_10460760
978 Ga0207643_10001861
979 Ga0207643_10634200
980 Ga0207654_10677468
981 Ga0207707_10531941
982 Ga0207660_10324243
983 Ga0207660_10715158
984 Ga0207662_10029612
985 Ga0207662_10281207
986 Ga0207657_11047182
987 Ga0207649_10914339
988 Ga0207652_10199925
989 Ga0207652_10858850
990 Ga0207646_10184701
991 Ga0207681_10038225
992 Ga0207681_10136308
993 Ga0207681_10240304
994 Ga0207681_10270202
995 Ga0207681_10896890
996 Ga0207650_10094140
997 Ga0207650_10139963
998 Ga0207650_10146784
999 Ga0207659_10051570
1000 Ga0207659_10150242
1001 Ga0207659_10277172
1002 Ga0207659_10464678
1003 Ga0207644_10694168
1004 Ga0207690_10228229
1005 Ga0207706_10051547
1006 Ga0207706_10145169
1007 Ga0207706_11268378
1008 Ga0207686_11392734
1009 Ga0207709_10156774
1010 Ga0207709_11648701
1011 Ga0207670_10154120
1012 Ga0207669_10308550
1013 Ga0207669_10650665
1014 Ga0207669_10752029
1015 Ga0207669_10825341
1016 Ga0207704_10429634
1017 Ga0207691_10047709
1018 Ga0207691_10048247
1019 Ga0207689_10029911
1020 Ga0207689_10037828
1021 Ga0207679_10946075
1022 Ga0207679_10948555
1023 Ga0207651_10215254
1024 Ga0207651_10382510
1025 Ga0207651_10817640
1026 Ga0207651_11058045
1027 Ga0207712_10134538
1028 Ga0207712_10758262
1029 Ga0207668_10056441
1030 Ga0207668_10111298
1031 Ga0207668_10212019
1032 Ga0207668_10527833
1033 Ga0207668_11172008
1034 Ga0207668_11355995
1035 Ga0207640_12160373
1036 Ga0207658_10323811
1037 Ga0207658_10392160
1038 Ga0207677_10109295
1039 Ga0207677_10144804
1040 Ga0207703_10067144
1041 Ga0207639_11567305
1042 Ga0207678_10507476
1043 Ga0207708_10014564
1044 Ga0207708_10079337
1045 Ga0207708_10176591
1046 Ga0207641_10045325
1047 Ga0207648_10011235
1048 Ga0207648_10136627
1049 Ga0207648_10707051
1050 Ga0207676_12251048
1051 Ga0207674_10012217
1052 Ga0207674_10102973
1053 Ga0207674_10964471
1054 Ga0207675_100000124
1055 Ga0207675_100035215
1056 Ga0207675_101173777
1057 Ga0207675_101543168
1058 Ga0207675_101557716
1059 Ga0207675_101936163
1060 Ga0207683_10469730
1061 Ga0207698_10881460
1062 Ga0209999_1108304
1063 Ga0209970_1016880
1064 Ga0209971_1088365
1065 Ga0209998_10026940
1066 Ga0209974_10121126
1067 Ga0207428_10002981
1068 Ga0207428_10045477
1069 Ga0207428_10053575
1070 Ga0207428_10208007
1071 Ga0268266_10071749
1072 Ga0268266_10319088
1073 Ga0268265_10094194
1074 Ga0268265_10245097
1075 Ga0268265_10266709
1076 Ga0268265_10416703
1077 Ga0268265_11088622
1078 Ga0268264_10973594
1079 Ga0307408_100044927
1080 Ga0307408_100363887
1081 Ga0307408_100486806
1082 Ga0316575_10223255
1083 Ga0316579_10209389
1084 Ga0316576_10020700
1085 Ga0307405_10213506
1086 Ga0307405_10251247
1087 Ga0307405_11365749
1088 Ga0307405_11959634
1089 Ga0316577_10601743
1090 Ga0307413_10012189
1091 Ga0307413_10022302
1092 Ga0307413_10154526
1093 Ga0307413_10215595
1094 Ga0307413_10255222
1095 Ga0307413_10804922
1096 Ga0307410_10100481
1097 Ga0307410_10101683
1098 Ga0307410_10113584
1099 Ga0307410_10206081
1100 Ga0307410_10230418
1101 Ga0307410_10586404
1102 Ga0307406_10019197
1103 Ga0307406_10023124
1104 Ga0307406_10243562
1105 Ga0307406_10292176
1106 Ga0307406_10443826
1107 Ga0307406_11211486
1108 Ga0307407_10100708
1109 Ga0307407_10116380
1110 Ga0307407_10427272
1111 Ga0307407_10884213
1112 Ga0307412_10061591
1113 Ga0307412_10639176
1114 Ga0307412_11267391
1115 Ga0307409_100056359
1116 Ga0307409_100104786
1117 Ga0307409_100212034
1118 Ga0307409_100290009
1119 Ga0307409_100472936
1120 Ga0307409_100500838
1121 Ga0307416_100043428
1122 Ga0307416_100124491
1123 Ga0307416_100145851
1124 Ga0307416_100689779
1125 Ga0307416_101112359
1126 Ga0307416_102547629
1127 Ga0307416_102580988
1128 Ga0307416_103127917
1129 Ga0307414_10037547
1130 Ga0307414_10169225
1131 Ga0307414_10244606
1132 Ga0307414_10859078
1133 Ga0307414_11634922
1134 Ga0307411_10046418
1135 Ga0307411_10054783
1136 Ga0307411_10307869
1137 Ga0307411_11459754
1138 Ga0307415_100052651
1139 Ga0307415_100068705
1140 Ga0307415_100199881
1141 Ga0307415_100858136
1142 Ga0307415_101797755
1143 Ga0307415_102225903
1144 Ga0316583_10071931
1145 Ga0316593_10024061
1146 Ga0316593_10184836
1147 Ga0373930_0202038
1148 Ga0373940_0264048
1149 Ga0373939_0117479
1150 Ga0373961_0267209
1151 Ga0373961_0276580
1152 Ga0316574_0061629
1153 Ga0316574_1004499
1154 Ga0373931_0041802
1155 Ga0316582_0030218
1156 Ga0316582_0166360
1157 Ga0316582_0452353
1158 Ga0316584_0171975
1159 Ga0316584_0680989
1160 Ga0395900_0544527
1161 Ga0395898_0655345
1162 Ga0316581_0156753
1163 Ga0439438_154039
1164 Ga0439461_0177192
1165 Ga0439466_0137519
1166 Ga0439465_0106251
1167 Ga0439465_0203638
1168 Ga0451795_0874052
1169 Ga0451804_0532822
1170 Ga0451807_0239030
1171 Ga0451841_1423195
1172 Ga0451855_1617122
1173 Ga0451855_1634399
1174 Ga0451853_0934038
1175 Ga0439431_0064943
1176 Ga0439433_0221066
1177 Ga0439449_0326510
1178 Ga0450894_022689
1179 Ga0439446_0029939
1180 Ga0439446_0061538
1181 Ga0439446_0212558
1182 Ga0439446_0300493
1183 Ga0439434_0060274
1184 Ga0439434_0182225
1185 Ga0439435_0000833
1186 Ga0439444_0064739
1187 Ga0439460_0121078
1188 Ga0451577_0025707
1189 Ga0451577_0187623
1190 Ga0451577_0371721
1191 Ga0451577_0384578
1192 Ga0451577_0459593
1193 Ga0451577_0541323
1194 Ga0451577_0903110
1195 Ga0453683_0788599
1196 Ga0466965_0778310
1197 Ga0453684_0001141
1198 Ga0453684_0110810
1199 Ga0453684_0119318
1200 Ga0453684_0234121
1201 Ga0451576_0654452
1202 Ga0466967_0133535
1203 Ga0495629_0223480
1204 Ga0495629_1028663
1205 Ga0495641_0096316
1206 Ga0495654_0403379
1207 Ga0495621_0003477
1208 Ga0495668_0148820
1209 Ga0495634_0773042
1210 Ga0495625_0769885
1211 Ga0495658_0232394
1212 Ga0495671_0439171
1213 Ga0495676_0482070
1214 Ga0496101_0782173
1215 Ga0496101_1306746
1216 Ga0496102_0250002
1217 Ga0496102_0543272
1218 Ga0496103_0579218
1219 Ga0496108_0000682
1220 Ga0496108_0243703
1221 Ga0496108_0698292
1222 Ga0496109_0505514
1223 Ga0496109_0793711
1224 Ga0496110_0137105
1225 Ga0496110_1053102
1226 Ga0496111_0203355
1227 Ga0496111_0477277
1228 Ga0496118_0272121
1229 Ga0496121_0001234
1230 Ga0496123_0122848
1231 Ga0496125_0025414
1232 Ga0496126_0005110
1233 Ga0501317_067990
1234 Ga0501031_0489566
1235 Ga0501031_0553139
1236 Ga0501031_0826358
1237 Ga0501031_0928753
1238 Ga0501032_0952139
1239 Ga0501033_0001374
1240 Ga0501033_0170544
1241 Ga0501033_0454201
1242 Ga0501033_1040522
1243 Ga0501033_1113775
1244 Ga0501034_0783124
1245 Ga0501036_0091584
1246 Ga0501036_0227375
1247 Ga0501036_0433837
1248 Ga0501036_0509395
1249 Ga0501036_1273705
1250 Ga0501037_0129047
1251 Ga0501038_0175116
1252 Ga0501038_0794449
1253 Ga0501039_0031091
1254 Ga0501039_0548507
1255 Ga0501039_0958714
1256 Ga0501040_0019515
1257 Ga0501040_0041766
1258 Ga0501040_0127191
1259 Ga0501040_0145728
1260 Ga0501040_0177437
1261 Ga0501040_0601596
1262 Ga0501040_0905793
1263 Ga0501041_0020783
1264 Ga0501041_0121826
1265 Ga0501041_0153088
1266 Ga0501041_0323300
1267 Ga0501041_0378980
1268 Ga0501041_0481918
1269 Ga0501041_0860551
1270 Ga0501041_1125987
1271 Ga0501042_0004686
1272 Ga0501042_0102895
1273 Ga0501042_0164627
1274 Ga0501042_0557667
1275 Ga0501042_0725153
1276 Ga0501043_0402244
1277 Ga0501046_0046457
1278 Ga0501046_0308068
1279 Ga0501046_0926504
1280 Ga0501048_0128923
1281 Ga0501048_0150997
1282 Ga0501048_0185160
1283 Ga0501048_0305878
1284 Ga0501048_0352597
1285 Ga0501048_1014962
1286 Ga0501048_1268830
1287 Ga0501067_0543490
1288 Ga0501067_0666491
1289 Ga0501068_0039957
1290 Ga0501068_0727526
1291 Ga0501069_0208794
1292 Ga0501071_0025152
1293 Ga0501071_0358459
1294 Ga0501071_0695294
1295 Ga0501071_0940627
1296 Ga0501072_0212784
1297 Ga0501072_0329392
1298 Ga0501072_0800018
1299 Ga0501073_0000503
1300 Ga0501073_0399207
1301 Ga0501073_0574183
1302 Ga0501074_0023899
1303 Ga0501074_0049215
1304 Ga0501074_0280968
1305 Ga0501074_0590368
1306 Ga0501075_0012280
1307 Ga0501075_0106634
1308 Ga0501075_0226601
1309 Ga0501075_0268579
1310 Ga0501075_0293837
1311 Ga0501075_0378832
1312 Ga0501075_0476578
1313 Ga0501075_1093771
1314 Ga0501075_1356375
1315 Ga0501075_1530952
1316 Ga0501076_0032757
1317 Ga0501076_0067166
1318 Ga0501076_0349212
1319 Ga0501076_0417383
1320 Ga0501076_0485834
1321 Ga0501076_0756430
1322 Ga0501076_0799623
1323 Ga0501076_1661858
1324 Ga0501076_1726762
1325 Ga0501077_0018711
1326 Ga0501077_0068595
1327 Ga0501077_0168048
1328 Ga0501077_0227472
1329 Ga0501077_0240873
1330 Ga0501077_0248078
1331 Ga0501221_179282
1332 Ga0501225_0035487
1333 Ga0501079_0033171
1334 Ga0501079_0051938
1335 Ga0501079_0067094
1336 Ga0501079_0157324
1337 Ga0501080_0213591
1338 Ga0501080_0620723
1339 Ga0501080_1490260
1340 Ga0501081_0041651
1341 Ga0501081_0154702
1342 Ga0501081_0164746
1343 Ga0501081_0469220
1344 Ga0501081_1096695
1345 Ga0501081_1511022
1346 Ga0501081_1537530
1347 Ga0501083_0388857
1348 Ga0501263_089938
1349 Ga0501266_072899
1350 Ga0501267_033953
1351 Ga0501268_011063
1352 Ga0501035_0027384
1353 Ga0501035_0729233
1354 Ga0501035_1165141
1355 Ga0501035_1169170
1356 Ga0501045_0029889
1357 Ga0501045_0047836
1358 Ga0501045_0072798
1359 Ga0501045_0139580
1360 Ga0501045_0223136
1361 Ga0501045_0238967
1362 Ga0501045_0385780
1363 Ga0501045_0575696
1364 Ga0501045_0674621
1365 Ga0501212_007103
1366 nmdc:mga03683_285609_c1
1367 nmdc:mga00v17_729240_c1
1368 nmdc:mga0k408_461092_c1
1369 nmdc:mga06z11_530861_c1
1370 nmdc:mga07m45_82819_c1
1371 nmdc:mga05p37_1344528_c1
1372 nmdc:mga05p37_1520613_c1
1373 nmdc:mga05p37_200966_c1
1374 nmdc:mga05p37_37964_c1
1375 nmdc:mga05p37_731421_c1
1376 nmdc:mga09592_1229285_c1
1377 nmdc:mga06r32_1895894_c1
1378 nmdc:mga06r32_26127_c1
1379 nmdc:mga06r32_685800_c1
1380 nmdc:mga08y16_2020729_c1
1381 nmdc:mga08y16_33353_c1
1382 nmdc:mga08y16_34948_c1
1383 nmdc:mga08y16_41914_c1
1384 nmdc:mga0n895_224571_c1
1385 nmdc:mga0n895_553756_c1
1386 nmdc:mga0rr50_138651_c1
1387 nmdc:mga0rr50_79923_c1
1388 nmdc:mga08x19_663134_c1
1389 Ga0500646_0084980
1390 Ga0500555_002117
1391 Ga0500555_009332
1392 Ga0501084_0056529
1393 Ga0501084_0109545
1394 Ga0501084_0113443
1395 Ga0501084_0130724
1396 Ga0501084_0139972
1397 Ga0501084_0481508
1398 Ga0501084_0483956
1399 Ga0501084_1176323
1400 Ga0590071_000490
1401 Ga0590071_009584
1402 Ga0590071_013624
1403 Ga0590071_159148
1404 Ga0590074_005933
1405 Ga0590075_017317
1406 Ga0590075_045278
1407 Ga0590075_047623
1408 Ga0590075_053747
1409 Ga0590075_070888
1410 Ga0590077_031057
1411 Ga0501082_0002645
1412 Ga0501082_0015965
1413 Ga0501082_0031453
1414 Ga0501082_0131909
1415 Ga0501082_0877830
1416 Ga0501082_0896940
1417 Ga0530510_0047815
1418 Ga0530510_0140486
1419 Ga0530510_0215025
1420 Ga0530510_0302918
1421 Ga0530510_0613369
1422 Ga0530510_1376840
1423 2508734755
1424 2509079362
1425 2774871832
1426 2776257615
1427 2835318417
1428 2882459047
1429 2894234218
1430 2995395388

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01906

YbjQ_1

Putative heavy-metal-binding

26

132

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.9521 4 108
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.941 4 108
1y2i-assembly1.cif.gz_C crystal structure of mcsg target apc27401 from shigella flexneri 0.9222 4 107
2gtc-assembly1.cif.gz_E crystal structure of the hypthetical protein from bacillus cereus (atcc 14579). northeast structural genomics target bcr11 0.9186 4 108
2gtc-assembly1.cif.gz_E crystal structure of the hypthetical protein from bacillus cereus (atcc 14579). northeast structural genomics target bcr11 0.9101 4 108
ID Description Score Start End Superfamily
1y2iA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.9132 6 107 3.30.110.70
1ybbE00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8812 4 108 3.30.110.70
1ybbE00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.872 4 108 3.30.110.70
1y2iA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8566 6 107 3.30.110.70
af_Q58808_5_102_3.30.110.70 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8527 5 107 3.30.110.70
ID Description Score Start End GO Terms
AF-B7LN30-F1-model_v4 UPF0145 protein YbjQ 0.9807 4 107
AF-B4TRP6-F1-model_v4 UPF0145 protein YbjQ 0.9801 4 107
AF-A8AIP7-F1-model_v4 UPF0145 protein CKO_02237 0.9799 4 107
AF-A0A2Z5SNW2-F1-model_v4 deleted 0.9781 2 107
AF-A0A7C3DIF8-F1-model_v4 UPF0145 protein ENS82_14995 0.9779 4 107

Map