F476940
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 361 | 695 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10063256|Ga0114129_100632564 |
| Length | 294 |
| Sequence | VRPEPHYDEDCNMSVIQVAETLEASPIRRRQSLFLKKSVRHSLPWLVIGLLFLLWEIAVRTFAIPEFVLPAPSAIFAAAWEFRAGILDNAWQTLFTTAIGFVIAIVFGVVGGVAIGSSPLVYQGFYPALIGFNSIPKVAIVPILVIWFGVGTIPAIITAFLISFFPILVNVATGIATLEPELRDVLRALGASRFKVITKVGLPRAMPYFFASLKIAVTVAFIGSIVSETVAANRGIGHLMLVASARFEVPLAFAALLVTGAMGVGMYAIAGAFERHMTGWAVRGINGVGLTPQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 2 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 3 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 4 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 5 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 6 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 7 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 8 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 9 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 10 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 11 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 12 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 13 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 14 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 15 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 16 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 17 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 189 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 323 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 341 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 343 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 347 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 348 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 349 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 352 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 353 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 354 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 357 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 360 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 361 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.34 |
| Metatranscriptomes | 0 |
| Isolates | 2.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7 |
| Nodule | 0.84 |
| Rhizoplane | 9.38 |
| Rhizosphere | 77.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10011179 | 3300003187 | Bacteria | 4134 |
| 2 | JGI25406J46586_10048618 | 3300003203 | Bacteria | 1437 |
| 3 | JGI25153J46596_10001453 | 3300003215 | Bacteria | 14169 |
| 4 | rootL2_10000581 | 3300003322 | Bacteria | 1682 |
| 5 | Ga0065712_10069608 | 3300005290 | Bacteria | 6977 |
| 6 | Ga0070683_100116237 | 3300005329 | Bacteria | 2525 |
| 7 | Ga0070690_100017371 | 3300005330 | Bacteria | 4325 |
| 8 | Ga0070690_100094459 | 3300005330 | Bacteria | 1973 |
| 9 | Ga0070690_100288032 | 3300005330 | Unclassified | 1174 |
| 10 | Ga0070670_100000725 | 3300005331 | Bacteria | 25600 |
| 11 | Ga0070680_100032118 | 3300005336 | Bacteria | 4223 |
| 12 | Ga0068868_100031126 | 3300005338 | Bacteria | 4096 |
| 13 | Ga0070687_100370820 | 3300005343 | Bacteria | 930 |
| 14 | Ga0070661_100028049 | 3300005344 | Bacteria | 4059 |
| 15 | Ga0070668_100241806 | 3300005347 | Bacteria | 1495 |
| 16 | Ga0070669_100202067 | 3300005353 | Bacteria | 1564 |
| 17 | Ga0070675_100265426 | 3300005354 | Bacteria | 1505 |
| 18 | Ga0070675_100414273 | 3300005354 | Unclassified | 1204 |
| 19 | Ga0070671_100066381 | 3300005355 | Bacteria | 3007 |
| 20 | Ga0070671_100112883 | 3300005355 | Bacteria | 2283 |
| 21 | Ga0070673_100277222 | 3300005364 | Bacteria | 1469 |
| 22 | Ga0070688_100226098 | 3300005365 | Bacteria | 1321 |
| 23 | Ga0070688_100274645 | 3300005365 | Bacteria | 1208 |
| 24 | Ga0070688_100462212 | 3300005365 | Bacteria | 951 |
| 25 | Ga0070659_100189118 | 3300005366 | Bacteria | 1691 |
| 26 | Ga0070659_100190179 | 3300005366 | Bacteria | 1687 |
| 27 | Ga0070659_100475550 | 3300005366 | Bacteria | 1063 |
| 28 | Ga0070667_100028854 | 3300005367 | Bacteria | 4620 |
| 29 | Ga0070667_100133196 | 3300005367 | Bacteria | 2171 |
| 30 | Ga0070709_10021066 | 3300005434 | Bacteria | 3794 |
| 31 | Ga0070709_10083604 | 3300005434 | Bacteria | 2088 |
| 32 | Ga0070709_10108537 | 3300005434 | Bacteria | 1862 |
| 33 | Ga0070714_100028036 | 3300005435 | Bacteria | 4668 |
| 34 | Ga0070713_100000550 | 3300005436 | Bacteria | 23862 |
| 35 | Ga0070713_100021301 | 3300005436 | Bacteria | 4983 |
| 36 | Ga0070713_100043618 | 3300005436 | Bacteria | 3667 |
| 37 | Ga0070713_100104000 | 3300005436 | Bacteria | 2465 |
| 38 | Ga0070713_100128811 | 3300005436 | Bacteria | 2229 |
| 39 | Ga0070710_10001391 | 3300005437 | Bacteria | 11419 |
| 40 | Ga0070711_100022169 | 3300005439 | Bacteria | 4113 |
| 41 | Ga0070711_100062344 | 3300005439 | Bacteria | 2598 |
| 42 | Ga0070711_100151821 | 3300005439 | Bacteria | 1747 |
| 43 | Ga0070711_100319265 | 3300005439 | Bacteria | 1240 |
| 44 | Ga0070711_100386871 | 3300005439 | Bacteria | 1132 |
| 45 | Ga0070705_100215980 | 3300005440 | Bacteria | 1325 |
| 46 | Ga0070705_100365203 | 3300005440 | Bacteria | 1057 |
| 47 | Ga0070700_100025387 | 3300005441 | Bacteria | 3488 |
| 48 | Ga0070700_100167445 | 3300005441 | Bacteria | 1519 |
| 49 | Ga0070700_100181908 | 3300005441 | Unclassified | 1464 |
| 50 | Ga0070694_100025036 | 3300005444 | Bacteria | 3857 |
| 51 | Ga0070694_100068923 | 3300005444 | Bacteria | 2432 |
| 52 | Ga0070663_100038861 | 3300005455 | Bacteria | 3322 |
| 53 | Ga0070663_100145095 | 3300005455 | Bacteria | 1815 |
| 54 | Ga0070678_100174090 | 3300005456 | Bacteria | 1756 |
| 55 | Ga0070662_100107414 | 3300005457 | Bacteria | 2122 |
| 56 | Ga0070662_100225242 | 3300005457 | Bacteria | 1498 |
| 57 | Ga0070681_10028847 | 3300005458 | Bacteria | 5576 |
| 58 | Ga0070681_10090746 | 3300005458 | Bacteria | 3005 |
| 59 | Ga0070681_10142988 | 3300005458 | Bacteria | 2322 |
| 60 | Ga0070685_10003366 | 3300005466 | Bacteria | 8135 |
| 61 | Ga0070699_100303955 | 3300005518 | Bacteria | 1431 |
| 62 | Ga0070699_100772055 | 3300005518 | Bacteria | 879 |
| 63 | Ga0070679_100023809 | 3300005530 | Bacteria | 5999 |
| 64 | Ga0070679_100233505 | 3300005530 | Bacteria | 1798 |
| 65 | Ga0070686_100022671 | 3300005544 | Bacteria | 3744 |
| 66 | Ga0070695_100002744 | 3300005545 | Bacteria | 10208 |
| 67 | Ga0070695_100123514 | 3300005545 | Bacteria | 1775 |
| 68 | Ga0070695_100284146 | 3300005545 | Bacteria | 1217 |
| 69 | Ga0070696_100006859 | 3300005546 | Bacteria | 7600 |
| 70 | Ga0070696_100010689 | 3300005546 | Bacteria | 6149 |
| 71 | Ga0070696_100077142 | 3300005546 | Bacteria | 2354 |
| 72 | Ga0070693_100032265 | 3300005547 | Bacteria | 2879 |
| 73 | Ga0070665_100013778 | 3300005548 | Bacteria | 8135 |
| 74 | Ga0070665_100517707 | 3300005548 | Bacteria | 1204 |
| 75 | Ga0070704_100490021 | 3300005549 | Bacteria | 1065 |
| 76 | Ga0068855_100364916 | 3300005563 | Bacteria | 1588 |
| 77 | Ga0070664_100073324 | 3300005564 | Bacteria | 2937 |
| 78 | Ga0070664_100134166 | 3300005564 | Bacteria | 2176 |
| 79 | Ga0070664_100302826 | 3300005564 | Bacteria | 1445 |
| 80 | Ga0068856_100012857 | 3300005614 | Bacteria | 8101 |
| 81 | Ga0068856_100443432 | 3300005614 | Bacteria | 1319 |
| 82 | Ga0070702_100151314 | 3300005615 | Bacteria | 1490 |
| 83 | Ga0070702_100174959 | 3300005615 | Bacteria | 1399 |
| 84 | Ga0068852_100456388 | 3300005616 | Bacteria | 1266 |
| 85 | Ga0068852_100793125 | 3300005616 | Bacteria | 961 |
| 86 | Ga0068864_100262459 | 3300005618 | Bacteria | 1607 |
| 87 | Ga0068851_10136830 | 3300005834 | Unclassified | 1329 |
| 88 | Ga0068858_100066979 | 3300005842 | Bacteria | 3325 |
| 89 | Ga0068858_100204034 | 3300005842 | Bacteria | 1870 |
| 90 | Ga0068860_100173155 | 3300005843 | Bacteria | 2085 |
| 91 | Ga0068862_100107449 | 3300005844 | Bacteria | 2447 |
| 92 | Ga0081455_10000151 | 3300005937 | Bacteria | 83439 |
| 93 | Ga0081455_10003823 | 3300005937 | Bacteria | 17186 |
| 94 | Ga0081455_10062198 | 3300005937 | Bacteria | 3139 |
| 95 | Ga0081455_10146836 | 3300005937 | Bacteria | 1823 |
| 96 | Ga0081538_10045879 | 3300005981 | Bacteria | 2703 |
| 97 | Ga0081540_1004764 | 3300005983 | Bacteria | 10243 |
| 98 | Ga0081540_1040244 | 3300005983 | Bacteria | 2438 |
| 99 | Ga0081539_10000803 | 3300005985 | Bacteria | 61113 |
| 100 | Ga0070717_10000150 | 3300006028 | Bacteria | 51802 |
| 101 | Ga0070717_10011597 | 3300006028 | Bacteria | 6700 |
| 102 | Ga0075365_10039942 | 3300006038 | Bacteria | 3058 |
| 103 | Ga0075365_10084424 | 3300006038 | Bacteria | 2155 |
| 104 | Ga0075365_10228289 | 3300006038 | Bacteria | 1306 |
| 105 | Ga0075364_10011379 | 3300006051 | Bacteria | 5406 |
| 106 | Ga0075364_10037522 | 3300006051 | Bacteria | 3138 |
| 107 | Ga0075432_10000665 | 3300006058 | Bacteria | 10537 |
| 108 | Ga0070715_10000967 | 3300006163 | Bacteria | 8011 |
| 109 | Ga0070715_10014104 | 3300006163 | Bacteria | 2951 |
| 110 | Ga0070716_100043881 | 3300006173 | Bacteria | 2502 |
| 111 | Ga0070716_100313921 | 3300006173 | Bacteria | 1096 |
| 112 | Ga0070712_100004012 | 3300006175 | Bacteria | 9044 |
| 113 | Ga0070712_100047161 | 3300006175 | Bacteria | 2981 |
| 114 | Ga0070712_100105322 | 3300006175 | Bacteria | 2094 |
| 115 | Ga0070712_100139899 | 3300006175 | Bacteria | 1846 |
| 116 | Ga0070712_100320963 | 3300006175 | Bacteria | 1259 |
| 117 | Ga0070712_100404518 | 3300006175 | Bacteria | 1128 |
| 118 | Ga0075367_10081989 | 3300006178 | Bacteria | 1952 |
| 119 | Ga0075367_10179961 | 3300006178 | Bacteria | 1318 |
| 120 | Ga0075369_10001766 | 3300006186 | Bacteria | 7509 |
| 121 | Ga0075366_10027788 | 3300006195 | Bacteria | 3320 |
| 122 | Ga0075366_10097275 | 3300006195 | Bacteria | 1765 |
| 123 | Ga0097621_100074880 | 3300006237 | Bacteria | 2804 |
| 124 | Ga0068871_100103835 | 3300006358 | Bacteria | 2383 |
| 125 | Ga0075428_100003032 | 3300006844 | Bacteria | 18343 |
| 126 | Ga0075428_100016992 | 3300006844 | Bacteria | 8038 |
| 127 | Ga0075428_100091698 | 3300006844 | Bacteria | 3313 |
| 128 | Ga0075428_100117704 | 3300006844 | Unclassified | 2894 |
| 129 | Ga0075428_100209789 | 3300006844 | Bacteria | 2105 |
| 130 | Ga0075428_100519168 | 3300006844 | Bacteria | 1274 |
| 131 | Ga0075430_100000587 | 3300006846 | Bacteria | 27593 |
| 132 | Ga0075431_100008096 | 3300006847 | Bacteria | 10493 |
| 133 | Ga0075431_100042771 | 3300006847 | Bacteria | 4674 |
| 134 | Ga0075431_100166346 | 3300006847 | Bacteria | 2267 |
| 135 | Ga0075431_100172342 | 3300006847 | Bacteria | 2223 |
| 136 | Ga0075433_10000020 | 3300006852 | Bacteria | 61231 |
| 137 | Ga0075434_100164402 | 3300006871 | Bacteria | 2239 |
| 138 | Ga0075434_100170023 | 3300006871 | Bacteria | 2200 |
| 139 | Ga0075434_100423924 | 3300006871 | Bacteria | 1352 |
| 140 | Ga0075434_100449024 | 3300006871 | Bacteria | 1310 |
| 141 | Ga0075429_100001660 | 3300006880 | Bacteria | 18412 |
| 142 | Ga0075429_100246846 | 3300006880 | Bacteria | 1563 |
| 143 | Ga0075429_100604303 | 3300006880 | Bacteria | 961 |
| 144 | Ga0075436_100221484 | 3300006914 | Unclassified | 1343 |
| 145 | Ga0079104_1000010 | 3300006946 | Bacteria | 366021 |
| 146 | Ga0075435_100097104 | 3300007076 | Bacteria | 2438 |
| 147 | Ga0099794_10004996 | 3300007265 | Bacteria | 5280 |
| 148 | Ga0099795_10016233 | 3300007788 | Bacteria | 2351 |
| 149 | Ga0105251_10106778 | 3300009011 | Bacteria | 1278 |
| 150 | Ga0105240_10313559 | 3300009093 | Bacteria | 1790 |
| 151 | Ga0111539_10000373 | 3300009094 | Bacteria | 55466 |
| 152 | Ga0111539_10014430 | 3300009094 | Bacteria | 9860 |
| 153 | Ga0111539_10056564 | 3300009094 | Bacteria | 4661 |
| 154 | Ga0111539_10779354 | 3300009094 | Bacteria | 1113 |
| 155 | Ga0105245_10103130 | 3300009098 | Bacteria | 2642 |
| 156 | Ga0105245_10165695 | 3300009098 | Bacteria | 2101 |
| 157 | Ga0105247_10017947 | 3300009101 | Bacteria | 4245 |
| 158 | Ga0105247_10032174 | 3300009101 | Bacteria | 3187 |
| 159 | Ga0105247_10079479 | 3300009101 | Bacteria | 2064 |
| 160 | Ga0114129_10008524 | 3300009147 | Bacteria | 14611 |
| 161 | Ga0114129_10063256 | 3300009147 | Bacteria | 5168 |
| 162 | Ga0114129_10138946 | 3300009147 | Bacteria | 3332 |
| 163 | Ga0105243_10015381 | 3300009148 | Bacteria | 5787 |
| 164 | Ga0105243_10105133 | 3300009148 | Bacteria | 2351 |
| 165 | Ga0105241_10103883 | 3300009174 | Bacteria | 2263 |
| 166 | Ga0105242_10029702 | 3300009176 | Bacteria | 4360 |
| 167 | Ga0105242_10190895 | 3300009176 | Bacteria | 1813 |
| 168 | Ga0105242_10241245 | 3300009176 | Bacteria | 1625 |
| 169 | Ga0105248_10027809 | 3300009177 | Bacteria | 6295 |
| 170 | Ga0105248_10030287 | 3300009177 | Bacteria | 6042 |
| 171 | Ga0105237_10057439 | 3300009545 | Bacteria | 3895 |
| 172 | Ga0105237_10232450 | 3300009545 | Bacteria | 1844 |
| 173 | Ga0105238_10113365 | 3300009551 | Bacteria | 2691 |
| 174 | Ga0105249_10037876 | 3300009553 | Bacteria | 4376 |
| 175 | Ga0105249_10056111 | 3300009553 | Bacteria | 3606 |
| 176 | Ga0105239_10117853 | 3300010375 | Bacteria | 2947 |
| 177 | Ga0105239_10189397 | 3300010375 | Bacteria | 2303 |
| 178 | Ga0105239_10206762 | 3300010375 | Bacteria | 2200 |
| 179 | Ga0105246_10131138 | 3300011119 | Bacteria | 1873 |
| 180 | Ga0105246_10185335 | 3300011119 | Bacteria | 1606 |
| 181 | Ga0157373_10002050 | 3300013100 | Bacteria | 15264 |
| 182 | Ga0157373_10199073 | 3300013100 | Bacteria | 1412 |
| 183 | Ga0157371_10000380 | 3300013102 | Bacteria | 55836 |
| 184 | Ga0157371_10029143 | 3300013102 | Bacteria | 3995 |
| 185 | Ga0157370_10000748 | 3300013104 | Bacteria | 40596 |
| 186 | Ga0157370_10290289 | 3300013104 | Unclassified | 1511 |
| 187 | Ga0157370_10616500 | 3300013104 | Unclassified | 993 |
| 188 | Ga0157369_10030046 | 3300013105 | Bacteria | 5996 |
| 189 | Ga0157369_10136236 | 3300013105 | Bacteria | 2599 |
| 190 | Ga0157369_10785478 | 3300013105 | Bacteria | 979 |
| 191 | Ga0157374_10051951 | 3300013296 | Bacteria | 3815 |
| 192 | Ga0157374_10866535 | 3300013296 | Bacteria | 920 |
| 193 | Ga0157378_10096546 | 3300013297 | Bacteria | 2693 |
| 194 | Ga0163162_10142571 | 3300013306 | Bacteria | 2510 |
| 195 | Ga0157372_10248405 | 3300013307 | Bacteria | 2065 |
| 196 | Ga0157372_10455554 | 3300013307 | Bacteria | 1491 |
| 197 | Ga0163163_10006448 | 3300014325 | Bacteria | 10262 |
| 198 | Ga0163163_10017610 | 3300014325 | Bacteria | 6668 |
| 199 | Ga0157380_10181281 | 3300014326 | Bacteria | 1850 |
| 200 | Ga0157377_10044714 | 3300014745 | Bacteria | 2470 |
| 201 | Ga0157379_10018740 | 3300014968 | Bacteria | 6104 |
| 202 | Ga0157379_10037217 | 3300014968 | Bacteria | 4338 |
| 203 | Ga0157376_10064616 | 3300014969 | Bacteria | 3087 |
| 204 | Ga0163161_10066517 | 3300017792 | Bacteria | 2632 |
| 205 | Ga0163161_10265282 | 3300017792 | Bacteria | 1342 |
| 206 | Ga0163161_10395886 | 3300017792 | Bacteria | 1107 |
| 207 | Ga0209025_1000074 | 3300025294 | Bacteria | 277445 |
| 208 | Ga0209025_1000080 | 3300025294 | Bacteria | 267244 |
| 209 | Ga0209758_1000223 | 3300025297 | Bacteria | 122584 |
| 210 | Ga0209758_1002322 | 3300025297 | Bacteria | 19664 |
| 211 | Ga0209758_1011638 | 3300025297 | Bacteria | 5063 |
| 212 | Ga0209050_1015422 | 3300025298 | Bacteria | 3212 |
| 213 | Ga0209051_1002851 | 3300025303 | Bacteria | 11913 |
| 214 | Ga0209257_1002587 | 3300025304 | Bacteria | 17594 |
| 215 | Ga0207653_10005827 | 3300025885 | Bacteria | 3845 |
| 216 | Ga0207692_10011833 | 3300025898 | Bacteria | 3729 |
| 217 | Ga0207692_10020246 | 3300025898 | Bacteria | 3022 |
| 218 | Ga0207692_10045206 | 3300025898 | Bacteria | 2201 |
| 219 | Ga0207692_10109771 | 3300025898 | Bacteria | 1528 |
| 220 | Ga0207710_10026292 | 3300025900 | Bacteria | 2514 |
| 221 | Ga0207688_10141195 | 3300025901 | Bacteria | 1418 |
| 222 | Ga0207680_10205830 | 3300025903 | Bacteria | 1343 |
| 223 | Ga0207647_10278634 | 3300025904 | Bacteria | 955 |
| 224 | Ga0207685_10008065 | 3300025905 | Bacteria | 2977 |
| 225 | Ga0207685_10012920 | 3300025905 | Bacteria | 2566 |
| 226 | Ga0207685_10079496 | 3300025905 | Bacteria | 1353 |
| 227 | Ga0207699_10005642 | 3300025906 | Bacteria | 6007 |
| 228 | Ga0207699_10039047 | 3300025906 | Bacteria | 2725 |
| 229 | Ga0207699_10176664 | 3300025906 | Bacteria | 1432 |
| 230 | Ga0207645_10127926 | 3300025907 | Bacteria | 1652 |
| 231 | Ga0207654_10022166 | 3300025911 | Bacteria | 3385 |
| 232 | Ga0207654_10040799 | 3300025911 | Bacteria | 2617 |
| 233 | Ga0207707_10003237 | 3300025912 | Bacteria | 14459 |
| 234 | Ga0207671_10062226 | 3300025914 | Bacteria | 2771 |
| 235 | Ga0207671_10219058 | 3300025914 | Bacteria | 1491 |
| 236 | Ga0207693_10001763 | 3300025915 | Bacteria | 18986 |
| 237 | Ga0207693_10009968 | 3300025915 | Bacteria | 7724 |
| 238 | Ga0207693_10011822 | 3300025915 | Bacteria | 7055 |
| 239 | Ga0207693_10085574 | 3300025915 | Bacteria | 2469 |
| 240 | Ga0207693_10123504 | 3300025915 | Bacteria | 2034 |
| 241 | Ga0207693_10124056 | 3300025915 | Bacteria | 2029 |
| 242 | Ga0207693_10308975 | 3300025915 | Bacteria | 1238 |
| 243 | Ga0207663_10008055 | 3300025916 | Bacteria | 5491 |
| 244 | Ga0207663_10033763 | 3300025916 | Bacteria | 3052 |
| 245 | Ga0207663_10039065 | 3300025916 | Bacteria | 2873 |
| 246 | Ga0207663_10060283 | 3300025916 | Bacteria | 2404 |
| 247 | Ga0207660_10017175 | 3300025917 | Bacteria | 4802 |
| 248 | Ga0207660_10142108 | 3300025917 | Bacteria | 1836 |
| 249 | Ga0207657_10059369 | 3300025919 | Bacteria | 3287 |
| 250 | Ga0207652_10168272 | 3300025921 | Bacteria | 1966 |
| 251 | Ga0207652_10349028 | 3300025921 | Bacteria | 1335 |
| 252 | Ga0207652_10469094 | 3300025921 | Bacteria | 1134 |
| 253 | Ga0207694_10037464 | 3300025924 | Bacteria | 3725 |
| 254 | Ga0207687_10040092 | 3300025927 | Bacteria | 3209 |
| 255 | Ga0207687_10134032 | 3300025927 | Bacteria | 1871 |
| 256 | Ga0207700_10027048 | 3300025928 | Bacteria | 4010 |
| 257 | Ga0207700_10049864 | 3300025928 | Bacteria | 3116 |
| 258 | Ga0207700_10054575 | 3300025928 | Bacteria | 3000 |
| 259 | Ga0207664_10033634 | 3300025929 | Bacteria | 3941 |
| 260 | Ga0207664_10059208 | 3300025929 | Bacteria | 3049 |
| 261 | Ga0207664_10065036 | 3300025929 | Bacteria | 2919 |
| 262 | Ga0207664_10145653 | 3300025929 | Bacteria | 2008 |
| 263 | Ga0207664_10282550 | 3300025929 | Unclassified | 1456 |
| 264 | Ga0207664_10393264 | 3300025929 | Bacteria | 1232 |
| 265 | Ga0207690_10032375 | 3300025932 | Bacteria | 3355 |
| 266 | Ga0207706_10017172 | 3300025933 | Bacteria | 6526 |
| 267 | Ga0207686_10185336 | 3300025934 | Unclassified | 1479 |
| 268 | Ga0207704_10040421 | 3300025938 | Bacteria | 2726 |
| 269 | Ga0207665_10000228 | 3300025939 | Bacteria | 38348 |
| 270 | Ga0207665_10002785 | 3300025939 | Bacteria | 11719 |
| 271 | Ga0207665_10038422 | 3300025939 | Bacteria | 3187 |
| 272 | Ga0207665_10096091 | 3300025939 | Bacteria | 2060 |
| 273 | Ga0207665_10333274 | 3300025939 | Bacteria | 1142 |
| 274 | Ga0207691_10188433 | 3300025940 | Bacteria | 1800 |
| 275 | Ga0207711_10044811 | 3300025941 | Bacteria | 3778 |
| 276 | Ga0207711_10101378 | 3300025941 | Bacteria | 2548 |
| 277 | Ga0207689_10077955 | 3300025942 | Bacteria | 2723 |
| 278 | Ga0207661_10045706 | 3300025944 | Bacteria | 3468 |
| 279 | Ga0207661_10381646 | 3300025944 | Bacteria | 1275 |
| 280 | Ga0207679_10050621 | 3300025945 | Bacteria | 3036 |
| 281 | Ga0207679_10077869 | 3300025945 | Bacteria | 2524 |
| 282 | Ga0207679_10252622 | 3300025945 | Bacteria | 1500 |
| 283 | Ga0207667_10053509 | 3300025949 | Bacteria | 4248 |
| 284 | Ga0207712_10073594 | 3300025961 | Bacteria | 2465 |
| 285 | Ga0207712_10436686 | 3300025961 | Bacteria | 1107 |
| 286 | Ga0207668_10148064 | 3300025972 | Bacteria | 1814 |
| 287 | Ga0207703_10177238 | 3300026035 | Bacteria | 1879 |
| 288 | Ga0207703_10276456 | 3300026035 | Bacteria | 1523 |
| 289 | Ga0207703_10322309 | 3300026035 | Bacteria | 1415 |
| 290 | Ga0207678_10013871 | 3300026067 | Bacteria | 7079 |
| 291 | Ga0207678_10078763 | 3300026067 | Bacteria | 2822 |
| 292 | Ga0207708_10040934 | 3300026075 | Bacteria | 3534 |
| 293 | Ga0207708_10143143 | 3300026075 | Bacteria | 1877 |
| 294 | Ga0207702_10007306 | 3300026078 | Bacteria | 9443 |
| 295 | Ga0207676_10039983 | 3300026095 | Bacteria | 3591 |
| 296 | Ga0207676_10245298 | 3300026095 | Bacteria | 1609 |
| 297 | Ga0207675_100243518 | 3300026118 | Bacteria | 1738 |
| 298 | Ga0207683_10020028 | 3300026121 | Bacteria | 5717 |
| 299 | Ga0207683_10241618 | 3300026121 | Bacteria | 1647 |
| 300 | Ga0207698_10562599 | 3300026142 | Bacteria | 1119 |
| 301 | Ga0209281_1000078 | 3300027111 | Bacteria | 261622 |
| 302 | Ga0209179_1002629 | 3300027512 | Bacteria | 2462 |
| 303 | Ga0209998_10004731 | 3300027717 | Bacteria | 2878 |
| 304 | Ga0209974_10011673 | 3300027876 | Bacteria | 2947 |
| 305 | Ga0209974_10057892 | 3300027876 | Bacteria | 1309 |
| 306 | Ga0207428_10000172 | 3300027907 | Bacteria | 90200 |
| 307 | Ga0207428_10021624 | 3300027907 | Bacteria | 5443 |
| 308 | Ga0207428_10084354 | 3300027907 | Bacteria | 2476 |
| 309 | Ga0268266_10002687 | 3300028379 | Bacteria | 18670 |
| 310 | Ga0268266_10747861 | 3300028379 | Bacteria | 943 |
| 311 | Ga0316181_1162723 | 3300030744 | Bacteria | 5107 |
| 312 | Ga0265332_10006577 | 3300031238 | Bacteria | 5270 |
| 313 | Ga0265332_10007158 | 3300031238 | Bacteria | 5053 |
| 314 | Ga0265325_10039642 | 3300031241 | Bacteria | 2479 |
| 315 | Ga0265329_10017186 | 3300031242 | Bacteria | 2494 |
| 316 | Ga0265340_10002525 | 3300031247 | Bacteria | 10395 |
| 317 | Ga0307408_100121415 | 3300031548 | Bacteria | 2025 |
| 318 | Ga0265314_10001423 | 3300031711 | Bacteria | 26797 |
| 319 | Ga0265342_10000039 | 3300031712 | Bacteria | 140091 |
| 320 | Ga0307412_10167717 | 3300031911 | Bacteria | 1639 |
| 321 | Ga0307412_10294627 | 3300031911 | Bacteria | 1279 |
| 322 | Ga0307409_100232069 | 3300031995 | Bacteria | 1674 |
| 323 | Ga0373958_0007804 | 3300034819 | Bacteria | 1716 |
| 324 | Ga0373938_0007040 | 3300034957 | Bacteria | 1967 |
| 325 | Ga0373926_0102193 | 3300035083 | Bacteria | 1072 |
| 326 | Ga0373934_0005408 | 3300035086 | Bacteria | 4730 |
| 327 | Ga0373940_0040445 | 3300035088 | Unclassified | 1280 |
| 328 | Ga0373949_0015114 | 3300035090 | Bacteria | 1722 |
| 329 | Ga0373923_0006894 | 3300035111 | Bacteria | 3960 |
| 330 | Ga0373923_0032595 | 3300035111 | Bacteria | 2105 |
| 331 | Ga0373932_0012530 | 3300035112 | Bacteria | 2089 |
| 332 | Ga0373936_0001699 | 3300035113 | Bacteria | 8079 |
| 333 | Ga0373939_0020751 | 3300035114 | Bacteria | 1790 |
| 334 | Ga0373945_0006895 | 3300035116 | Bacteria | 3673 |
| 335 | Ga0373953_0030324 | 3300035117 | Bacteria | 2096 |
| 336 | Ga0373954_0000751 | 3300035118 | Bacteria | 12539 |
| 337 | Ga0373954_0219689 | 3300035118 | Bacteria | 935 |
| 338 | Ga0373956_0043891 | 3300035119 | Bacteria | 1991 |
| 339 | Ga0373956_0079853 | 3300035119 | Bacteria | 1500 |
| 340 | Ga0373957_0000733 | 3300035120 | Bacteria | 8526 |
| 341 | Ga0373960_0009997 | 3300035121 | Bacteria | 2310 |
| 342 | Ga0373943_0004643 | 3300035170 | Bacteria | 6213 |
| 343 | Ga0373943_0008319 | 3300035170 | Bacteria | 4656 |
| 344 | Ga0373943_0030335 | 3300035170 | Bacteria | 2558 |
| 345 | Ga0373943_0031188 | 3300035170 | Bacteria | 2527 |
| 346 | Ga0373946_0006737 | 3300035171 | Bacteria | 4174 |
| 347 | Ga0373946_0007033 | 3300035171 | Bacteria | 4103 |
| 348 | Ga0373946_0019295 | 3300035171 | Bacteria | 2627 |
| 349 | Ga0373946_0089667 | 3300035171 | Bacteria | 1360 |
| 350 | Ga0373955_0276130 | 3300035172 | Bacteria | 1010 |
| 351 | Ga0373962_0014481 | 3300035242 | Bacteria | 2010 |
| 352 | Ga0373924_0041422 | 3300035410 | Bacteria | 1887 |
| 353 | Ga0373935_0000086 | 3300035692 | Bacteria | 40589 |
| 354 | Ga0373935_0170460 | 3300035692 | Bacteria | 1489 |
| 355 | Ga0373935_0300658 | 3300035692 | Bacteria | 1134 |
| 356 | Ga0373927_0060680 | 3300035695 | Bacteria | 2447 |
| 357 | Ga0373927_0077816 | 3300035695 | Bacteria | 2148 |
| 358 | Ga0373933_0002170 | 3300035724 | Bacteria | 11232 |
| 359 | Ga0373933_0006542 | 3300035724 | Bacteria | 6349 |
| 360 | Ga0373947_0000096 | 3300035725 | Bacteria | 44841 |
| 361 | Ga0373947_0031816 | 3300035725 | Bacteria | 3107 |
| 362 | Ga0373937_0000198 | 3300036401 | Bacteria | 59112 |
| 363 | Ga0373937_0003016 | 3300036401 | Bacteria | 14120 |
| 364 | Ga0373937_0107061 | 3300036401 | Bacteria | 2599 |
| 365 | Ga0373937_0179690 | 3300036401 | Bacteria | 1987 |
| 366 | Ga0373925_0000071 | 3300037068 | Bacteria | 106825 |
| 367 | Ga0373925_0029022 | 3300037068 | Bacteria | 4057 |
| 368 | Ga0373925_0160375 | 3300037068 | Bacteria | 1771 |
| 369 | Ga0373925_0195231 | 3300037068 | Bacteria | 1608 |
| 370 | Ga0395900_0121087 | 3300037418 | Bacteria | 2684 |
| 371 | Ga0395898_0059476 | 3300037466 | Bacteria | 3717 |
| 372 | Ga0395901_0195724 | 3300038443 | Bacteria | 2120 |
| 373 | Ga0436361_0769631 | 3300039447 | Bacteria | 2825 |
| 374 | Ga0436362_1062509 | 3300039453 | Bacteria | 1062 |
| 375 | Ga0451577_0001529 | 3300042876 | Bacteria | 30377 |
| 376 | Ga0451577_0001601 | 3300042876 | Bacteria | 29482 |
| 377 | Ga0466963_0104050 | 3300044694 | Bacteria | 1945 |
| 378 | Ga0466957_0026026 | 3300044842 | Bacteria | 3470 |
| 379 | Ga0495592_0000117 | 3300046454 | Bacteria | 69975 |
| 380 | Ga0495592_0000943 | 3300046454 | Bacteria | 20225 |
| 381 | Ga0495603_0033207 | 3300046455 | Bacteria | 3105 |
| 382 | Ga0495629_0001744 | 3300046459 | Bacteria | 17057 |
| 383 | Ga0495629_0005598 | 3300046459 | Bacteria | 9380 |
| 384 | Ga0495629_0036632 | 3300046459 | Bacteria | 3461 |
| 385 | Ga0495629_0159976 | 3300046459 | Bacteria | 1564 |
| 386 | Ga0495638_0010059 | 3300046460 | Bacteria | 6593 |
| 387 | Ga0495641_0020639 | 3300046461 | Bacteria | 3335 |
| 388 | Ga0495641_0030621 | 3300046461 | Bacteria | 2578 |
| 389 | Ga0495641_0032809 | 3300046461 | Bacteria | 2469 |
| 390 | Ga0495651_0000370 | 3300046462 | Bacteria | 34672 |
| 391 | Ga0495651_0003262 | 3300046462 | Bacteria | 12453 |
| 392 | Ga0495653_0000047 | 3300046463 | Bacteria | 111093 |
| 393 | Ga0495653_0007752 | 3300046463 | Bacteria | 8787 |
| 394 | Ga0495653_0132873 | 3300046463 | Bacteria | 1759 |
| 395 | Ga0495580_0307465 | 3300046472 | Bacteria | 1079 |
| 396 | Ga0495582_0055230 | 3300046473 | Bacteria | 2189 |
| 397 | Ga0495605_0105778 | 3300046474 | Bacteria | 1289 |
| 398 | Ga0495662_0060585 | 3300046476 | Bacteria | 1828 |
| 399 | Ga0495662_0096788 | 3300046476 | Bacteria | 1442 |
| 400 | Ga0495664_0000024 | 3300046477 | Bacteria | 126593 |
| 401 | Ga0495664_0042800 | 3300046477 | Bacteria | 2684 |
| 402 | Ga0495664_0125858 | 3300046477 | Bacteria | 1550 |
| 403 | Ga0495584_0023830 | 3300046491 | Bacteria | 3103 |
| 404 | Ga0495584_0120977 | 3300046491 | Bacteria | 1326 |
| 405 | Ga0495594_0022620 | 3300046499 | Bacteria | 3363 |
| 406 | Ga0495608_0000004 | 3300046511 | Bacteria | 355027 |
| 407 | Ga0495608_0002716 | 3300046511 | Bacteria | 12715 |
| 408 | Ga0495608_0070198 | 3300046511 | Bacteria | 2286 |
| 409 | Ga0495618_0000036 | 3300046514 | Bacteria | 101535 |
| 410 | Ga0495618_0009781 | 3300046514 | Bacteria | 5795 |
| 411 | Ga0495628_0000006 | 3300046516 | Bacteria | 306606 |
| 412 | Ga0495628_0011899 | 3300046516 | Bacteria | 7336 |
| 413 | Ga0495628_0136219 | 3300046516 | Bacteria | 1877 |
| 414 | Ga0495630_0000647 | 3300046517 | Bacteria | 25227 |
| 415 | Ga0495648_0151478 | 3300046524 | Bacteria | 1209 |
| 416 | Ga0495652_0000038 | 3300046529 | Bacteria | 129311 |
| 417 | Ga0495652_0017333 | 3300046529 | Bacteria | 6428 |
| 418 | Ga0495652_0021127 | 3300046529 | Bacteria | 5786 |
| 419 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 420 | Ga0495640_0102422 | 3300046533 | Bacteria | 1878 |
| 421 | Ga0495640_0216039 | 3300046533 | Bacteria | 1210 |
| 422 | Ga0495586_0028908 | 3300046535 | Unclassified | 2967 |
| 423 | Ga0495587_0000004 | 3300046536 | Bacteria | 358433 |
| 424 | Ga0495587_0002288 | 3300046536 | Bacteria | 12837 |
| 425 | Ga0495587_0019457 | 3300046536 | Bacteria | 4201 |
| 426 | Ga0495621_0040224 | 3300046539 | Bacteria | 1638 |
| 427 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 428 | Ga0495645_0003108 | 3300046543 | Bacteria | 11252 |
| 429 | Ga0495645_0045961 | 3300046543 | Bacteria | 3184 |
| 430 | Ga0495633_0135242 | 3300046558 | Bacteria | 1140 |
| 431 | Ga0495667_0000093 | 3300046559 | Bacteria | 65066 |
| 432 | Ga0495667_0006750 | 3300046559 | Bacteria | 7789 |
| 433 | Ga0495667_0037960 | 3300046559 | Bacteria | 3209 |
| 434 | Ga0495667_0148309 | 3300046559 | Bacteria | 1511 |
| 435 | Ga0495668_0175491 | 3300046616 | Bacteria | 1174 |
| 436 | Ga0495634_0000133 | 3300046642 | Bacteria | 64326 |
| 437 | Ga0495634_0081646 | 3300046642 | Bacteria | 2114 |
| 438 | Ga0495635_0000003 | 3300046663 | Bacteria | 390055 |
| 439 | Ga0495635_0004663 | 3300046663 | Bacteria | 9518 |
| 440 | Ga0495635_0242349 | 3300046663 | Unclassified | 1216 |
| 441 | Ga0495657_0000143 | 3300046675 | Bacteria | 64334 |
| 442 | Ga0495657_0001806 | 3300046675 | Bacteria | 18302 |
| 443 | Ga0495599_0000012 | 3300046678 | Bacteria | 181156 |
| 444 | Ga0495599_0013037 | 3300046678 | Bacteria | 5131 |
| 445 | Ga0495599_0177450 | 3300046678 | Bacteria | 1313 |
| 446 | Ga0495623_0000015 | 3300046679 | Bacteria | 117329 |
| 447 | Ga0495623_0005760 | 3300046679 | Bacteria | 8083 |
| 448 | Ga0495623_0058642 | 3300046679 | Bacteria | 2420 |
| 449 | Ga0495646_0000005 | 3300046680 | Bacteria | 266899 |
| 450 | Ga0495646_0005112 | 3300046680 | Bacteria | 8274 |
| 451 | Ga0495646_0007322 | 3300046680 | Bacteria | 7012 |
| 452 | Ga0495647_0017761 | 3300046681 | Bacteria | 2522 |
| 453 | Ga0495647_0057890 | 3300046681 | Bacteria | 1522 |
| 454 | Ga0495647_0074544 | 3300046681 | Bacteria | 1364 |
| 455 | Ga0495658_0001024 | 3300046683 | Bacteria | 14792 |
| 456 | Ga0495658_0025664 | 3300046683 | Bacteria | 3152 |
| 457 | Ga0495613_0046067 | 3300046689 | Bacteria | 3225 |
| 458 | Ga0495613_0049291 | 3300046689 | Bacteria | 3108 |
| 459 | Ga0495600_0000051 | 3300046809 | Bacteria | 69572 |
| 460 | Ga0495581_0019002 | 3300047315 | Bacteria | 3988 |
| 461 | Ga0495581_0024892 | 3300047315 | Bacteria | 3467 |
| 462 | Ga0495581_0029576 | 3300047315 | Bacteria | 3175 |
| 463 | Ga0495604_0000002 | 3300047317 | Bacteria | 530904 |
| 464 | Ga0495604_0003703 | 3300047317 | Bacteria | 12176 |
| 465 | Ga0495604_0010136 | 3300047317 | Bacteria | 7463 |
| 466 | Ga0495674_0000004 | 3300047319 | Bacteria | 531855 |
| 467 | Ga0495674_0010801 | 3300047319 | Bacteria | 8640 |
| 468 | Ga0495676_0089159 | 3300047321 | Bacteria | 2311 |
| 469 | Ga0495680_0000142 | 3300047322 | Bacteria | 72324 |
| 470 | Ga0495680_0014220 | 3300047322 | Bacteria | 6902 |
| 471 | Ga0495680_0021842 | 3300047322 | Bacteria | 5348 |
| 472 | Ga0495680_0183953 | 3300047322 | Bacteria | 1507 |
| 473 | Ga0495675_0000824 | 3300047444 | Bacteria | 19028 |
| 474 | Ga0495675_0003237 | 3300047444 | Bacteria | 9783 |
| 475 | Ga0495675_0058797 | 3300047444 | Bacteria | 2437 |
| 476 | Ga0495681_0012100 | 3300047470 | Bacteria | 5086 |
| 477 | Ga0495684_0000004 | 3300047471 | Bacteria | 307093 |
| 478 | Ga0495684_0342975 | 3300047471 | Bacteria | 1063 |
| 479 | Ga0495593_0001806 | 3300047673 | Bacteria | 12722 |
| 480 | Ga0495593_0017478 | 3300047673 | Bacteria | 4037 |
| 481 | Ga0495593_0071411 | 3300047673 | Bacteria | 1803 |
| 482 | Ga0495602_0000001 | 3300048088 | Bacteria | 510904 |
| 483 | Ga0496100_0002959 | 3300048903 | Bacteria | 8738 |
| 484 | Ga0496100_0006229 | 3300048903 | Bacteria | 6491 |
| 485 | Ga0496100_0036518 | 3300048903 | Bacteria | 3100 |
| 486 | Ga0496100_0060962 | 3300048903 | Bacteria | 2484 |
| 487 | Ga0496100_0158471 | 3300048903 | Bacteria | 1621 |
| 488 | Ga0496101_0014991 | 3300048904 | Bacteria | 5216 |
| 489 | Ga0496102_0017001 | 3300048905 | Bacteria | 6366 |
| 490 | Ga0496102_0069464 | 3300048905 | Bacteria | 3233 |
| 491 | Ga0496102_0124729 | 3300048905 | Bacteria | 2406 |
| 492 | Ga0496102_0331359 | 3300048905 | Bacteria | 1434 |
| 493 | Ga0496102_0481462 | 3300048905 | Unclassified | 1162 |
| 494 | Ga0496102_0504132 | 3300048905 | Unclassified | 1132 |
| 495 | Ga0496103_0011009 | 3300048906 | Bacteria | 5353 |
| 496 | Ga0496103_0047686 | 3300048906 | Bacteria | 2647 |
| 497 | Ga0496104_0002463 | 3300048907 | Bacteria | 15951 |
| 498 | Ga0496104_0009345 | 3300048907 | Bacteria | 8719 |
| 499 | Ga0496104_0080605 | 3300048907 | Bacteria | 3104 |
| 500 | Ga0496104_0080731 | 3300048907 | Bacteria | 3101 |
| 501 | Ga0496104_0118279 | 3300048907 | Bacteria | 2544 |
| 502 | Ga0496105_0013402 | 3300048908 | Bacteria | 6506 |
| 503 | Ga0496105_0114632 | 3300048908 | Bacteria | 2223 |
| 504 | Ga0496105_0120826 | 3300048908 | Bacteria | 2160 |
| 505 | Ga0496105_0232910 | 3300048908 | Bacteria | 1496 |
| 506 | Ga0496105_0475106 | 3300048908 | Bacteria | 984 |
| 507 | Ga0496106_0027990 | 3300048909 | Bacteria | 4196 |
| 508 | Ga0496106_0058742 | 3300048909 | Bacteria | 2912 |
| 509 | Ga0496106_0319434 | 3300048909 | Bacteria | 1246 |
| 510 | Ga0496107_0012187 | 3300048910 | Bacteria | 5999 |
| 511 | Ga0496107_0013954 | 3300048910 | Bacteria | 5621 |
| 512 | Ga0496107_0016975 | 3300048910 | Bacteria | 5118 |
| 513 | Ga0496108_0000521 | 3300048911 | Bacteria | 30116 |
| 514 | Ga0496108_0003119 | 3300048911 | Bacteria | 13326 |
| 515 | Ga0496108_0003202 | 3300048911 | Bacteria | 13163 |
| 516 | Ga0496108_0016735 | 3300048911 | Bacteria | 5990 |
| 517 | Ga0496108_0122586 | 3300048911 | Bacteria | 2230 |
| 518 | Ga0496109_0000193 | 3300048912 | Bacteria | 60451 |
| 519 | Ga0496109_0003221 | 3300048912 | Bacteria | 13593 |
| 520 | Ga0496109_0004187 | 3300048912 | Bacteria | 12035 |
| 521 | Ga0496109_0107421 | 3300048912 | Bacteria | 2592 |
| 522 | Ga0496109_0534957 | 3300048912 | Bacteria | 1106 |
| 523 | Ga0496110_0000441 | 3300048913 | Bacteria | 28247 |
| 524 | Ga0496110_0003067 | 3300048913 | Bacteria | 12664 |
| 525 | Ga0496110_0013165 | 3300048913 | Bacteria | 6830 |
| 526 | Ga0496110_0072267 | 3300048913 | Bacteria | 3060 |
| 527 | Ga0496110_0097488 | 3300048913 | Bacteria | 2634 |
| 528 | Ga0496110_0166576 | 3300048913 | Bacteria | 1998 |
| 529 | Ga0496110_0273469 | 3300048913 | Bacteria | 1538 |
| 530 | Ga0496111_0009662 | 3300048914 | Bacteria | 6446 |
| 531 | Ga0496111_0013311 | 3300048914 | Bacteria | 5594 |
| 532 | Ga0496111_0017800 | 3300048914 | Bacteria | 4914 |
| 533 | Ga0496111_0036646 | 3300048914 | Bacteria | 3508 |
| 534 | Ga0496111_0064734 | 3300048914 | Bacteria | 2652 |
| 535 | Ga0496111_0168603 | 3300048914 | Bacteria | 1626 |
| 536 | Ga0496112_0005729 | 3300048915 | Bacteria | 10797 |
| 537 | Ga0496112_0012961 | 3300048915 | Bacteria | 7683 |
| 538 | Ga0496112_0017810 | 3300048915 | Bacteria | 6685 |
| 539 | Ga0496112_0043962 | 3300048915 | Bacteria | 4374 |
| 540 | Ga0496112_0180334 | 3300048915 | Bacteria | 2076 |
| 541 | Ga0496113_0000245 | 3300048916 | Bacteria | 25607 |
| 542 | Ga0496113_0001728 | 3300048916 | Bacteria | 12369 |
| 543 | Ga0496113_0146356 | 3300048916 | Bacteria | 1861 |
| 544 | Ga0496114_0003838 | 3300048917 | Bacteria | 11590 |
| 545 | Ga0496114_0043144 | 3300048917 | Bacteria | 3740 |
| 546 | Ga0496114_0227277 | 3300048917 | Bacteria | 1639 |
| 547 | Ga0496115_0010397 | 3300048918 | Bacteria | 6951 |
| 548 | Ga0496115_0014998 | 3300048918 | Bacteria | 5874 |
| 549 | Ga0496115_0177691 | 3300048918 | Bacteria | 1760 |
| 550 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 551 | Ga0496116_0080624 | 3300048919 | Bacteria | 2020 |
| 552 | Ga0496116_0108471 | 3300048919 | Bacteria | 1639 |
| 553 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 554 | Ga0496117_0008869 | 3300048920 | Bacteria | 9487 |
| 555 | Ga0496118_0000214 | 3300048921 | Bacteria | 100898 |
| 556 | Ga0496119_0033566 | 3300048922 | Bacteria | 3399 |
| 557 | Ga0496120_0000125 | 3300048923 | Bacteria | 128983 |
| 558 | Ga0496120_0012194 | 3300048923 | Bacteria | 5860 |
| 559 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 560 | Ga0496121_0011173 | 3300048924 | Bacteria | 10012 |
| 561 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 562 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 563 | Ga0496123_0047076 | 3300048926 | Bacteria | 2918 |
| 564 | Ga0496124_0007143 | 3300048927 | Bacteria | 11954 |
| 565 | Ga0496124_0041577 | 3300048927 | Bacteria | 3965 |
| 566 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 567 | Ga0496125_0000180 | 3300048928 | Bacteria | 138952 |
| 568 | Ga0496125_0041483 | 3300048928 | Bacteria | 3932 |
| 569 | Ga0496126_0000156 | 3300048929 | Bacteria | 158537 |
| 570 | Ga0496126_0059922 | 3300048929 | Bacteria | 3426 |
| 571 | Ga0496126_0204233 | 3300048929 | Bacteria | 1666 |
| 572 | Ga0496126_0209148 | 3300048929 | Bacteria | 1643 |
| 573 | Ga0501031_0221443 | 3300049568 | Bacteria | 1232 |
| 574 | Ga0501032_0097409 | 3300049569 | Bacteria | 1949 |
| 575 | Ga0501033_0017045 | 3300049570 | Bacteria | 5491 |
| 576 | Ga0501034_0224139 | 3300049571 | Bacteria | 1831 |
| 577 | Ga0501036_0036305 | 3300049572 | Bacteria | 4170 |
| 578 | Ga0501037_0032929 | 3300049573 | Bacteria | 3830 |
| 579 | Ga0501038_0089124 | 3300049574 | Bacteria | 2588 |
| 580 | Ga0501038_0115930 | 3300049574 | Bacteria | 2214 |
| 581 | Ga0501040_0027784 | 3300049576 | Bacteria | 3810 |
| 582 | Ga0501041_0018427 | 3300049577 | Bacteria | 4160 |
| 583 | Ga0501046_0015157 | 3300049580 | Bacteria | 6482 |
| 584 | Ga0501047_0009379 | 3300049581 | Bacteria | 9245 |
| 585 | Ga0501047_0051691 | 3300049581 | Bacteria | 3971 |
| 586 | Ga0501048_0038408 | 3300049582 | Bacteria | 3435 |
| 587 | Ga0501069_0349140 | 3300049585 | Bacteria | 872 |
| 588 | Ga0501070_0097021 | 3300049586 | Bacteria | 2438 |
| 589 | Ga0501070_0214492 | 3300049586 | Bacteria | 1579 |
| 590 | Ga0501070_0238294 | 3300049586 | Bacteria | 1489 |
| 591 | Ga0501071_0090756 | 3300049587 | Bacteria | 2244 |
| 592 | Ga0501072_0048616 | 3300049588 | Bacteria | 3340 |
| 593 | Ga0501072_0190718 | 3300049588 | Bacteria | 1635 |
| 594 | Ga0501075_0027496 | 3300049591 | Bacteria | 4192 |
| 595 | Ga0501075_0432990 | 3300049591 | Bacteria | 1003 |
| 596 | Ga0501076_0036224 | 3300049592 | Bacteria | 3865 |
| 597 | Ga0501080_0067192 | 3300049742 | Bacteria | 3334 |
| 598 | Ga0501080_0162688 | 3300049742 | Bacteria | 2061 |
| 599 | Ga0501081_0024033 | 3300049743 | Bacteria | 4089 |
| 600 | Ga0501081_0144577 | 3300049743 | Unclassified | 1706 |
| 601 | Ga0501081_0463943 | 3300049743 | Bacteria | 942 |
| 602 | Ga0501035_0016279 | 3300049822 | Bacteria | 6861 |
| 603 | Ga0501035_0129757 | 3300049822 | Bacteria | 2198 |
| 604 | Ga0501035_0245719 | 3300049822 | Bacteria | 1521 |
| 605 | Ga0501044_0016598 | 3300049823 | Bacteria | 7903 |
| 606 | Ga0501044_0091317 | 3300049823 | Bacteria | 3071 |
| 607 | Ga0501045_0000739 | 3300049824 | Bacteria | 20855 |
| 608 | Ga0501045_0363535 | 3300049824 | Bacteria | 1077 |
| 609 | nmdc:mga00v17_187_c1 | 3300050491 | Bacteria | 37112 |
| 610 | nmdc:mga00v17_21845_c1 | 3300050491 | Bacteria | 3685 |
| 611 | nmdc:mga00v17_45908_c1 | 3300050491 | Bacteria | 2641 |
| 612 | nmdc:mga0yw44_165052_c1 | 3300050492 | Bacteria | 1451 |
| 613 | nmdc:mga0yw44_2154_c1 | 3300050492 | Bacteria | 8264 |
| 614 | nmdc:mga0yw44_24154_c1 | 3300050492 | Bacteria | 3436 |
| 615 | nmdc:mga0yw44_2601_c1 | 3300050492 | Bacteria | 7754 |
| 616 | nmdc:mga06z11_83395_c1 | 3300050494 | Bacteria | 1720 |
| 617 | nmdc:mga07m45_155758_c1 | 3300050496 | Bacteria | 1325 |
| 618 | nmdc:mga05p37_102_c1 | 3300050507 | Bacteria | 69207 |
| 619 | nmdc:mga05p37_11802_c1 | 3300050507 | Bacteria | 5876 |
| 620 | nmdc:mga05p37_503256_c1 | 3300050507 | Bacteria | 1390 |
| 621 | nmdc:mga05p37_68171_c1 | 3300050507 | Bacteria | 4376 |
| 622 | nmdc:mga05p37_7504_c2 | 3300050507 | Bacteria | 5937 |
| 623 | nmdc:mga09592_235498_c1 | 3300050508 | Bacteria | 1586 |
| 624 | nmdc:mga09592_431646_c1 | 3300050508 | Bacteria | 1137 |
| 625 | nmdc:mga09592_433134_c1 | 3300050508 | Bacteria | 1135 |
| 626 | nmdc:mga09592_716_c1 | 3300050508 | Bacteria | 25471 |
| 627 | nmdc:mga0qj67_119_c1 | 3300050509 | Bacteria | 51910 |
| 628 | nmdc:mga0qj67_304759_c1 | 3300050509 | Bacteria | 1290 |
| 629 | nmdc:mga0qj67_7849_c1 | 3300050509 | Bacteria | 7883 |
| 630 | nmdc:mga06r32_14315_c1 | 3300050510 | Bacteria | 7196 |
| 631 | nmdc:mga06r32_203117_c1 | 3300050510 | Bacteria | 1969 |
| 632 | nmdc:mga06r32_265661_c1 | 3300050510 | Bacteria | 1703 |
| 633 | nmdc:mga06r32_2969_c1 | 3300050510 | Bacteria | 15197 |
| 634 | nmdc:mga06r32_320250_c1 | 3300050510 | Bacteria | 1536 |
| 635 | nmdc:mga06r32_36988_c1 | 3300050510 | Bacteria | 4618 |
| 636 | nmdc:mga06r32_80542_c1 | 3300050510 | Bacteria | 3169 |
| 637 | nmdc:mga08y16_26909_c1 | 3300050511 | Bacteria | 6061 |
| 638 | nmdc:mga08y16_2739_c1 | 3300050511 | Bacteria | 18063 |
| 639 | nmdc:mga0n895_15595_c1 | 3300050512 | Bacteria | 6935 |
| 640 | nmdc:mga0n895_56080_c1 | 3300050512 | Bacteria | 3881 |
| 641 | nmdc:mga0n895_56490_c2 | 3300050512 | Bacteria | 3188 |
| 642 | nmdc:mga0n895_57667_c1 | 3300050512 | Bacteria | 3828 |
| 643 | nmdc:mga0rr50_494_c1 | 3300050513 | Bacteria | 21000 |
| 644 | nmdc:mga0rr50_58336_c1 | 3300050513 | Bacteria | 2892 |
| 645 | nmdc:mga0rr50_683700_c1 | 3300050513 | Bacteria | 876 |
| 646 | nmdc:mga0rr50_72138_c1 | 3300050513 | Bacteria | 2636 |
| 647 | nmdc:mga08x19_200757_c1 | 3300050514 | Bacteria | 1367 |
| 648 | nmdc:mga0a205_4441_c1 | 3300050515 | Bacteria | 12596 |
| 649 | nmdc:mga0sz30_150_c1 | 3300050516 | Bacteria | 25823 |
| 650 | nmdc:mga0sz30_21896_c1 | 3300050516 | Bacteria | 2591 |
| 651 | Ga0495601_0000026 | 3300053077 | Bacteria | 126257 |
| 652 | Ga0495601_0006164 | 3300053077 | Bacteria | 6998 |
| 653 | Ga0495601_0028123 | 3300053077 | Bacteria | 3480 |
| 654 | Ga0495601_0088744 | 3300053077 | Bacteria | 1988 |
| 655 | Ga0495612_0000005 | 3300053078 | Bacteria | 286943 |
| 656 | Ga0495612_0002387 | 3300053078 | Bacteria | 7744 |
| 657 | Ga0495612_0005295 | 3300053078 | Bacteria | 5328 |
| 658 | Ga0495655_0061394 | 3300053083 | Bacteria | 1026 |
| 659 | Ga0495655_0062935 | 3300053083 | Bacteria | 1017 |
| 660 | Ga0495595_0000058 | 3300053084 | Bacteria | 57705 |
| 661 | Ga0495595_0023153 | 3300053084 | Bacteria | 2732 |
| 662 | Ga0495595_0026857 | 3300053084 | Bacteria | 2561 |
| 663 | Ga0495595_0031240 | 3300053084 | Bacteria | 2393 |
| 664 | Ga0495595_0060709 | 3300053084 | Bacteria | 1770 |
| 665 | Ga0495595_0074460 | 3300053084 | Bacteria | 1609 |
| 666 | Ga0495619_0000003 | 3300053085 | Bacteria | 515784 |
| 667 | Ga0495619_0000439 | 3300053085 | Bacteria | 28081 |
| 668 | Ga0495619_0002107 | 3300053085 | Bacteria | 13189 |
| 669 | Ga0495619_0022694 | 3300053085 | Bacteria | 4019 |
| 670 | Ga0495619_0025324 | 3300053085 | Bacteria | 3809 |
| 671 | Ga0500643_008044 | 3300053087 | Bacteria | 4178 |
| 672 | Ga0500644_0001376 | 3300053088 | Bacteria | 6478 |
| 673 | Ga0500651_0000898 | 3300053093 | Bacteria | 14595 |
| 674 | Ga0500566_0032329 | 3300053094 | Bacteria | 3051 |
| 675 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 676 | Ga0500618_000990 | 3300053125 | Bacteria | 14364 |
| 677 | Ga0500642_0028181 | 3300053130 | Bacteria | 2314 |
| 678 | Ga0500652_008214 | 3300053131 | Bacteria | 3467 |
| 679 | Ga0500561_0000283 | 3300053137 | Bacteria | 8867 |
| 680 | Ga0500573_0006853 | 3300053140 | Bacteria | 6182 |
| 681 | Ga0500573_0007517 | 3300053140 | Bacteria | 5947 |
| 682 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 683 | Ga0500616_0000949 | 3300053153 | Bacteria | 31578 |
| 684 | Ga0500616_0023203 | 3300053153 | Bacteria | 3458 |
| 685 | Ga0500616_0078056 | 3300053153 | Bacteria | 1671 |
| 686 | Ga0500622_0036278 | 3300053156 | Bacteria | 2577 |
| 687 | Ga0500624_000336 | 3300053157 | Bacteria | 15794 |
| 688 | Ga0500634_0063351 | 3300053161 | Bacteria | 1956 |
| 689 | Ga0500645_001078 | 3300053730 | Bacteria | 15075 |
| 690 | Ga0501084_0134402 | 3300054114 | Bacteria | 2082 |
| 691 | Ga0590071_007032 | 3300059421 | Bacteria | 2664 |
| 692 | Ga0590077_003753 | 3300059426 | Bacteria | 3137 |
| 693 | Ga0501082_0429223 | 3300060353 | Unclassified | 1154 |
| 694 | Ga0501082_0602966 | 3300060353 | Bacteria | 961 |
| 695 | Ga0530510_0139354 | 3300061734 | Bacteria | 1786 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026035 | Ga0207703_10276456 | Ga0207703_102764562 | 202 |
| 2 | 3300006175 | Ga0070712_100004012 | Ga0070712_1000040124 | 219 |
| 3 | 3300025915 | Ga0207693_10009968 | Ga0207693_100099684 | 219 |
| 4 | 3300035692 | Ga0373935_0300658 | Ga0373935_0300658_57_782 | 221 |
| 5 | 3300036401 | Ga0373937_0107061 | Ga0373937_0107061_797_1522 | 221 |
| 6 | 3300046454 | Ga0495592_0000943 | Ga0495592_0000943_16986_17711 | 221 |
| 7 | 3300046463 | Ga0495653_0132873 | Ga0495653_0132873_176_901 | 221 |
| 8 | 3300046477 | Ga0495664_0042800 | Ga0495664_0042800_1131_1856 | 221 |
| 9 | 3300046511 | Ga0495608_0070198 | Ga0495608_0070198_261_986 | 221 |
| 10 | 3300046529 | Ga0495652_0017333 | Ga0495652_0017333_2139_2864 | 221 |
| 11 | 3300046536 | Ga0495587_0019457 | Ga0495587_0019457_3151_3876 | 221 |
| 12 | 3300046543 | Ga0495645_0045961 | Ga0495645_0045961_563_1288 | 221 |
| 13 | 3300046559 | Ga0495667_0037960 | Ga0495667_0037960_102_827 | 221 |
| 14 | 3300046678 | Ga0495599_0013037 | Ga0495599_0013037_3184_3909 | 221 |
| 15 | 3300046679 | Ga0495623_0058642 | Ga0495623_0058642_452_1177 | 221 |
| 16 | 3300046680 | Ga0495646_0005112 | Ga0495646_0005112_3978_4703 | 221 |
| 17 | 3300047317 | Ga0495604_0010136 | Ga0495604_0010136_2088_2813 | 221 |
| 18 | 3300047319 | Ga0495674_0010801 | Ga0495674_0010801_2100_2825 | 221 |
| 19 | 3300047322 | Ga0495680_0183953 | Ga0495680_0183953_391_1116 | 221 |
| 20 | 3300047444 | Ga0495675_0058797 | Ga0495675_0058797_1035_1760 | 221 |
| 21 | 3300048918 | Ga0496115_0177691 | Ga0496115_0177691_992_1717 | 221 |
| 22 | 3300053077 | Ga0495601_0028123 | Ga0495601_0028123_986_1711 | 221 |
| 23 | 3300053078 | Ga0495612_0002387 | Ga0495612_0002387_6698_7423 | 221 |
| 24 | 3300053084 | Ga0495595_0031240 | Ga0495595_0031240_998_1723 | 221 |
| 25 | 3300053085 | Ga0495619_0002107 | Ga0495619_0002107_404_1129 | 221 |
| 26 | 3300059421 | Ga0590071_007032 | Ga0590071_007032_1405_2247 | 221 |
| 27 | 3300006847 | Ga0075431_100008096 | Ga0075431_10000809610 | 223 |
| 28 | 3300009098 | Ga0105245_10165695 | Ga0105245_101656953 | 223 |
| 29 | 3300009101 | Ga0105247_10032174 | Ga0105247_100321743 | 223 |
| 30 | 3300009177 | Ga0105248_10027809 | Ga0105248_100278096 | 223 |
| 31 | 3300014968 | Ga0157379_10018740 | Ga0157379_100187406 | 223 |
| 32 | 3300017792 | Ga0163161_10066517 | Ga0163161_100665172 | 223 |
| 33 | 3300048903 | Ga0496100_0060962 | Ga0496100_0060962_594_1454 | 223 |
| 34 | 3300048904 | Ga0496101_0014991 | Ga0496101_0014991_4329_5189 | 223 |
| 35 | 3300048905 | Ga0496102_0017001 | Ga0496102_0017001_2422_3282 | 223 |
| 36 | 3300048906 | Ga0496103_0047686 | Ga0496103_0047686_873_1733 | 223 |
| 37 | 3300048908 | Ga0496105_0120826 | Ga0496105_0120826_1125_1985 | 223 |
| 38 | 3300048909 | Ga0496106_0058742 | Ga0496106_0058742_1631_2491 | 223 |
| 39 | 3300048915 | Ga0496112_0180334 | Ga0496112_0180334_620_1480 | 223 |
| 40 | 3300048917 | Ga0496114_0043144 | Ga0496114_0043144_428_1288 | 223 |
| 41 | 3300048918 | Ga0496115_0010397 | Ga0496115_0010397_4706_5566 | 223 |
| 42 | 3300050508 | nmdc:mga09592_431646_c1 | nmdc:mga09592_431646_c1_159_1010 | 223 |
| 43 | 3300050509 | nmdc:mga0qj67_7849_c1 | nmdc:mga0qj67_7849_c1_6851_7702 | 223 |
| 44 | 3300050510 | nmdc:mga06r32_36988_c1 | nmdc:mga06r32_36988_c1_598_1449 | 223 |
| 45 | 3300005329 | Ga0070683_100116237 | Ga0070683_1001162372 | 224 |
| 46 | 3300005330 | Ga0070690_100017371 | Ga0070690_1000173711 | 224 |
| 47 | 3300005330 | Ga0070690_100094459 | Ga0070690_1000944592 | 224 |
| 48 | 3300005336 | Ga0070680_100032118 | Ga0070680_1000321183 | 224 |
| 49 | 3300005338 | Ga0068868_100031126 | Ga0068868_1000311266 | 224 |
| 50 | 3300005344 | Ga0070661_100028049 | Ga0070661_1000280494 | 224 |
| 51 | 3300005354 | Ga0070675_100414273 | Ga0070675_1004142731 | 224 |
| 52 | 3300005355 | Ga0070671_100066381 | Ga0070671_1000663812 | 224 |
| 53 | 3300005355 | Ga0070671_100112883 | Ga0070671_1001128833 | 224 |
| 54 | 3300005364 | Ga0070673_100277222 | Ga0070673_1002772222 | 224 |
| 55 | 3300005365 | Ga0070688_100274645 | Ga0070688_1002746452 | 224 |
| 56 | 3300005366 | Ga0070659_100189118 | Ga0070659_1001891182 | 224 |
| 57 | 3300005367 | Ga0070667_100028854 | Ga0070667_1000288543 | 224 |
| 58 | 3300005434 | Ga0070709_10021066 | Ga0070709_100210662 | 224 |
| 59 | 3300005434 | Ga0070709_10108537 | Ga0070709_101085372 | 224 |
| 60 | 3300005436 | Ga0070713_100000550 | Ga0070713_10000055022 | 224 |
| 61 | 3300005436 | Ga0070713_100128811 | Ga0070713_1001288112 | 224 |
| 62 | 3300005437 | Ga0070710_10001391 | Ga0070710_100013912 | 224 |
| 63 | 3300005439 | Ga0070711_100022169 | Ga0070711_1000221694 | 224 |
| 64 | 3300005439 | Ga0070711_100151821 | Ga0070711_1001518213 | 224 |
| 65 | 3300005441 | Ga0070700_100181908 | Ga0070700_1001819082 | 224 |
| 66 | 3300005455 | Ga0070663_100038861 | Ga0070663_1000388612 | 224 |
| 67 | 3300005456 | Ga0070678_100174090 | Ga0070678_1001740902 | 224 |
| 68 | 3300005457 | Ga0070662_100107414 | Ga0070662_1001074142 | 224 |
| 69 | 3300005458 | Ga0070681_10090746 | Ga0070681_100907462 | 224 |
| 70 | 3300005466 | Ga0070685_10003366 | Ga0070685_100033662 | 224 |
| 71 | 3300005544 | Ga0070686_100022671 | Ga0070686_1000226715 | 224 |
| 72 | 3300005547 | Ga0070693_100032265 | Ga0070693_1000322654 | 224 |
| 73 | 3300005615 | Ga0070702_100151314 | Ga0070702_1001513142 | 224 |
| 74 | 3300005615 | Ga0070702_100174959 | Ga0070702_1001749592 | 224 |
| 75 | 3300005616 | Ga0068852_100456388 | Ga0068852_1004563882 | 224 |
| 76 | 3300005834 | Ga0068851_10136830 | Ga0068851_101368302 | 224 |
| 77 | 3300005842 | Ga0068858_100066979 | Ga0068858_1000669794 | 224 |
| 78 | 3300005843 | Ga0068860_100173155 | Ga0068860_1001731552 | 224 |
| 79 | 3300005844 | Ga0068862_100107449 | Ga0068862_1001074493 | 224 |
| 80 | 3300006028 | Ga0070717_10000150 | Ga0070717_100001507 | 224 |
| 81 | 3300006163 | Ga0070715_10000967 | Ga0070715_100009677 | 224 |
| 82 | 3300006163 | Ga0070715_10014104 | Ga0070715_100141042 | 224 |
| 83 | 3300006175 | Ga0070712_100105322 | Ga0070712_1001053223 | 224 |
| 84 | 3300006237 | Ga0097621_100074880 | Ga0097621_1000748803 | 224 |
| 85 | 3300006358 | Ga0068871_100103835 | Ga0068871_1001038352 | 224 |
| 86 | 3300006871 | Ga0075434_100170023 | Ga0075434_1001700233 | 224 |
| 87 | 3300006914 | Ga0075436_100221484 | Ga0075436_1002214842 | 224 |
| 88 | 3300009011 | Ga0105251_10106778 | Ga0105251_101067782 | 224 |
| 89 | 3300009176 | Ga0105242_10190895 | Ga0105242_101908952 | 224 |
| 90 | 3300009545 | Ga0105237_10057439 | Ga0105237_100574394 | 224 |
| 91 | 3300009553 | Ga0105249_10037876 | Ga0105249_100378764 | 224 |
| 92 | 3300010375 | Ga0105239_10117853 | Ga0105239_101178532 | 224 |
| 93 | 3300011119 | Ga0105246_10131138 | Ga0105246_101311382 | 224 |
| 94 | 3300013100 | Ga0157373_10199073 | Ga0157373_101990732 | 224 |
| 95 | 3300013296 | Ga0157374_10866535 | Ga0157374_108665351 | 224 |
| 96 | 3300013297 | Ga0157378_10096546 | Ga0157378_100965463 | 224 |
| 97 | 3300013306 | Ga0163162_10142571 | Ga0163162_101425713 | 224 |
| 98 | 3300014326 | Ga0157380_10181281 | Ga0157380_101812812 | 224 |
| 99 | 3300014745 | Ga0157377_10044714 | Ga0157377_100447143 | 224 |
| 100 | 3300025898 | Ga0207692_10011833 | Ga0207692_100118335 | 224 |
| 101 | 3300025898 | Ga0207692_10045206 | Ga0207692_100452063 | 224 |
| 102 | 3300025903 | Ga0207680_10205830 | Ga0207680_102058302 | 224 |
| 103 | 3300025905 | Ga0207685_10008065 | Ga0207685_100080652 | 224 |
| 104 | 3300025905 | Ga0207685_10079496 | Ga0207685_100794962 | 224 |
| 105 | 3300025906 | Ga0207699_10005642 | Ga0207699_100056426 | 224 |
| 106 | 3300025906 | Ga0207699_10039047 | Ga0207699_100390472 | 224 |
| 107 | 3300025907 | Ga0207645_10127926 | Ga0207645_101279262 | 224 |
| 108 | 3300025911 | Ga0207654_10040799 | Ga0207654_100407992 | 224 |
| 109 | 3300025914 | Ga0207671_10062226 | Ga0207671_100622263 | 224 |
| 110 | 3300025915 | Ga0207693_10001763 | Ga0207693_100017632 | 224 |
| 111 | 3300025915 | Ga0207693_10011822 | Ga0207693_100118223 | 224 |
| 112 | 3300025916 | Ga0207663_10008055 | Ga0207663_100080553 | 224 |
| 113 | 3300025916 | Ga0207663_10039065 | Ga0207663_100390652 | 224 |
| 114 | 3300025917 | Ga0207660_10017175 | Ga0207660_100171754 | 224 |
| 115 | 3300025919 | Ga0207657_10059369 | Ga0207657_100593692 | 224 |
| 116 | 3300025921 | Ga0207652_10349028 | Ga0207652_103490281 | 224 |
| 117 | 3300025927 | Ga0207687_10040092 | Ga0207687_100400924 | 224 |
| 118 | 3300025927 | Ga0207687_10134032 | Ga0207687_101340322 | 224 |
| 119 | 3300025928 | Ga0207700_10027048 | Ga0207700_100270484 | 224 |
| 120 | 3300025928 | Ga0207700_10054575 | Ga0207700_100545753 | 224 |
| 121 | 3300025929 | Ga0207664_10033634 | Ga0207664_100336345 | 224 |
| 122 | 3300025929 | Ga0207664_10282550 | Ga0207664_102825502 | 224 |
| 123 | 3300025932 | Ga0207690_10032375 | Ga0207690_100323753 | 224 |
| 124 | 3300025933 | Ga0207706_10017172 | Ga0207706_100171722 | 224 |
| 125 | 3300025934 | Ga0207686_10185336 | Ga0207686_101853362 | 224 |
| 126 | 3300025938 | Ga0207704_10040421 | Ga0207704_100404214 | 224 |
| 127 | 3300025939 | Ga0207665_10000228 | Ga0207665_1000022834 | 224 |
| 128 | 3300025939 | Ga0207665_10096091 | Ga0207665_100960912 | 224 |
| 129 | 3300025941 | Ga0207711_10044811 | Ga0207711_100448113 | 224 |
| 130 | 3300025944 | Ga0207661_10381646 | Ga0207661_103816462 | 224 |
| 131 | 3300025961 | Ga0207712_10073594 | Ga0207712_100735944 | 224 |
| 132 | 3300026035 | Ga0207703_10322309 | Ga0207703_103223092 | 224 |
| 133 | 3300026067 | Ga0207678_10078763 | Ga0207678_100787633 | 224 |
| 134 | 3300026095 | Ga0207676_10039983 | Ga0207676_100399834 | 224 |
| 135 | 3300026121 | Ga0207683_10020028 | Ga0207683_100200282 | 224 |
| 136 | 3300026121 | Ga0207683_10241618 | Ga0207683_102416182 | 224 |
| 137 | 3300034819 | Ga0373958_0007804 | Ga0373958_0007804_100_963 | 224 |
| 138 | 3300034957 | Ga0373938_0007040 | Ga0373938_0007040_980_1843 | 224 |
| 139 | 3300035083 | Ga0373926_0102193 | Ga0373926_0102193_132_995 | 224 |
| 140 | 3300035086 | Ga0373934_0005408 | Ga0373934_0005408_2724_3587 | 224 |
| 141 | 3300035088 | Ga0373940_0040445 | Ga0373940_0040445_48_911 | 224 |
| 142 | 3300035090 | Ga0373949_0015114 | Ga0373949_0015114_34_897 | 224 |
| 143 | 3300035111 | Ga0373923_0032595 | Ga0373923_0032595_261_1124 | 224 |
| 144 | 3300035112 | Ga0373932_0012530 | Ga0373932_0012530_1142_2017 | 224 |
| 145 | 3300035114 | Ga0373939_0020751 | Ga0373939_0020751_100_963 | 224 |
| 146 | 3300035119 | Ga0373956_0079853 | Ga0373956_0079853_257_1120 | 224 |
| 147 | 3300035120 | Ga0373957_0000733 | Ga0373957_0000733_2854_3717 | 224 |
| 148 | 3300035121 | Ga0373960_0009997 | Ga0373960_0009997_782_1645 | 224 |
| 149 | 3300035170 | Ga0373943_0004643 | Ga0373943_0004643_4344_5219 | 224 |
| 150 | 3300035170 | Ga0373943_0031188 | Ga0373943_0031188_343_1206 | 224 |
| 151 | 3300035171 | Ga0373946_0007033 | Ga0373946_0007033_2036_2899 | 224 |
| 152 | 3300035171 | Ga0373946_0019295 | Ga0373946_0019295_641_1516 | 224 |
| 153 | 3300035242 | Ga0373962_0014481 | Ga0373962_0014481_870_1733 | 224 |
| 154 | 3300035692 | Ga0373935_0170460 | Ga0373935_0170460_560_1435 | 224 |
| 155 | 3300035695 | Ga0373927_0060680 | Ga0373927_0060680_1000_1875 | 224 |
| 156 | 3300035724 | Ga0373933_0002170 | Ga0373933_0002170_4967_5830 | 224 |
| 157 | 3300035725 | Ga0373947_0031816 | Ga0373947_0031816_494_1369 | 224 |
| 158 | 3300036401 | Ga0373937_0003016 | Ga0373937_0003016_10453_11316 | 224 |
| 159 | 3300037068 | Ga0373925_0029022 | Ga0373925_0029022_1898_2773 | 224 |
| 160 | 3300046455 | Ga0495603_0033207 | Ga0495603_0033207_824_1699 | 224 |
| 161 | 3300046459 | Ga0495629_0001744 | Ga0495629_0001744_11568_12443 | 224 |
| 162 | 3300046459 | Ga0495629_0159976 | Ga0495629_0159976_444_1307 | 224 |
| 163 | 3300046461 | Ga0495641_0020639 | Ga0495641_0020639_1492_2367 | 224 |
| 164 | 3300046461 | Ga0495641_0030621 | Ga0495641_0030621_1049_1912 | 224 |
| 165 | 3300046462 | Ga0495651_0003262 | Ga0495651_0003262_10097_10960 | 224 |
| 166 | 3300046463 | Ga0495653_0007752 | Ga0495653_0007752_4741_5604 | 224 |
| 167 | 3300046473 | Ga0495582_0055230 | Ga0495582_0055230_45_920 | 224 |
| 168 | 3300046477 | Ga0495664_0125858 | Ga0495664_0125858_492_1355 | 224 |
| 169 | 3300046511 | Ga0495608_0002716 | Ga0495608_0002716_7212_8075 | 224 |
| 170 | 3300046514 | Ga0495618_0009781 | Ga0495618_0009781_4741_5604 | 224 |
| 171 | 3300046516 | Ga0495628_0011899 | Ga0495628_0011899_1509_2372 | 224 |
| 172 | 3300046529 | Ga0495652_0021127 | Ga0495652_0021127_3235_4098 | 224 |
| 173 | 3300046533 | Ga0495640_0102422 | Ga0495640_0102422_569_1432 | 224 |
| 174 | 3300046533 | Ga0495640_0216039 | Ga0495640_0216039_257_1120 | 224 |
| 175 | 3300046535 | Ga0495586_0028908 | Ga0495586_0028908_2074_2937 | 224 |
| 176 | 3300046536 | Ga0495587_0002288 | Ga0495587_0002288_10218_11081 | 224 |
| 177 | 3300046543 | Ga0495645_0003108 | Ga0495645_0003108_2933_3796 | 224 |
| 178 | 3300046559 | Ga0495667_0006750 | Ga0495667_0006750_5107_5970 | 224 |
| 179 | 3300046663 | Ga0495635_0004663 | Ga0495635_0004663_3850_4713 | 224 |
| 180 | 3300046663 | Ga0495635_0242349 | Ga0495635_0242349_288_1163 | 224 |
| 181 | 3300046675 | Ga0495657_0001806 | Ga0495657_0001806_14672_15535 | 224 |
| 182 | 3300046678 | Ga0495599_0177450 | Ga0495599_0177450_193_1056 | 224 |
| 183 | 3300046679 | Ga0495623_0005760 | Ga0495623_0005760_2295_3158 | 224 |
| 184 | 3300046680 | Ga0495646_0007322 | Ga0495646_0007322_1509_2372 | 224 |
| 185 | 3300046681 | Ga0495647_0017761 | Ga0495647_0017761_828_1703 | 224 |
| 186 | 3300046681 | Ga0495647_0074544 | Ga0495647_0074544_444_1307 | 224 |
| 187 | 3300046683 | Ga0495658_0001024 | Ga0495658_0001024_3516_4391 | 224 |
| 188 | 3300047315 | Ga0495581_0029576 | Ga0495581_0029576_754_1629 | 224 |
| 189 | 3300047317 | Ga0495604_0003703 | Ga0495604_0003703_11249_12112 | 224 |
| 190 | 3300047321 | Ga0495676_0089159 | Ga0495676_0089159_474_1337 | 224 |
| 191 | 3300047322 | Ga0495680_0014220 | Ga0495680_0014220_2805_3668 | 224 |
| 192 | 3300047322 | Ga0495680_0021842 | Ga0495680_0021842_1069_1944 | 224 |
| 193 | 3300047444 | Ga0495675_0003237 | Ga0495675_0003237_4184_5047 | 224 |
| 194 | 3300047673 | Ga0495593_0017478 | Ga0495593_0017478_1774_2649 | 224 |
| 195 | 3300048903 | Ga0496100_0006229 | Ga0496100_0006229_3214_4077 | 224 |
| 196 | 3300048905 | Ga0496102_0069464 | Ga0496102_0069464_1539_2402 | 224 |
| 197 | 3300048905 | Ga0496102_0481462 | Ga0496102_0481462_86_949 | 224 |
| 198 | 3300048905 | Ga0496102_0504132 | Ga0496102_0504132_82_945 | 224 |
| 199 | 3300048907 | Ga0496104_0009345 | Ga0496104_0009345_7785_8648 | 224 |
| 200 | 3300048910 | Ga0496107_0013954 | Ga0496107_0013954_3762_4625 | 224 |
| 201 | 3300048910 | Ga0496107_0016975 | Ga0496107_0016975_2228_3091 | 224 |
| 202 | 3300048913 | Ga0496110_0097488 | Ga0496110_0097488_1497_2360 | 224 |
| 203 | 3300048917 | Ga0496114_0003838 | Ga0496114_0003838_804_1667 | 224 |
| 204 | 3300050514 | nmdc:mga08x19_200757_c1 | nmdc:mga08x19_200757_c1_310_1173 | 224 |
| 205 | 3300053077 | Ga0495601_0006164 | Ga0495601_0006164_4971_5834 | 224 |
| 206 | 3300053078 | Ga0495612_0005295 | Ga0495612_0005295_4075_4938 | 224 |
| 207 | 3300053084 | Ga0495595_0074460 | Ga0495595_0074460_65_928 | 224 |
| 208 | 3300053085 | Ga0495619_0000439 | Ga0495619_0000439_15611_16486 | 224 |
| 209 | 3300031548 | Ga0307408_100121415 | Ga0307408_1001214153 | 225 |
| 210 | 3300050512 | nmdc:mga0n895_15595_c1 | nmdc:mga0n895_15595_c1_5553_6278 | 226 |
| 211 | 3300050513 | nmdc:mga0rr50_58336_c1 | nmdc:mga0rr50_58336_c1_1947_2672 | 226 |
| 212 | 3300046539 | Ga0495621_0040224 | Ga0495621_0040224_326_1099 | 227 |
| 213 | 3300009147 | Ga0114129_10138946 | Ga0114129_101389462 | 228 |
| 214 | 3300050507 | nmdc:mga05p37_68171_c1 | nmdc:mga05p37_68171_c1_1303_2061 | 228 |
| 215 | 3300050508 | nmdc:mga09592_235498_c1 | nmdc:mga09592_235498_c1_29_787 | 228 |
| 216 | 3300025915 | Ga0207693_10123504 | Ga0207693_101235043 | 229 |
| 217 | 3300053140 | Ga0500573_0007517 | Ga0500573_0007517_818_1594 | 229 |
| 218 | 3300006844 | Ga0075428_100091698 | Ga0075428_1000916982 | 231 |
| 219 | 3300006880 | Ga0075429_100246846 | Ga0075429_1002468462 | 231 |
| 220 | 3300038443 | Ga0395901_0195724 | Ga0395901_0195724_890_1750 | 231 |
| 221 | 3300006173 | Ga0070716_100043881 | Ga0070716_1000438812 | 232 |
| 222 | 3300036401 | Ga0373937_0179690 | Ga0373937_0179690_938_1720 | 232 |
| 223 | 3300049592 | Ga0501076_0036224 | Ga0501076_0036224_2741_3583 | 232 |
| 224 | 3300049742 | Ga0501080_0162688 | Ga0501080_0162688_868_1710 | 232 |
| 225 | 3300050507 | nmdc:mga05p37_503256_c1 | nmdc:mga05p37_503256_c1_15_857 | 232 |
| 226 | 3300050510 | nmdc:mga06r32_14315_c1 | nmdc:mga06r32_14315_c1_5873_6715 | 232 |
| 227 | 3300060353 | Ga0501082_0429223 | Ga0501082_0429223_295_1137 | 232 |
| 228 | 3300061734 | Ga0530510_0139354 | Ga0530510_0139354_330_1172 | 232 |
| 229 | 3300006871 | Ga0075434_100449024 | Ga0075434_1004490242 | 233 |
| 230 | 3300049568 | Ga0501031_0221443 | Ga0501031_0221443_377_1177 | 233 |
| 231 | 3300049572 | Ga0501036_0036305 | Ga0501036_0036305_1092_1892 | 233 |
| 232 | 3300049576 | Ga0501040_0027784 | Ga0501040_0027784_2161_2961 | 233 |
| 233 | 3300049577 | Ga0501041_0018427 | Ga0501041_0018427_1125_1925 | 233 |
| 234 | 3300049580 | Ga0501046_0015157 | Ga0501046_0015157_1926_2726 | 233 |
| 235 | 3300049582 | Ga0501048_0038408 | Ga0501048_0038408_1125_1925 | 233 |
| 236 | 3300049588 | Ga0501072_0048616 | Ga0501072_0048616_2198_2998 | 233 |
| 237 | 3300049591 | Ga0501075_0027496 | Ga0501075_0027496_2289_3089 | 233 |
| 238 | 3300049743 | Ga0501081_0024033 | Ga0501081_0024033_2242_3042 | 233 |
| 239 | 3300049822 | Ga0501035_0245719 | Ga0501035_0245719_585_1385 | 233 |
| 240 | 3300049824 | Ga0501045_0000739 | Ga0501045_0000739_14161_14961 | 233 |
| 241 | 3300050513 | nmdc:mga0rr50_683700_c1 | nmdc:mga0rr50_683700_c1_57_827 | 233 |
| 242 | 3300054114 | Ga0501084_0134402 | Ga0501084_0134402_159_959 | 233 |
| 243 | 3300025885 | Ga0207653_10005827 | Ga0207653_100058274 | 234 |
| 244 | 3300005981 | Ga0081538_10045879 | Ga0081538_100458792 | 235 |
| 245 | 3300006847 | Ga0075431_100172342 | Ga0075431_1001723423 | 235 |
| 246 | 3300006880 | Ga0075429_100604303 | Ga0075429_1006043032 | 235 |
| 247 | 3300027876 | Ga0209974_10057892 | Ga0209974_100578922 | 235 |
| 248 | 3300031911 | Ga0307412_10294627 | Ga0307412_102946272 | 235 |
| 249 | 3300042876 | Ga0451577_0001529 | Ga0451577_0001529_13836_14606 | 235 |
| 250 | 3300050508 | nmdc:mga09592_433134_c1 | nmdc:mga09592_433134_c1_227_1000 | 235 |
| 251 | 3300050510 | nmdc:mga06r32_265661_c1 | nmdc:mga06r32_265661_c1_571_1344 | 235 |
| 252 | 3300053153 | Ga0500616_0078056 | Ga0500616_0078056_125_892 | 236 |
| 253 | 3300042876 | Ga0451577_0001601 | Ga0451577_0001601_14394_15164 | 237 |
| 254 | 3300005444 | Ga0070694_100068923 | Ga0070694_1000689232 | 238 |
| 255 | 3300005545 | Ga0070695_100123514 | Ga0070695_1001235142 | 238 |
| 256 | 3300005546 | Ga0070696_100010689 | Ga0070696_1000106893 | 238 |
| 257 | 3300006178 | Ga0075367_10179961 | Ga0075367_101799612 | 239 |
| 258 | 3300049571 | Ga0501034_0224139 | Ga0501034_0224139_981_1820 | 239 |
| 259 | 3300014969 | Ga0157376_10064616 | Ga0157376_100646163 | 240 |
| 260 | 3300048903 | Ga0496100_0158471 | Ga0496100_0158471_32_814 | 240 |
| 261 | 3300048905 | Ga0496102_0331359 | Ga0496102_0331359_440_1222 | 240 |
| 262 | 3300053140 | Ga0500573_0006853 | Ga0500573_0006853_4079_4855 | 240 |
| 263 | 3300009101 | Ga0105247_10017947 | Ga0105247_100179473 | 241 |
| 264 | 3300009177 | Ga0105248_10030287 | Ga0105248_100302874 | 241 |
| 265 | 3300014325 | Ga0163163_10006448 | Ga0163163_100064485 | 241 |
| 266 | 3300014968 | Ga0157379_10037217 | Ga0157379_100372174 | 241 |
| 267 | 3300048907 | Ga0496104_0118279 | Ga0496104_0118279_296_1156 | 241 |
| 268 | 3300048908 | Ga0496105_0232910 | Ga0496105_0232910_241_1101 | 241 |
| 269 | 3300048911 | Ga0496108_0016735 | Ga0496108_0016735_1132_1992 | 241 |
| 270 | 3300048912 | Ga0496109_0004187 | Ga0496109_0004187_4067_4927 | 241 |
| 271 | 3300048913 | Ga0496110_0166576 | Ga0496110_0166576_610_1470 | 241 |
| 272 | 3300048914 | Ga0496111_0017800 | Ga0496111_0017800_1629_2489 | 241 |
| 273 | 3300048915 | Ga0496112_0005729 | Ga0496112_0005729_7289_8149 | 241 |
| 274 | 3300048916 | Ga0496113_0001728 | Ga0496113_0001728_1500_2360 | 241 |
| 275 | 3300048926 | Ga0496123_0047076 | Ga0496123_0047076_1699_2517 | 241 |
| 276 | 3300049570 | Ga0501033_0017045 | Ga0501033_0017045_963_1745 | 241 |
| 277 | 3300049574 | Ga0501038_0115930 | Ga0501038_0115930_1093_1875 | 241 |
| 278 | 3300049581 | Ga0501047_0009379 | Ga0501047_0009379_1197_1979 | 241 |
| 279 | 3300049586 | Ga0501070_0097021 | Ga0501070_0097021_394_1176 | 241 |
| 280 | 3300049742 | Ga0501080_0067192 | Ga0501080_0067192_1430_2212 | 241 |
| 281 | 3300049822 | Ga0501035_0016279 | Ga0501035_0016279_3469_4251 | 241 |
| 282 | 3300049823 | Ga0501044_0016598 | Ga0501044_0016598_6921_7703 | 241 |
| 283 | iso_pu_bacteria | 2585427634 | 2586003790 | 241 |
| 284 | 3300003203 | JGI25406J46586_10048618 | JGI25406J46586_100486182 | 242 |
| 285 | 3300005290 | Ga0065712_10069608 | Ga0065712_100696083 | 242 |
| 286 | 3300005365 | Ga0070688_100226098 | Ga0070688_1002260982 | 242 |
| 287 | 3300005458 | Ga0070681_10142988 | Ga0070681_101429883 | 242 |
| 288 | 3300005564 | Ga0070664_100073324 | Ga0070664_1000733242 | 242 |
| 289 | 3300005618 | Ga0068864_100262459 | Ga0068864_1002624592 | 242 |
| 290 | 3300005842 | Ga0068858_100204034 | Ga0068858_1002040342 | 242 |
| 291 | 3300005985 | Ga0081539_10000803 | Ga0081539_1000080330 | 242 |
| 292 | 3300025917 | Ga0207660_10142108 | Ga0207660_101421083 | 242 |
| 293 | 3300025941 | Ga0207711_10101378 | Ga0207711_101013783 | 242 |
| 294 | 3300025945 | Ga0207679_10252622 | Ga0207679_102526221 | 242 |
| 295 | 3300026035 | Ga0207703_10177238 | Ga0207703_101772382 | 242 |
| 296 | 3300026095 | Ga0207676_10245298 | Ga0207676_102452982 | 242 |
| 297 | 3300049569 | Ga0501032_0097409 | Ga0501032_0097409_441_1316 | 242 |
| 298 | 3300049573 | Ga0501037_0032929 | Ga0501037_0032929_558_1433 | 242 |
| 299 | 3300049574 | Ga0501038_0089124 | Ga0501038_0089124_1023_1898 | 242 |
| 300 | 3300049581 | Ga0501047_0051691 | Ga0501047_0051691_2569_3444 | 242 |
| 301 | 3300049586 | Ga0501070_0214492 | Ga0501070_0214492_679_1551 | 242 |
| 302 | 3300049586 | Ga0501070_0238294 | Ga0501070_0238294_484_1359 | 242 |
| 303 | 3300049587 | Ga0501071_0090756 | Ga0501071_0090756_82_954 | 242 |
| 304 | 3300049822 | Ga0501035_0129757 | Ga0501035_0129757_556_1431 | 242 |
| 305 | 3300049823 | Ga0501044_0091317 | Ga0501044_0091317_1700_2575 | 242 |
| 306 | 3300050509 | nmdc:mga0qj67_304759_c1 | nmdc:mga0qj67_304759_c1_145_906 | 242 |
| 307 | iso_pu_bacteria | 2643221733 | 2644730216 | 242 |
| 308 | 3300005435 | Ga0070714_100028036 | Ga0070714_1000280364 | 243 |
| 309 | 3300005436 | Ga0070713_100021301 | Ga0070713_1000213013 | 243 |
| 310 | 3300005439 | Ga0070711_100319265 | Ga0070711_1003192652 | 243 |
| 311 | 3300006028 | Ga0070717_10011597 | Ga0070717_100115973 | 243 |
| 312 | 3300006051 | Ga0075364_10037522 | Ga0075364_100375223 | 243 |
| 313 | 3300006173 | Ga0070716_100313921 | Ga0070716_1003139212 | 243 |
| 314 | 3300006871 | Ga0075434_100423924 | Ga0075434_1004239242 | 243 |
| 315 | 3300009094 | Ga0111539_10014430 | Ga0111539_100144306 | 243 |
| 316 | 3300013102 | Ga0157371_10029143 | Ga0157371_100291435 | 243 |
| 317 | 3300013105 | Ga0157369_10030046 | Ga0157369_100300465 | 243 |
| 318 | 3300025898 | Ga0207692_10020246 | Ga0207692_100202462 | 243 |
| 319 | 3300025905 | Ga0207685_10012920 | Ga0207685_100129203 | 243 |
| 320 | 3300025906 | Ga0207699_10176664 | Ga0207699_101766642 | 243 |
| 321 | 3300025928 | Ga0207700_10049864 | Ga0207700_100498642 | 243 |
| 322 | 3300025929 | Ga0207664_10145653 | Ga0207664_101456532 | 243 |
| 323 | 3300025939 | Ga0207665_10333274 | Ga0207665_103332742 | 243 |
| 324 | 3300048919 | Ga0496116_0000036 | Ga0496116_0000036_238360_239178 | 243 |
| 325 | 3300048929 | Ga0496126_0000156 | Ga0496126_0000156_135062_135880 | 243 |
| 326 | 3300048929 | Ga0496126_0209148 | Ga0496126_0209148_108_878 | 243 |
| 327 | 3300050511 | nmdc:mga08y16_26909_c1 | nmdc:mga08y16_26909_c1_2293_3153 | 243 |
| 328 | iso_pu_bacteria | 2574179768 | 2574431235 | 243 |
| 329 | iso_pu_bacteria | 639633007 | 639788680 | 243 |
| 330 | 3300003322 | rootL2_10000581 | rootL2_100005812 | 244 |
| 331 | 3300005440 | Ga0070705_100215980 | Ga0070705_1002159802 | 244 |
| 332 | 3300005546 | Ga0070696_100077142 | Ga0070696_1000771423 | 244 |
| 333 | 3300005937 | Ga0081455_10062198 | Ga0081455_100621983 | 244 |
| 334 | 3300006058 | Ga0075432_10000665 | Ga0075432_100006653 | 244 |
| 335 | 3300006844 | Ga0075428_100003032 | Ga0075428_1000030328 | 244 |
| 336 | 3300006846 | Ga0075430_100000587 | Ga0075430_10000058716 | 244 |
| 337 | 3300006852 | Ga0075433_10000020 | Ga0075433_1000002024 | 244 |
| 338 | 3300006880 | Ga0075429_100001660 | Ga0075429_10000166014 | 244 |
| 339 | 3300009094 | Ga0111539_10000373 | Ga0111539_1000037349 | 244 |
| 340 | 3300025916 | Ga0207663_10033763 | Ga0207663_100337632 | 244 |
| 341 | 3300025945 | Ga0207679_10077869 | Ga0207679_100778693 | 244 |
| 342 | 3300027717 | Ga0209998_10004731 | Ga0209998_100047312 | 244 |
| 343 | 3300027876 | Ga0209974_10011673 | Ga0209974_100116734 | 244 |
| 344 | 3300027907 | Ga0207428_10000172 | Ga0207428_1000017266 | 244 |
| 345 | 3300027907 | Ga0207428_10021624 | Ga0207428_100216245 | 244 |
| 346 | 3300031238 | Ga0265332_10006577 | Ga0265332_100065774 | 244 |
| 347 | 3300035118 | Ga0373954_0219689 | Ga0373954_0219689_17_796 | 244 |
| 348 | 3300050507 | nmdc:mga05p37_102_c1 | nmdc:mga05p37_102_c1_54637_55512 | 244 |
| 349 | 3300050508 | nmdc:mga09592_716_c1 | nmdc:mga09592_716_c1_8304_9179 | 244 |
| 350 | 3300050509 | nmdc:mga0qj67_119_c1 | nmdc:mga0qj67_119_c1_8721_9596 | 244 |
| 351 | 3300050510 | nmdc:mga06r32_2969_c1 | nmdc:mga06r32_2969_c1_10085_10960 | 244 |
| 352 | 3300050511 | nmdc:mga08y16_2739_c1 | nmdc:mga08y16_2739_c1_5824_6699 | 244 |
| 353 | 3300050512 | nmdc:mga0n895_56080_c1 | nmdc:mga0n895_56080_c1_620_1495 | 244 |
| 354 | 3300050513 | nmdc:mga0rr50_494_c1 | nmdc:mga0rr50_494_c1_11686_12561 | 244 |
| 355 | 3300050513 | nmdc:mga0rr50_72138_c1 | nmdc:mga0rr50_72138_c1_1539_2414 | 244 |
| 356 | 3300050515 | nmdc:mga0a205_4441_c1 | nmdc:mga0a205_4441_c1_1554_2429 | 244 |
| 357 | 3300053125 | Ga0500618_000990 | Ga0500618_000990_10805_11575 | 244 |
| 358 | 3300059426 | Ga0590077_003753 | Ga0590077_003753_997_1839 | 244 |
| 359 | 3300005343 | Ga0070687_100370820 | Ga0070687_1003708201 | 245 |
| 360 | 3300005354 | Ga0070675_100265426 | Ga0070675_1002654262 | 245 |
| 361 | 3300006175 | Ga0070712_100404518 | Ga0070712_1004045181 | 245 |
| 362 | 3300006871 | Ga0075434_100164402 | Ga0075434_1001644022 | 245 |
| 363 | 3300013104 | Ga0157370_10290289 | Ga0157370_102902893 | 245 |
| 364 | 3300013105 | Ga0157369_10136236 | Ga0157369_101362362 | 245 |
| 365 | 3300013296 | Ga0157374_10051951 | Ga0157374_100519512 | 245 |
| 366 | 3300037418 | Ga0395900_0121087 | Ga0395900_0121087_452_1222 | 245 |
| 367 | 3300044842 | Ga0466957_0026026 | Ga0466957_0026026_1469_2251 | 245 |
| 368 | 3300048919 | Ga0496116_0080624 | Ga0496116_0080624_1186_2004 | 245 |
| 369 | 3300048920 | Ga0496117_0008869 | Ga0496117_0008869_1714_2532 | 245 |
| 370 | 3300048923 | Ga0496120_0012194 | Ga0496120_0012194_2459_3277 | 245 |
| 371 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_851334_852152 | 245 |
| 372 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_965269_966087 | 245 |
| 373 | 3300048929 | Ga0496126_0059922 | Ga0496126_0059922_692_1510 | 245 |
| 374 | 3300049591 | Ga0501075_0432990 | Ga0501075_0432990_190_960 | 245 |
| 375 | 3300050491 | nmdc:mga00v17_21845_c1 | nmdc:mga00v17_21845_c1_1597_2415 | 245 |
| 376 | iso_pu_bacteria | 2897803580 | 2897806681 | 245 |
| 377 | 3300005330 | Ga0070690_100288032 | Ga0070690_1002880322 | 246 |
| 378 | 3300005347 | Ga0070668_100241806 | Ga0070668_1002418061 | 246 |
| 379 | 3300005367 | Ga0070667_100133196 | Ga0070667_1001331963 | 246 |
| 380 | 3300005434 | Ga0070709_10083604 | Ga0070709_100836042 | 246 |
| 381 | 3300005436 | Ga0070713_100043618 | Ga0070713_1000436182 | 246 |
| 382 | 3300005436 | Ga0070713_100104000 | Ga0070713_1001040002 | 246 |
| 383 | 3300005439 | Ga0070711_100062344 | Ga0070711_1000623443 | 246 |
| 384 | 3300005441 | Ga0070700_100167445 | Ga0070700_1001674452 | 246 |
| 385 | 3300005455 | Ga0070663_100145095 | Ga0070663_1001450952 | 246 |
| 386 | 3300005458 | Ga0070681_10028847 | Ga0070681_100288472 | 246 |
| 387 | 3300005530 | Ga0070679_100023809 | Ga0070679_1000238097 | 246 |
| 388 | 3300005530 | Ga0070679_100233505 | Ga0070679_1002335052 | 246 |
| 389 | 3300005563 | Ga0068855_100364916 | Ga0068855_1003649162 | 246 |
| 390 | 3300005564 | Ga0070664_100134166 | Ga0070664_1001341663 | 246 |
| 391 | 3300005564 | Ga0070664_100302826 | Ga0070664_1003028262 | 246 |
| 392 | 3300005614 | Ga0068856_100012857 | Ga0068856_1000128577 | 246 |
| 393 | 3300005614 | Ga0068856_100443432 | Ga0068856_1004434322 | 246 |
| 394 | 3300005937 | Ga0081455_10003823 | Ga0081455_100038236 | 246 |
| 395 | 3300005937 | Ga0081455_10146836 | Ga0081455_101468362 | 246 |
| 396 | 3300005983 | Ga0081540_1004764 | Ga0081540_10047644 | 246 |
| 397 | 3300006038 | Ga0075365_10039942 | Ga0075365_100399422 | 246 |
| 398 | 3300006038 | Ga0075365_10084424 | Ga0075365_100844242 | 246 |
| 399 | 3300006844 | Ga0075428_100519168 | Ga0075428_1005191682 | 246 |
| 400 | 3300009093 | Ga0105240_10313559 | Ga0105240_103135592 | 246 |
| 401 | 3300009148 | Ga0105243_10105133 | Ga0105243_101051334 | 246 |
| 402 | 3300009174 | Ga0105241_10103883 | Ga0105241_101038832 | 246 |
| 403 | 3300009176 | Ga0105242_10029702 | Ga0105242_100297022 | 246 |
| 404 | 3300009545 | Ga0105237_10232450 | Ga0105237_102324502 | 246 |
| 405 | 3300009551 | Ga0105238_10113365 | Ga0105238_101133652 | 246 |
| 406 | 3300013104 | Ga0157370_10616500 | Ga0157370_106165002 | 246 |
| 407 | 3300013105 | Ga0157369_10785478 | Ga0157369_107854782 | 246 |
| 408 | 3300013307 | Ga0157372_10248405 | Ga0157372_102484052 | 246 |
| 409 | 3300013307 | Ga0157372_10455554 | Ga0157372_104555542 | 246 |
| 410 | 3300017792 | Ga0163161_10265282 | Ga0163161_102652822 | 246 |
| 411 | 3300025898 | Ga0207692_10109771 | Ga0207692_101097712 | 246 |
| 412 | 3300025901 | Ga0207688_10141195 | Ga0207688_101411951 | 246 |
| 413 | 3300025904 | Ga0207647_10278634 | Ga0207647_102786342 | 246 |
| 414 | 3300025911 | Ga0207654_10022166 | Ga0207654_100221662 | 246 |
| 415 | 3300025912 | Ga0207707_10003237 | Ga0207707_1000323713 | 246 |
| 416 | 3300025914 | Ga0207671_10219058 | Ga0207671_102190582 | 246 |
| 417 | 3300025915 | Ga0207693_10085574 | Ga0207693_100855742 | 246 |
| 418 | 3300025921 | Ga0207652_10168272 | Ga0207652_101682722 | 246 |
| 419 | 3300025921 | Ga0207652_10469094 | Ga0207652_104690942 | 246 |
| 420 | 3300025924 | Ga0207694_10037464 | Ga0207694_100374643 | 246 |
| 421 | 3300025929 | Ga0207664_10059208 | Ga0207664_100592082 | 246 |
| 422 | 3300025929 | Ga0207664_10393264 | Ga0207664_103932642 | 246 |
| 423 | 3300025940 | Ga0207691_10188433 | Ga0207691_101884332 | 246 |
| 424 | 3300025942 | Ga0207689_10077955 | Ga0207689_100779554 | 246 |
| 425 | 3300025945 | Ga0207679_10050621 | Ga0207679_100506213 | 246 |
| 426 | 3300025949 | Ga0207667_10053509 | Ga0207667_100535092 | 246 |
| 427 | 3300026075 | Ga0207708_10143143 | Ga0207708_101431432 | 246 |
| 428 | 3300026078 | Ga0207702_10007306 | Ga0207702_100073065 | 246 |
| 429 | 3300026142 | Ga0207698_10562599 | Ga0207698_105625992 | 246 |
| 430 | 3300031911 | Ga0307412_10167717 | Ga0307412_101677172 | 246 |
| 431 | 3300031995 | Ga0307409_100232069 | Ga0307409_1002320692 | 246 |
| 432 | 3300035170 | Ga0373943_0030335 | Ga0373943_0030335_1015_1791 | 246 |
| 433 | 3300037068 | Ga0373925_0195231 | Ga0373925_0195231_116_892 | 246 |
| 434 | 3300037466 | Ga0395898_0059476 | Ga0395898_0059476_1789_2559 | 246 |
| 435 | 3300046474 | Ga0495605_0105778 | Ga0495605_0105778_499_1275 | 246 |
| 436 | 3300046516 | Ga0495628_0136219 | Ga0495628_0136219_424_1200 | 246 |
| 437 | 3300046524 | Ga0495648_0151478 | Ga0495648_0151478_150_926 | 246 |
| 438 | 3300046616 | Ga0495668_0175491 | Ga0495668_0175491_23_799 | 246 |
| 439 | 3300046642 | Ga0495634_0081646 | Ga0495634_0081646_517_1293 | 246 |
| 440 | 3300046689 | Ga0495613_0046067 | Ga0495613_0046067_942_1718 | 246 |
| 441 | 3300047673 | Ga0495593_0071411 | Ga0495593_0071411_94_870 | 246 |
| 442 | 3300048906 | Ga0496103_0011009 | Ga0496103_0011009_4154_4930 | 246 |
| 443 | 3300048912 | Ga0496109_0534957 | Ga0496109_0534957_111_887 | 246 |
| 444 | 3300048917 | Ga0496114_0227277 | Ga0496114_0227277_800_1576 | 246 |
| 445 | 3300049585 | Ga0501069_0349140 | Ga0501069_0349140_90_860 | 246 |
| 446 | 3300049824 | Ga0501045_0363535 | Ga0501045_0363535_113_952 | 246 |
| 447 | 3300050492 | nmdc:mga0yw44_165052_c1 | nmdc:mga0yw44_165052_c1_41_817 | 246 |
| 448 | 3300050492 | nmdc:mga0yw44_2154_c1 | nmdc:mga0yw44_2154_c1_689_1465 | 246 |
| 449 | 3300053077 | Ga0495601_0088744 | Ga0495601_0088744_530_1306 | 246 |
| 450 | 3300053083 | Ga0495655_0061394 | Ga0495655_0061394_135_911 | 246 |
| 451 | 3300053085 | Ga0495619_0022694 | Ga0495619_0022694_881_1657 | 246 |
| 452 | 3300053156 | Ga0500622_0036278 | Ga0500622_0036278_868_1638 | 246 |
| 453 | 3300005331 | Ga0070670_100000725 | Ga0070670_10000072512 | 247 |
| 454 | 3300005365 | Ga0070688_100462212 | Ga0070688_1004622121 | 247 |
| 455 | 3300005366 | Ga0070659_100190179 | Ga0070659_1001901792 | 247 |
| 456 | 3300005366 | Ga0070659_100475550 | Ga0070659_1004755501 | 247 |
| 457 | 3300005457 | Ga0070662_100225242 | Ga0070662_1002252422 | 247 |
| 458 | 3300005548 | Ga0070665_100517707 | Ga0070665_1005177072 | 247 |
| 459 | 3300005616 | Ga0068852_100793125 | Ga0068852_1007931252 | 247 |
| 460 | 3300005937 | Ga0081455_10000151 | Ga0081455_100001518 | 247 |
| 461 | 3300006038 | Ga0075365_10228289 | Ga0075365_102282891 | 247 |
| 462 | 3300006847 | Ga0075431_100042771 | Ga0075431_1000427714 | 247 |
| 463 | 3300006847 | Ga0075431_100166346 | Ga0075431_1001663461 | 247 |
| 464 | 3300009094 | Ga0111539_10056564 | Ga0111539_100565643 | 247 |
| 465 | 3300009101 | Ga0105247_10079479 | Ga0105247_100794792 | 247 |
| 466 | 3300009147 | Ga0114129_10008524 | Ga0114129_100085247 | 247 |
| 467 | 3300010375 | Ga0105239_10206762 | Ga0105239_102067622 | 247 |
| 468 | 3300011119 | Ga0105246_10185335 | Ga0105246_101853352 | 247 |
| 469 | 3300014325 | Ga0163163_10017610 | Ga0163163_100176105 | 247 |
| 470 | 3300025900 | Ga0207710_10026292 | Ga0207710_100262922 | 247 |
| 471 | 3300025929 | Ga0207664_10065036 | Ga0207664_100650363 | 247 |
| 472 | 3300025944 | Ga0207661_10045706 | Ga0207661_100457063 | 247 |
| 473 | 3300026067 | Ga0207678_10013871 | Ga0207678_100138714 | 247 |
| 474 | 3300027907 | Ga0207428_10084354 | Ga0207428_100843542 | 247 |
| 475 | 3300046459 | Ga0495629_0036632 | Ga0495629_0036632_1206_1985 | 247 |
| 476 | 3300046461 | Ga0495641_0032809 | Ga0495641_0032809_1370_2149 | 247 |
| 477 | 3300047315 | Ga0495581_0019002 | Ga0495581_0019002_2225_3004 | 247 |
| 478 | 3300048903 | Ga0496100_0036518 | Ga0496100_0036518_842_1621 | 247 |
| 479 | 3300048905 | Ga0496102_0124729 | Ga0496102_0124729_1609_2388 | 247 |
| 480 | 3300048907 | Ga0496104_0002463 | Ga0496104_0002463_8863_9642 | 247 |
| 481 | 3300048908 | Ga0496105_0013402 | Ga0496105_0013402_1595_2374 | 247 |
| 482 | 3300048908 | Ga0496105_0475106 | Ga0496105_0475106_133_912 | 247 |
| 483 | 3300048909 | Ga0496106_0319434 | Ga0496106_0319434_258_1037 | 247 |
| 484 | 3300048910 | Ga0496107_0012187 | Ga0496107_0012187_1170_1949 | 247 |
| 485 | 3300048911 | Ga0496108_0000521 | Ga0496108_0000521_14717_15496 | 247 |
| 486 | 3300048912 | Ga0496109_0000193 | Ga0496109_0000193_47651_48430 | 247 |
| 487 | 3300048913 | Ga0496110_0013165 | Ga0496110_0013165_1095_1874 | 247 |
| 488 | 3300048914 | Ga0496111_0064734 | Ga0496111_0064734_1064_1843 | 247 |
| 489 | 3300048915 | Ga0496112_0043962 | Ga0496112_0043962_297_1076 | 247 |
| 490 | 3300048916 | Ga0496113_0000245 | Ga0496113_0000245_15838_16617 | 247 |
| 491 | 3300050496 | nmdc:mga07m45_155758_c1 | nmdc:mga07m45_155758_c1_268_1047 | 247 |
| 492 | 3300050507 | nmdc:mga05p37_11802_c1 | nmdc:mga05p37_11802_c1_586_1446 | 247 |
| 493 | 3300050507 | nmdc:mga05p37_7504_c2 | nmdc:mga05p37_7504_c2_1756_2535 | 247 |
| 494 | 3300050510 | nmdc:mga06r32_320250_c1 | nmdc:mga06r32_320250_c1_724_1503 | 247 |
| 495 | 3300050510 | nmdc:mga06r32_80542_c1 | nmdc:mga06r32_80542_c1_1363_2223 | 247 |
| 496 | 3300053084 | Ga0495595_0060709 | Ga0495595_0060709_385_1164 | 247 |
| 497 | 3300049743 | Ga0501081_0144577 | Ga0501081_0144577_201_1043 | 248 |
| 498 | 3300005439 | Ga0070711_100386871 | Ga0070711_1003868712 | 250 |
| 499 | 3300006175 | Ga0070712_100320963 | Ga0070712_1003209631 | 250 |
| 500 | 3300025915 | Ga0207693_10308975 | Ga0207693_103089751 | 250 |
| 501 | 3300025916 | Ga0207663_10060283 | Ga0207663_100602831 | 250 |
| 502 | 3300025939 | Ga0207665_10002785 | Ga0207665_1000278510 | 250 |
| 503 | 3300005441 | Ga0070700_100025387 | Ga0070700_1000253873 | 252 |
| 504 | 3300005444 | Ga0070694_100025036 | Ga0070694_1000250364 | 252 |
| 505 | 3300005545 | Ga0070695_100002744 | Ga0070695_1000027448 | 252 |
| 506 | 3300006844 | Ga0075428_100117704 | Ga0075428_1001177042 | 252 |
| 507 | 3300009094 | Ga0111539_10779354 | Ga0111539_107793542 | 252 |
| 508 | 3300009098 | Ga0105245_10103130 | Ga0105245_101031302 | 252 |
| 509 | 3300009176 | Ga0105242_10241245 | Ga0105242_102412452 | 252 |
| 510 | 3300026075 | Ga0207708_10040934 | Ga0207708_100409343 | 252 |
| 511 | 3300026118 | Ga0207675_100243518 | Ga0207675_1002435182 | 252 |
| 512 | 3300035116 | Ga0373945_0006895 | Ga0373945_0006895_291_1136 | 252 |
| 513 | 3300035171 | Ga0373946_0089667 | Ga0373946_0089667_195_1040 | 252 |
| 514 | 3300046472 | Ga0495580_0307465 | Ga0495580_0307465_152_997 | 252 |
| 515 | 3300046476 | Ga0495662_0060585 | Ga0495662_0060585_215_1060 | 252 |
| 516 | 3300046491 | Ga0495584_0023830 | Ga0495584_0023830_1474_2322 | 252 |
| 517 | 3300046499 | Ga0495594_0022620 | Ga0495594_0022620_1049_1894 | 252 |
| 518 | 3300046559 | Ga0495667_0148309 | Ga0495667_0148309_405_1217 | 252 |
| 519 | 3300046683 | Ga0495658_0025664 | Ga0495658_0025664_1467_2312 | 252 |
| 520 | 3300049588 | Ga0501072_0190718 | Ga0501072_0190718_511_1353 | 252 |
| 521 | 3300053084 | Ga0495595_0023153 | Ga0495595_0023153_344_1156 | 252 |
| 522 | 3300053085 | Ga0495619_0025324 | Ga0495619_0025324_2836_3648 | 252 |
| 523 | 3300060353 | Ga0501082_0602966 | Ga0501082_0602966_72_914 | 252 |
| 524 | 3300005518 | Ga0070699_100772055 | Ga0070699_1007720551 | 253 |
| 525 | 3300039447 | Ga0436361_0769631 | Ga0436361_0769631_1023_1838 | 253 |
| 526 | 3300039453 | Ga0436362_1062509 | Ga0436362_1062509_230_1045 | 253 |
| 527 | 3300050512 | nmdc:mga0n895_57667_c1 | nmdc:mga0n895_57667_c1_42_869 | 253 |
| 528 | 3300053083 | Ga0495655_0062935 | Ga0495655_0062935_59_904 | 253 |
| 529 | 3300053084 | Ga0495595_0026857 | Ga0495595_0026857_1713_2528 | 253 |
| 530 | 3300005518 | Ga0070699_100303955 | Ga0070699_1003039552 | 255 |
| 531 | 3300006175 | Ga0070712_100139899 | Ga0070712_1001398992 | 255 |
| 532 | 3300007076 | Ga0075435_100097104 | Ga0075435_1000971043 | 255 |
| 533 | 3300007265 | Ga0099794_10004996 | Ga0099794_100049966 | 255 |
| 534 | 3300031238 | Ga0265332_10007158 | Ga0265332_100071583 | 255 |
| 535 | 3300031241 | Ga0265325_10039642 | Ga0265325_100396423 | 255 |
| 536 | 3300031242 | Ga0265329_10017186 | Ga0265329_100171863 | 255 |
| 537 | 3300031247 | Ga0265340_10002525 | Ga0265340_1000252511 | 255 |
| 538 | 3300031712 | Ga0265342_10000039 | Ga0265342_10000039112 | 255 |
| 539 | 3300044694 | Ga0466963_0104050 | Ga0466963_0104050_55_882 | 255 |
| 540 | 3300048914 | Ga0496111_0036646 | Ga0496111_0036646_150_992 | 255 |
| 541 | iso_pu_bacteria | 2838736955 | 2838738892 | 255 |
| 542 | iso_pu_bacteria | 2841840854 | 2841842791 | 255 |
| 543 | iso_pu_bacteria | 2842140634 | 2842142571 | 255 |
| 544 | 3300046460 | Ga0495638_0010059 | Ga0495638_0010059_1488_2300 | 256 |
| 545 | 3300053088 | Ga0500644_0001376 | Ga0500644_0001376_3297_4109 | 256 |
| 546 | 3300053093 | Ga0500651_0000898 | Ga0500651_0000898_782_1594 | 256 |
| 547 | 3300053153 | Ga0500616_0000006 | Ga0500616_0000006_26441_27253 | 256 |
| 548 | iso_pu_bacteria | 8056875544 | 8056876617 | 256 |
| 549 | 3300031711 | Ga0265314_10001423 | Ga0265314_100014232 | 257 |
| 550 | 3300046558 | Ga0495633_0135242 | Ga0495633_0135242_232_1050 | 257 |
| 551 | 3300047470 | Ga0495681_0012100 | Ga0495681_0012100_4121_4939 | 257 |
| 552 | 3300047471 | Ga0495684_0342975 | Ga0495684_0342975_170_1015 | 257 |
| 553 | 3300053157 | Ga0500624_000336 | Ga0500624_000336_1451_2269 | 257 |
| 554 | 3300053161 | Ga0500634_0063351 | Ga0500634_0063351_256_1074 | 257 |
| 555 | iso_pu_bacteria | 2510917026 | 2511173809 | 257 |
| 556 | iso_pu_bacteria | 2643221591 | 2643962902 | 257 |
| 557 | iso_pu_bacteria | 2821123053 | 2821124082 | 257 |
| 558 | iso_pu_bacteria | 2854896431 | 2854897122 | 257 |
| 559 | iso_pu_bacteria | 2857531043 | 2857531645 | 257 |
| 560 | 3300005549 | Ga0070704_100490021 | Ga0070704_1004900211 | 258 |
| 561 | 3300005983 | Ga0081540_1040244 | Ga0081540_10402442 | 258 |
| 562 | 3300006175 | Ga0070712_100047161 | Ga0070712_1000471612 | 258 |
| 563 | 3300009553 | Ga0105249_10056111 | Ga0105249_100561114 | 258 |
| 564 | 3300025915 | Ga0207693_10124056 | Ga0207693_101240562 | 258 |
| 565 | 3300025961 | Ga0207712_10436686 | Ga0207712_104366861 | 258 |
| 566 | 3300025972 | Ga0207668_10148064 | Ga0207668_101480642 | 258 |
| 567 | 3300035695 | Ga0373927_0077816 | Ga0373927_0077816_319_1161 | 258 |
| 568 | 3300037068 | Ga0373925_0160375 | Ga0373925_0160375_337_1179 | 258 |
| 569 | 3300046681 | Ga0495647_0057890 | Ga0495647_0057890_503_1351 | 258 |
| 570 | 3300050512 | nmdc:mga0n895_56490_c2 | nmdc:mga0n895_56490_c2_746_1567 | 258 |
| 571 | 3300053087 | Ga0500643_008044 | Ga0500643_008044_886_1707 | 258 |
| 572 | 3300053094 | Ga0500566_0032329 | Ga0500566_0032329_707_1528 | 258 |
| 573 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_113761_114582 | 258 |
| 574 | 3300053131 | Ga0500652_008214 | Ga0500652_008214_265_1086 | 258 |
| 575 | 3300053730 | Ga0500645_001078 | Ga0500645_001078_4168_4989 | 258 |
| 576 | iso_pu_bacteria | 2510461069 | 2510842852 | 258 |
| 577 | 3300003215 | JGI25153J46596_10001453 | JGI25153J46596_100014532 | 259 |
| 578 | 3300005440 | Ga0070705_100365203 | Ga0070705_1003652032 | 259 |
| 579 | 3300005545 | Ga0070695_100284146 | Ga0070695_1002841462 | 259 |
| 580 | 3300005546 | Ga0070696_100006859 | Ga0070696_1000068598 | 259 |
| 581 | 3300025297 | Ga0209758_1000223 | Ga0209758_100022340 | 259 |
| 582 | 3300053153 | Ga0500616_0023203 | Ga0500616_0023203_526_1368 | 259 |
| 583 | iso_pu_bacteria | 2738543031 | 2739349957 | 259 |
| 584 | iso_pu_bacteria | 2854916844 | 2854918260 | 259 |
| 585 | iso_pu_bacteria | 2919166419 | 2919167326 | 259 |
| 586 | iso_pu_bacteria | 2919171160 | 2919171480 | 259 |
| 587 | 3300006195 | Ga0075366_10027788 | Ga0075366_100277882 | 260 |
| 588 | 3300006844 | Ga0075428_100016992 | Ga0075428_1000169925 | 260 |
| 589 | 3300046491 | Ga0495584_0120977 | Ga0495584_0120977_132_971 | 260 |
| 590 | 3300048903 | Ga0496100_0002959 | Ga0496100_0002959_2245_3081 | 260 |
| 591 | 3300048907 | Ga0496104_0080605 | Ga0496104_0080605_150_986 | 260 |
| 592 | 3300048908 | Ga0496105_0114632 | Ga0496105_0114632_1208_2044 | 260 |
| 593 | 3300048909 | Ga0496106_0027990 | Ga0496106_0027990_612_1448 | 260 |
| 594 | 3300048911 | Ga0496108_0003119 | Ga0496108_0003119_4121_4957 | 260 |
| 595 | 3300048911 | Ga0496108_0003202 | Ga0496108_0003202_8949_9785 | 260 |
| 596 | 3300048912 | Ga0496109_0003221 | Ga0496109_0003221_9634_10470 | 260 |
| 597 | 3300048912 | Ga0496109_0107421 | Ga0496109_0107421_301_1137 | 260 |
| 598 | 3300048913 | Ga0496110_0000441 | Ga0496110_0000441_9167_10003 | 260 |
| 599 | 3300048913 | Ga0496110_0003067 | Ga0496110_0003067_1501_2337 | 260 |
| 600 | 3300048914 | Ga0496111_0009662 | Ga0496111_0009662_1803_2639 | 260 |
| 601 | 3300048914 | Ga0496111_0013311 | Ga0496111_0013311_3166_4002 | 260 |
| 602 | 3300048915 | Ga0496112_0012961 | Ga0496112_0012961_3646_4482 | 260 |
| 603 | 3300048915 | Ga0496112_0017810 | Ga0496112_0017810_3855_4691 | 260 |
| 604 | 3300048916 | Ga0496113_0146356 | Ga0496113_0146356_959_1795 | 260 |
| 605 | 3300048918 | Ga0496115_0014998 | Ga0496115_0014998_381_1217 | 260 |
| 606 | 3300049743 | Ga0501081_0463943 | Ga0501081_0463943_61_903 | 260 |
| 607 | 3300006844 | Ga0075428_100209789 | Ga0075428_1002097893 | 261 |
| 608 | 3300006946 | Ga0079104_1000010 | Ga0079104_1000010144 | 261 |
| 609 | 3300010375 | Ga0105239_10189397 | Ga0105239_101893972 | 261 |
| 610 | 3300017792 | Ga0163161_10395886 | Ga0163161_103958862 | 261 |
| 611 | 3300027111 | Ga0209281_1000078 | Ga0209281_100007826 | 261 |
| 612 | 3300028379 | Ga0268266_10747861 | Ga0268266_107478611 | 261 |
| 613 | 3300048907 | Ga0496104_0080731 | Ga0496104_0080731_1688_2530 | 261 |
| 614 | 3300048911 | Ga0496108_0122586 | Ga0496108_0122586_102_944 | 261 |
| 615 | 3300048913 | Ga0496110_0072267 | Ga0496110_0072267_960_1802 | 261 |
| 616 | 3300048913 | Ga0496110_0273469 | Ga0496110_0273469_193_1008 | 261 |
| 617 | 3300048914 | Ga0496111_0168603 | Ga0496111_0168603_592_1434 | 261 |
| 618 | 3300048924 | Ga0496121_0011173 | Ga0496121_0011173_7862_8680 | 261 |
| 619 | 3300048927 | Ga0496124_0041577 | Ga0496124_0041577_325_1143 | 261 |
| 620 | 3300048928 | Ga0496125_0000180 | Ga0496125_0000180_114872_115687 | 261 |
| 621 | 3300050510 | nmdc:mga06r32_203117_c1 | nmdc:mga06r32_203117_c1_349_1191 | 261 |
| 622 | 3300053153 | Ga0500616_0000949 | Ga0500616_0000949_926_1738 | 261 |
| 623 | 3300009147 | Ga0114129_10063256 | Ga0114129_100632564 | 262 |
| 624 | 3300025939 | Ga0207665_10038422 | Ga0207665_100384223 | 262 |
| 625 | 3300035111 | Ga0373923_0006894 | Ga0373923_0006894_1035_1895 | 262 |
| 626 | 3300035113 | Ga0373936_0001699 | Ga0373936_0001699_2590_3450 | 262 |
| 627 | 3300035117 | Ga0373953_0030324 | Ga0373953_0030324_1160_2020 | 262 |
| 628 | 3300035118 | Ga0373954_0000751 | Ga0373954_0000751_9156_10016 | 262 |
| 629 | 3300035119 | Ga0373956_0043891 | Ga0373956_0043891_891_1751 | 262 |
| 630 | 3300035170 | Ga0373943_0008319 | Ga0373943_0008319_2258_3118 | 262 |
| 631 | 3300035171 | Ga0373946_0006737 | Ga0373946_0006737_706_1566 | 262 |
| 632 | 3300035172 | Ga0373955_0276130 | Ga0373955_0276130_98_958 | 262 |
| 633 | 3300035410 | Ga0373924_0041422 | Ga0373924_0041422_138_998 | 262 |
| 634 | 3300035692 | Ga0373935_0000086 | Ga0373935_0000086_26120_26980 | 262 |
| 635 | 3300035724 | Ga0373933_0006542 | Ga0373933_0006542_4694_5554 | 262 |
| 636 | 3300035725 | Ga0373947_0000096 | Ga0373947_0000096_30301_31161 | 262 |
| 637 | 3300036401 | Ga0373937_0000198 | Ga0373937_0000198_29894_30754 | 262 |
| 638 | 3300037068 | Ga0373925_0000071 | Ga0373925_0000071_21196_22056 | 262 |
| 639 | 3300046454 | Ga0495592_0000117 | Ga0495592_0000117_25738_26598 | 262 |
| 640 | 3300046459 | Ga0495629_0005598 | Ga0495629_0005598_8369_9229 | 262 |
| 641 | 3300046462 | Ga0495651_0000370 | Ga0495651_0000370_18343_19203 | 262 |
| 642 | 3300046463 | Ga0495653_0000047 | Ga0495653_0000047_78821_79681 | 262 |
| 643 | 3300046476 | Ga0495662_0096788 | Ga0495662_0096788_85_945 | 262 |
| 644 | 3300046477 | Ga0495664_0000024 | Ga0495664_0000024_49668_50528 | 262 |
| 645 | 3300046511 | Ga0495608_0000004 | Ga0495608_0000004_92498_93358 | 262 |
| 646 | 3300046514 | Ga0495618_0000036 | Ga0495618_0000036_43308_44168 | 262 |
| 647 | 3300046516 | Ga0495628_0000006 | Ga0495628_0000006_57375_58235 | 262 |
| 648 | 3300046517 | Ga0495630_0000647 | Ga0495630_0000647_9854_10714 | 262 |
| 649 | 3300046529 | Ga0495652_0000038 | Ga0495652_0000038_52386_53246 | 262 |
| 650 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_40885_41745 | 262 |
| 651 | 3300046536 | Ga0495587_0000004 | Ga0495587_0000004_95963_96823 | 262 |
| 652 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_261758_262618 | 262 |
| 653 | 3300046559 | Ga0495667_0000093 | Ga0495667_0000093_43504_44364 | 262 |
| 654 | 3300046642 | Ga0495634_0000133 | Ga0495634_0000133_25728_26588 | 262 |
| 655 | 3300046663 | Ga0495635_0000003 | Ga0495635_0000003_261389_262249 | 262 |
| 656 | 3300046675 | Ga0495657_0000143 | Ga0495657_0000143_25695_26555 | 262 |
| 657 | 3300046678 | Ga0495599_0000012 | Ga0495599_0000012_35977_36837 | 262 |
| 658 | 3300046679 | Ga0495623_0000015 | Ga0495623_0000015_73040_73900 | 262 |
| 659 | 3300046680 | Ga0495646_0000005 | Ga0495646_0000005_173929_174789 | 262 |
| 660 | 3300046689 | Ga0495613_0049291 | Ga0495613_0049291_78_938 | 262 |
| 661 | 3300046809 | Ga0495600_0000051 | Ga0495600_0000051_28873_29733 | 262 |
| 662 | 3300047315 | Ga0495581_0024892 | Ga0495581_0024892_2042_2902 | 262 |
| 663 | 3300047317 | Ga0495604_0000002 | Ga0495604_0000002_268400_269260 | 262 |
| 664 | 3300047319 | Ga0495674_0000004 | Ga0495674_0000004_267949_268809 | 262 |
| 665 | 3300047322 | Ga0495680_0000142 | Ga0495680_0000142_56400_57260 | 262 |
| 666 | 3300047444 | Ga0495675_0000824 | Ga0495675_0000824_2540_3400 | 262 |
| 667 | 3300047471 | Ga0495684_0000004 | Ga0495684_0000004_248825_249685 | 262 |
| 668 | 3300047673 | Ga0495593_0001806 | Ga0495593_0001806_11791_12651 | 262 |
| 669 | 3300048088 | Ga0495602_0000001 | Ga0495602_0000001_261431_262291 | 262 |
| 670 | 3300053077 | Ga0495601_0000026 | Ga0495601_0000026_49460_50320 | 262 |
| 671 | 3300053078 | Ga0495612_0000005 | Ga0495612_0000005_37712_38572 | 262 |
| 672 | 3300053084 | Ga0495595_0000058 | Ga0495595_0000058_31923_32783 | 262 |
| 673 | 3300053085 | Ga0495619_0000003 | Ga0495619_0000003_266553_267413 | 262 |
| 674 | 3300053130 | Ga0500642_0028181 | Ga0500642_0028181_909_1814 | 262 |
| 675 | 3300003187 | JGI25151J46595_10011179 | JGI25151J46595_100111791 | 263 |
| 676 | 3300005353 | Ga0070669_100202067 | Ga0070669_1002020671 | 263 |
| 677 | 3300005548 | Ga0070665_100013778 | Ga0070665_1000137784 | 263 |
| 678 | 3300006051 | Ga0075364_10011379 | Ga0075364_100113793 | 263 |
| 679 | 3300006178 | Ga0075367_10081989 | Ga0075367_100819892 | 263 |
| 680 | 3300006186 | Ga0075369_10001766 | Ga0075369_100017666 | 263 |
| 681 | 3300006195 | Ga0075366_10097275 | Ga0075366_100972752 | 263 |
| 682 | 3300007788 | Ga0099795_10016233 | Ga0099795_100162333 | 263 |
| 683 | 3300009148 | Ga0105243_10015381 | Ga0105243_100153816 | 263 |
| 684 | 3300013100 | Ga0157373_10002050 | Ga0157373_100020506 | 263 |
| 685 | 3300013102 | Ga0157371_10000380 | Ga0157371_1000038032 | 263 |
| 686 | 3300013104 | Ga0157370_10000748 | Ga0157370_1000074817 | 263 |
| 687 | 3300025294 | Ga0209025_1000074 | Ga0209025_1000074213 | 263 |
| 688 | 3300025294 | Ga0209025_1000080 | Ga0209025_100008080 | 263 |
| 689 | 3300025297 | Ga0209758_1002322 | Ga0209758_10023224 | 263 |
| 690 | 3300025297 | Ga0209758_1011638 | Ga0209758_10116385 | 263 |
| 691 | 3300025298 | Ga0209050_1015422 | Ga0209050_10154223 | 263 |
| 692 | 3300025303 | Ga0209051_1002851 | Ga0209051_10028512 | 263 |
| 693 | 3300025304 | Ga0209257_1002587 | Ga0209257_100258713 | 263 |
| 694 | 3300027512 | Ga0209179_1002629 | Ga0209179_10026292 | 263 |
| 695 | 3300028379 | Ga0268266_10002687 | Ga0268266_100026878 | 263 |
| 696 | 3300030744 | Ga0316181_1162723 | Ga0316181_11627234 | 263 |
| 697 | 3300048919 | Ga0496116_0108471 | Ga0496116_0108471_145_963 | 263 |
| 698 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1529941_1530759 | 263 |
| 699 | 3300048921 | Ga0496118_0000214 | Ga0496118_0000214_18231_19049 | 263 |
| 700 | 3300048922 | Ga0496119_0033566 | Ga0496119_0033566_1682_2500 | 263 |
| 701 | 3300048923 | Ga0496120_0000125 | Ga0496120_0000125_98588_99406 | 263 |
| 702 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_900730_901548 | 263 |
| 703 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_904461_905279 | 263 |
| 704 | 3300048927 | Ga0496124_0007143 | Ga0496124_0007143_689_1507 | 263 |
| 705 | 3300048928 | Ga0496125_0041483 | Ga0496125_0041483_1705_2523 | 263 |
| 706 | 3300048929 | Ga0496126_0204233 | Ga0496126_0204233_139_957 | 263 |
| 707 | 3300050491 | nmdc:mga00v17_187_c1 | nmdc:mga00v17_187_c1_22486_23304 | 263 |
| 708 | 3300050491 | nmdc:mga00v17_45908_c1 | nmdc:mga00v17_45908_c1_498_1316 | 263 |
| 709 | 3300050492 | nmdc:mga0yw44_24154_c1 | nmdc:mga0yw44_24154_c1_864_1682 | 263 |
| 710 | 3300050492 | nmdc:mga0yw44_2601_c1 | nmdc:mga0yw44_2601_c1_4410_5231 | 263 |
| 711 | 3300050494 | nmdc:mga06z11_83395_c1 | nmdc:mga06z11_83395_c1_449_1267 | 263 |
| 712 | 3300050516 | nmdc:mga0sz30_150_c1 | nmdc:mga0sz30_150_c1_144_962 | 263 |
| 713 | 3300050516 | nmdc:mga0sz30_21896_c1 | nmdc:mga0sz30_21896_c1_59_877 | 263 |
| 714 | 3300053137 | Ga0500561_0000283 | Ga0500561_0000283_4599_5417 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
104
279
0.95
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.7456 | 61 | 253 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.686 | 62 | 247 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.6828 | 61 | 256 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.6795 | 61 | 253 |
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.6718 | 22 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9048 | 69 | 249 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9008 | 71 | 251 | 1.10.3720.10 |
| af_Q2FVG9_10_202_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9005 | 68 | 250 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8898 | 73 | 250 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8736 | 68 | 252 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4FIS4-F1-model_v4 | ABC transporter permease | 0.9464 | 23 | 261 |
GO:0005886
GO:0055085 |
| AF-A0A2D6YM04-F1-model_v4 | ABC transporter permease | 0.9441 | 19 | 259 |
GO:0005886
GO:0055085 |
| AF-A0A6N7GG86-F1-model_v4 | ABC transporter permease subunit | 0.944 | 48 | 260 |
GO:0005886
GO:0055085 |
| AF-A0A1E7TV73-F1-model_v4 | deleted | 0.9405 | 31 | 256 |
|
| AF-A0A2E2DT26-F1-model_v4 | deleted | 0.9404 | 32 | 260 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar