F476940

General Info

Members Datasets Scaffolds Average Seq Length
714 361 695 259

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10063256|Ga0114129_100632564
Length 294
Sequence VRPEPHYDEDCNMSVIQVAETLEASPIRRRQSLFLKKSVRHSLPWLVIGLLFLLWEIAVRTFAIPEFVLPAPSAIFAAAWEFRAGILDNAWQTLFTTAIGFVIAIVFGVVGGVAIGSSPLVYQGFYPALIGFNSIPKVAIVPILVIWFGVGTIPAIITAFLISFFPILVNVATGIATLEPELRDVLRALGASRFKVITKVGLPRAMPYFFASLKIAVTVAFIGSIVSETVAANRGIGHLMLVASARFEVPLAFAALLVTGAMGVGMYAIAGAFERHMTGWAVRGINGVGLTPQG

Samples

Sample ID Description Type Environment
1 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
4 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
5 2643221591 Devosia sp. Root685 Isolate Unclassified
6 2643221733 Bosea sp. Root381 Isolate Unclassified
7 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
8 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
9 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
10 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
11 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
12 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
13 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
14 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
15 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
16 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
17 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
237 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
258 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
338 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
346 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
347 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
348 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
349 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
353 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
354 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
360 639633007 Azoarcus olearius BH72 Isolate Unclassified
361 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 0
Isolates 2.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7
Nodule 0.84
Rhizoplane 9.38
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10011179 3300003187 Bacteria 4134
2 JGI25406J46586_10048618 3300003203 Bacteria 1437
3 JGI25153J46596_10001453 3300003215 Bacteria 14169
4 rootL2_10000581 3300003322 Bacteria 1682
5 Ga0065712_10069608 3300005290 Bacteria 6977
6 Ga0070683_100116237 3300005329 Bacteria 2525
7 Ga0070690_100017371 3300005330 Bacteria 4325
8 Ga0070690_100094459 3300005330 Bacteria 1973
9 Ga0070690_100288032 3300005330 Unclassified 1174
10 Ga0070670_100000725 3300005331 Bacteria 25600
11 Ga0070680_100032118 3300005336 Bacteria 4223
12 Ga0068868_100031126 3300005338 Bacteria 4096
13 Ga0070687_100370820 3300005343 Bacteria 930
14 Ga0070661_100028049 3300005344 Bacteria 4059
15 Ga0070668_100241806 3300005347 Bacteria 1495
16 Ga0070669_100202067 3300005353 Bacteria 1564
17 Ga0070675_100265426 3300005354 Bacteria 1505
18 Ga0070675_100414273 3300005354 Unclassified 1204
19 Ga0070671_100066381 3300005355 Bacteria 3007
20 Ga0070671_100112883 3300005355 Bacteria 2283
21 Ga0070673_100277222 3300005364 Bacteria 1469
22 Ga0070688_100226098 3300005365 Bacteria 1321
23 Ga0070688_100274645 3300005365 Bacteria 1208
24 Ga0070688_100462212 3300005365 Bacteria 951
25 Ga0070659_100189118 3300005366 Bacteria 1691
26 Ga0070659_100190179 3300005366 Bacteria 1687
27 Ga0070659_100475550 3300005366 Bacteria 1063
28 Ga0070667_100028854 3300005367 Bacteria 4620
29 Ga0070667_100133196 3300005367 Bacteria 2171
30 Ga0070709_10021066 3300005434 Bacteria 3794
31 Ga0070709_10083604 3300005434 Bacteria 2088
32 Ga0070709_10108537 3300005434 Bacteria 1862
33 Ga0070714_100028036 3300005435 Bacteria 4668
34 Ga0070713_100000550 3300005436 Bacteria 23862
35 Ga0070713_100021301 3300005436 Bacteria 4983
36 Ga0070713_100043618 3300005436 Bacteria 3667
37 Ga0070713_100104000 3300005436 Bacteria 2465
38 Ga0070713_100128811 3300005436 Bacteria 2229
39 Ga0070710_10001391 3300005437 Bacteria 11419
40 Ga0070711_100022169 3300005439 Bacteria 4113
41 Ga0070711_100062344 3300005439 Bacteria 2598
42 Ga0070711_100151821 3300005439 Bacteria 1747
43 Ga0070711_100319265 3300005439 Bacteria 1240
44 Ga0070711_100386871 3300005439 Bacteria 1132
45 Ga0070705_100215980 3300005440 Bacteria 1325
46 Ga0070705_100365203 3300005440 Bacteria 1057
47 Ga0070700_100025387 3300005441 Bacteria 3488
48 Ga0070700_100167445 3300005441 Bacteria 1519
49 Ga0070700_100181908 3300005441 Unclassified 1464
50 Ga0070694_100025036 3300005444 Bacteria 3857
51 Ga0070694_100068923 3300005444 Bacteria 2432
52 Ga0070663_100038861 3300005455 Bacteria 3322
53 Ga0070663_100145095 3300005455 Bacteria 1815
54 Ga0070678_100174090 3300005456 Bacteria 1756
55 Ga0070662_100107414 3300005457 Bacteria 2122
56 Ga0070662_100225242 3300005457 Bacteria 1498
57 Ga0070681_10028847 3300005458 Bacteria 5576
58 Ga0070681_10090746 3300005458 Bacteria 3005
59 Ga0070681_10142988 3300005458 Bacteria 2322
60 Ga0070685_10003366 3300005466 Bacteria 8135
61 Ga0070699_100303955 3300005518 Bacteria 1431
62 Ga0070699_100772055 3300005518 Bacteria 879
63 Ga0070679_100023809 3300005530 Bacteria 5999
64 Ga0070679_100233505 3300005530 Bacteria 1798
65 Ga0070686_100022671 3300005544 Bacteria 3744
66 Ga0070695_100002744 3300005545 Bacteria 10208
67 Ga0070695_100123514 3300005545 Bacteria 1775
68 Ga0070695_100284146 3300005545 Bacteria 1217
69 Ga0070696_100006859 3300005546 Bacteria 7600
70 Ga0070696_100010689 3300005546 Bacteria 6149
71 Ga0070696_100077142 3300005546 Bacteria 2354
72 Ga0070693_100032265 3300005547 Bacteria 2879
73 Ga0070665_100013778 3300005548 Bacteria 8135
74 Ga0070665_100517707 3300005548 Bacteria 1204
75 Ga0070704_100490021 3300005549 Bacteria 1065
76 Ga0068855_100364916 3300005563 Bacteria 1588
77 Ga0070664_100073324 3300005564 Bacteria 2937
78 Ga0070664_100134166 3300005564 Bacteria 2176
79 Ga0070664_100302826 3300005564 Bacteria 1445
80 Ga0068856_100012857 3300005614 Bacteria 8101
81 Ga0068856_100443432 3300005614 Bacteria 1319
82 Ga0070702_100151314 3300005615 Bacteria 1490
83 Ga0070702_100174959 3300005615 Bacteria 1399
84 Ga0068852_100456388 3300005616 Bacteria 1266
85 Ga0068852_100793125 3300005616 Bacteria 961
86 Ga0068864_100262459 3300005618 Bacteria 1607
87 Ga0068851_10136830 3300005834 Unclassified 1329
88 Ga0068858_100066979 3300005842 Bacteria 3325
89 Ga0068858_100204034 3300005842 Bacteria 1870
90 Ga0068860_100173155 3300005843 Bacteria 2085
91 Ga0068862_100107449 3300005844 Bacteria 2447
92 Ga0081455_10000151 3300005937 Bacteria 83439
93 Ga0081455_10003823 3300005937 Bacteria 17186
94 Ga0081455_10062198 3300005937 Bacteria 3139
95 Ga0081455_10146836 3300005937 Bacteria 1823
96 Ga0081538_10045879 3300005981 Bacteria 2703
97 Ga0081540_1004764 3300005983 Bacteria 10243
98 Ga0081540_1040244 3300005983 Bacteria 2438
99 Ga0081539_10000803 3300005985 Bacteria 61113
100 Ga0070717_10000150 3300006028 Bacteria 51802
101 Ga0070717_10011597 3300006028 Bacteria 6700
102 Ga0075365_10039942 3300006038 Bacteria 3058
103 Ga0075365_10084424 3300006038 Bacteria 2155
104 Ga0075365_10228289 3300006038 Bacteria 1306
105 Ga0075364_10011379 3300006051 Bacteria 5406
106 Ga0075364_10037522 3300006051 Bacteria 3138
107 Ga0075432_10000665 3300006058 Bacteria 10537
108 Ga0070715_10000967 3300006163 Bacteria 8011
109 Ga0070715_10014104 3300006163 Bacteria 2951
110 Ga0070716_100043881 3300006173 Bacteria 2502
111 Ga0070716_100313921 3300006173 Bacteria 1096
112 Ga0070712_100004012 3300006175 Bacteria 9044
113 Ga0070712_100047161 3300006175 Bacteria 2981
114 Ga0070712_100105322 3300006175 Bacteria 2094
115 Ga0070712_100139899 3300006175 Bacteria 1846
116 Ga0070712_100320963 3300006175 Bacteria 1259
117 Ga0070712_100404518 3300006175 Bacteria 1128
118 Ga0075367_10081989 3300006178 Bacteria 1952
119 Ga0075367_10179961 3300006178 Bacteria 1318
120 Ga0075369_10001766 3300006186 Bacteria 7509
121 Ga0075366_10027788 3300006195 Bacteria 3320
122 Ga0075366_10097275 3300006195 Bacteria 1765
123 Ga0097621_100074880 3300006237 Bacteria 2804
124 Ga0068871_100103835 3300006358 Bacteria 2383
125 Ga0075428_100003032 3300006844 Bacteria 18343
126 Ga0075428_100016992 3300006844 Bacteria 8038
127 Ga0075428_100091698 3300006844 Bacteria 3313
128 Ga0075428_100117704 3300006844 Unclassified 2894
129 Ga0075428_100209789 3300006844 Bacteria 2105
130 Ga0075428_100519168 3300006844 Bacteria 1274
131 Ga0075430_100000587 3300006846 Bacteria 27593
132 Ga0075431_100008096 3300006847 Bacteria 10493
133 Ga0075431_100042771 3300006847 Bacteria 4674
134 Ga0075431_100166346 3300006847 Bacteria 2267
135 Ga0075431_100172342 3300006847 Bacteria 2223
136 Ga0075433_10000020 3300006852 Bacteria 61231
137 Ga0075434_100164402 3300006871 Bacteria 2239
138 Ga0075434_100170023 3300006871 Bacteria 2200
139 Ga0075434_100423924 3300006871 Bacteria 1352
140 Ga0075434_100449024 3300006871 Bacteria 1310
141 Ga0075429_100001660 3300006880 Bacteria 18412
142 Ga0075429_100246846 3300006880 Bacteria 1563
143 Ga0075429_100604303 3300006880 Bacteria 961
144 Ga0075436_100221484 3300006914 Unclassified 1343
145 Ga0079104_1000010 3300006946 Bacteria 366021
146 Ga0075435_100097104 3300007076 Bacteria 2438
147 Ga0099794_10004996 3300007265 Bacteria 5280
148 Ga0099795_10016233 3300007788 Bacteria 2351
149 Ga0105251_10106778 3300009011 Bacteria 1278
150 Ga0105240_10313559 3300009093 Bacteria 1790
151 Ga0111539_10000373 3300009094 Bacteria 55466
152 Ga0111539_10014430 3300009094 Bacteria 9860
153 Ga0111539_10056564 3300009094 Bacteria 4661
154 Ga0111539_10779354 3300009094 Bacteria 1113
155 Ga0105245_10103130 3300009098 Bacteria 2642
156 Ga0105245_10165695 3300009098 Bacteria 2101
157 Ga0105247_10017947 3300009101 Bacteria 4245
158 Ga0105247_10032174 3300009101 Bacteria 3187
159 Ga0105247_10079479 3300009101 Bacteria 2064
160 Ga0114129_10008524 3300009147 Bacteria 14611
161 Ga0114129_10063256 3300009147 Bacteria 5168
162 Ga0114129_10138946 3300009147 Bacteria 3332
163 Ga0105243_10015381 3300009148 Bacteria 5787
164 Ga0105243_10105133 3300009148 Bacteria 2351
165 Ga0105241_10103883 3300009174 Bacteria 2263
166 Ga0105242_10029702 3300009176 Bacteria 4360
167 Ga0105242_10190895 3300009176 Bacteria 1813
168 Ga0105242_10241245 3300009176 Bacteria 1625
169 Ga0105248_10027809 3300009177 Bacteria 6295
170 Ga0105248_10030287 3300009177 Bacteria 6042
171 Ga0105237_10057439 3300009545 Bacteria 3895
172 Ga0105237_10232450 3300009545 Bacteria 1844
173 Ga0105238_10113365 3300009551 Bacteria 2691
174 Ga0105249_10037876 3300009553 Bacteria 4376
175 Ga0105249_10056111 3300009553 Bacteria 3606
176 Ga0105239_10117853 3300010375 Bacteria 2947
177 Ga0105239_10189397 3300010375 Bacteria 2303
178 Ga0105239_10206762 3300010375 Bacteria 2200
179 Ga0105246_10131138 3300011119 Bacteria 1873
180 Ga0105246_10185335 3300011119 Bacteria 1606
181 Ga0157373_10002050 3300013100 Bacteria 15264
182 Ga0157373_10199073 3300013100 Bacteria 1412
183 Ga0157371_10000380 3300013102 Bacteria 55836
184 Ga0157371_10029143 3300013102 Bacteria 3995
185 Ga0157370_10000748 3300013104 Bacteria 40596
186 Ga0157370_10290289 3300013104 Unclassified 1511
187 Ga0157370_10616500 3300013104 Unclassified 993
188 Ga0157369_10030046 3300013105 Bacteria 5996
189 Ga0157369_10136236 3300013105 Bacteria 2599
190 Ga0157369_10785478 3300013105 Bacteria 979
191 Ga0157374_10051951 3300013296 Bacteria 3815
192 Ga0157374_10866535 3300013296 Bacteria 920
193 Ga0157378_10096546 3300013297 Bacteria 2693
194 Ga0163162_10142571 3300013306 Bacteria 2510
195 Ga0157372_10248405 3300013307 Bacteria 2065
196 Ga0157372_10455554 3300013307 Bacteria 1491
197 Ga0163163_10006448 3300014325 Bacteria 10262
198 Ga0163163_10017610 3300014325 Bacteria 6668
199 Ga0157380_10181281 3300014326 Bacteria 1850
200 Ga0157377_10044714 3300014745 Bacteria 2470
201 Ga0157379_10018740 3300014968 Bacteria 6104
202 Ga0157379_10037217 3300014968 Bacteria 4338
203 Ga0157376_10064616 3300014969 Bacteria 3087
204 Ga0163161_10066517 3300017792 Bacteria 2632
205 Ga0163161_10265282 3300017792 Bacteria 1342
206 Ga0163161_10395886 3300017792 Bacteria 1107
207 Ga0209025_1000074 3300025294 Bacteria 277445
208 Ga0209025_1000080 3300025294 Bacteria 267244
209 Ga0209758_1000223 3300025297 Bacteria 122584
210 Ga0209758_1002322 3300025297 Bacteria 19664
211 Ga0209758_1011638 3300025297 Bacteria 5063
212 Ga0209050_1015422 3300025298 Bacteria 3212
213 Ga0209051_1002851 3300025303 Bacteria 11913
214 Ga0209257_1002587 3300025304 Bacteria 17594
215 Ga0207653_10005827 3300025885 Bacteria 3845
216 Ga0207692_10011833 3300025898 Bacteria 3729
217 Ga0207692_10020246 3300025898 Bacteria 3022
218 Ga0207692_10045206 3300025898 Bacteria 2201
219 Ga0207692_10109771 3300025898 Bacteria 1528
220 Ga0207710_10026292 3300025900 Bacteria 2514
221 Ga0207688_10141195 3300025901 Bacteria 1418
222 Ga0207680_10205830 3300025903 Bacteria 1343
223 Ga0207647_10278634 3300025904 Bacteria 955
224 Ga0207685_10008065 3300025905 Bacteria 2977
225 Ga0207685_10012920 3300025905 Bacteria 2566
226 Ga0207685_10079496 3300025905 Bacteria 1353
227 Ga0207699_10005642 3300025906 Bacteria 6007
228 Ga0207699_10039047 3300025906 Bacteria 2725
229 Ga0207699_10176664 3300025906 Bacteria 1432
230 Ga0207645_10127926 3300025907 Bacteria 1652
231 Ga0207654_10022166 3300025911 Bacteria 3385
232 Ga0207654_10040799 3300025911 Bacteria 2617
233 Ga0207707_10003237 3300025912 Bacteria 14459
234 Ga0207671_10062226 3300025914 Bacteria 2771
235 Ga0207671_10219058 3300025914 Bacteria 1491
236 Ga0207693_10001763 3300025915 Bacteria 18986
237 Ga0207693_10009968 3300025915 Bacteria 7724
238 Ga0207693_10011822 3300025915 Bacteria 7055
239 Ga0207693_10085574 3300025915 Bacteria 2469
240 Ga0207693_10123504 3300025915 Bacteria 2034
241 Ga0207693_10124056 3300025915 Bacteria 2029
242 Ga0207693_10308975 3300025915 Bacteria 1238
243 Ga0207663_10008055 3300025916 Bacteria 5491
244 Ga0207663_10033763 3300025916 Bacteria 3052
245 Ga0207663_10039065 3300025916 Bacteria 2873
246 Ga0207663_10060283 3300025916 Bacteria 2404
247 Ga0207660_10017175 3300025917 Bacteria 4802
248 Ga0207660_10142108 3300025917 Bacteria 1836
249 Ga0207657_10059369 3300025919 Bacteria 3287
250 Ga0207652_10168272 3300025921 Bacteria 1966
251 Ga0207652_10349028 3300025921 Bacteria 1335
252 Ga0207652_10469094 3300025921 Bacteria 1134
253 Ga0207694_10037464 3300025924 Bacteria 3725
254 Ga0207687_10040092 3300025927 Bacteria 3209
255 Ga0207687_10134032 3300025927 Bacteria 1871
256 Ga0207700_10027048 3300025928 Bacteria 4010
257 Ga0207700_10049864 3300025928 Bacteria 3116
258 Ga0207700_10054575 3300025928 Bacteria 3000
259 Ga0207664_10033634 3300025929 Bacteria 3941
260 Ga0207664_10059208 3300025929 Bacteria 3049
261 Ga0207664_10065036 3300025929 Bacteria 2919
262 Ga0207664_10145653 3300025929 Bacteria 2008
263 Ga0207664_10282550 3300025929 Unclassified 1456
264 Ga0207664_10393264 3300025929 Bacteria 1232
265 Ga0207690_10032375 3300025932 Bacteria 3355
266 Ga0207706_10017172 3300025933 Bacteria 6526
267 Ga0207686_10185336 3300025934 Unclassified 1479
268 Ga0207704_10040421 3300025938 Bacteria 2726
269 Ga0207665_10000228 3300025939 Bacteria 38348
270 Ga0207665_10002785 3300025939 Bacteria 11719
271 Ga0207665_10038422 3300025939 Bacteria 3187
272 Ga0207665_10096091 3300025939 Bacteria 2060
273 Ga0207665_10333274 3300025939 Bacteria 1142
274 Ga0207691_10188433 3300025940 Bacteria 1800
275 Ga0207711_10044811 3300025941 Bacteria 3778
276 Ga0207711_10101378 3300025941 Bacteria 2548
277 Ga0207689_10077955 3300025942 Bacteria 2723
278 Ga0207661_10045706 3300025944 Bacteria 3468
279 Ga0207661_10381646 3300025944 Bacteria 1275
280 Ga0207679_10050621 3300025945 Bacteria 3036
281 Ga0207679_10077869 3300025945 Bacteria 2524
282 Ga0207679_10252622 3300025945 Bacteria 1500
283 Ga0207667_10053509 3300025949 Bacteria 4248
284 Ga0207712_10073594 3300025961 Bacteria 2465
285 Ga0207712_10436686 3300025961 Bacteria 1107
286 Ga0207668_10148064 3300025972 Bacteria 1814
287 Ga0207703_10177238 3300026035 Bacteria 1879
288 Ga0207703_10276456 3300026035 Bacteria 1523
289 Ga0207703_10322309 3300026035 Bacteria 1415
290 Ga0207678_10013871 3300026067 Bacteria 7079
291 Ga0207678_10078763 3300026067 Bacteria 2822
292 Ga0207708_10040934 3300026075 Bacteria 3534
293 Ga0207708_10143143 3300026075 Bacteria 1877
294 Ga0207702_10007306 3300026078 Bacteria 9443
295 Ga0207676_10039983 3300026095 Bacteria 3591
296 Ga0207676_10245298 3300026095 Bacteria 1609
297 Ga0207675_100243518 3300026118 Bacteria 1738
298 Ga0207683_10020028 3300026121 Bacteria 5717
299 Ga0207683_10241618 3300026121 Bacteria 1647
300 Ga0207698_10562599 3300026142 Bacteria 1119
301 Ga0209281_1000078 3300027111 Bacteria 261622
302 Ga0209179_1002629 3300027512 Bacteria 2462
303 Ga0209998_10004731 3300027717 Bacteria 2878
304 Ga0209974_10011673 3300027876 Bacteria 2947
305 Ga0209974_10057892 3300027876 Bacteria 1309
306 Ga0207428_10000172 3300027907 Bacteria 90200
307 Ga0207428_10021624 3300027907 Bacteria 5443
308 Ga0207428_10084354 3300027907 Bacteria 2476
309 Ga0268266_10002687 3300028379 Bacteria 18670
310 Ga0268266_10747861 3300028379 Bacteria 943
311 Ga0316181_1162723 3300030744 Bacteria 5107
312 Ga0265332_10006577 3300031238 Bacteria 5270
313 Ga0265332_10007158 3300031238 Bacteria 5053
314 Ga0265325_10039642 3300031241 Bacteria 2479
315 Ga0265329_10017186 3300031242 Bacteria 2494
316 Ga0265340_10002525 3300031247 Bacteria 10395
317 Ga0307408_100121415 3300031548 Bacteria 2025
318 Ga0265314_10001423 3300031711 Bacteria 26797
319 Ga0265342_10000039 3300031712 Bacteria 140091
320 Ga0307412_10167717 3300031911 Bacteria 1639
321 Ga0307412_10294627 3300031911 Bacteria 1279
322 Ga0307409_100232069 3300031995 Bacteria 1674
323 Ga0373958_0007804 3300034819 Bacteria 1716
324 Ga0373938_0007040 3300034957 Bacteria 1967
325 Ga0373926_0102193 3300035083 Bacteria 1072
326 Ga0373934_0005408 3300035086 Bacteria 4730
327 Ga0373940_0040445 3300035088 Unclassified 1280
328 Ga0373949_0015114 3300035090 Bacteria 1722
329 Ga0373923_0006894 3300035111 Bacteria 3960
330 Ga0373923_0032595 3300035111 Bacteria 2105
331 Ga0373932_0012530 3300035112 Bacteria 2089
332 Ga0373936_0001699 3300035113 Bacteria 8079
333 Ga0373939_0020751 3300035114 Bacteria 1790
334 Ga0373945_0006895 3300035116 Bacteria 3673
335 Ga0373953_0030324 3300035117 Bacteria 2096
336 Ga0373954_0000751 3300035118 Bacteria 12539
337 Ga0373954_0219689 3300035118 Bacteria 935
338 Ga0373956_0043891 3300035119 Bacteria 1991
339 Ga0373956_0079853 3300035119 Bacteria 1500
340 Ga0373957_0000733 3300035120 Bacteria 8526
341 Ga0373960_0009997 3300035121 Bacteria 2310
342 Ga0373943_0004643 3300035170 Bacteria 6213
343 Ga0373943_0008319 3300035170 Bacteria 4656
344 Ga0373943_0030335 3300035170 Bacteria 2558
345 Ga0373943_0031188 3300035170 Bacteria 2527
346 Ga0373946_0006737 3300035171 Bacteria 4174
347 Ga0373946_0007033 3300035171 Bacteria 4103
348 Ga0373946_0019295 3300035171 Bacteria 2627
349 Ga0373946_0089667 3300035171 Bacteria 1360
350 Ga0373955_0276130 3300035172 Bacteria 1010
351 Ga0373962_0014481 3300035242 Bacteria 2010
352 Ga0373924_0041422 3300035410 Bacteria 1887
353 Ga0373935_0000086 3300035692 Bacteria 40589
354 Ga0373935_0170460 3300035692 Bacteria 1489
355 Ga0373935_0300658 3300035692 Bacteria 1134
356 Ga0373927_0060680 3300035695 Bacteria 2447
357 Ga0373927_0077816 3300035695 Bacteria 2148
358 Ga0373933_0002170 3300035724 Bacteria 11232
359 Ga0373933_0006542 3300035724 Bacteria 6349
360 Ga0373947_0000096 3300035725 Bacteria 44841
361 Ga0373947_0031816 3300035725 Bacteria 3107
362 Ga0373937_0000198 3300036401 Bacteria 59112
363 Ga0373937_0003016 3300036401 Bacteria 14120
364 Ga0373937_0107061 3300036401 Bacteria 2599
365 Ga0373937_0179690 3300036401 Bacteria 1987
366 Ga0373925_0000071 3300037068 Bacteria 106825
367 Ga0373925_0029022 3300037068 Bacteria 4057
368 Ga0373925_0160375 3300037068 Bacteria 1771
369 Ga0373925_0195231 3300037068 Bacteria 1608
370 Ga0395900_0121087 3300037418 Bacteria 2684
371 Ga0395898_0059476 3300037466 Bacteria 3717
372 Ga0395901_0195724 3300038443 Bacteria 2120
373 Ga0436361_0769631 3300039447 Bacteria 2825
374 Ga0436362_1062509 3300039453 Bacteria 1062
375 Ga0451577_0001529 3300042876 Bacteria 30377
376 Ga0451577_0001601 3300042876 Bacteria 29482
377 Ga0466963_0104050 3300044694 Bacteria 1945
378 Ga0466957_0026026 3300044842 Bacteria 3470
379 Ga0495592_0000117 3300046454 Bacteria 69975
380 Ga0495592_0000943 3300046454 Bacteria 20225
381 Ga0495603_0033207 3300046455 Bacteria 3105
382 Ga0495629_0001744 3300046459 Bacteria 17057
383 Ga0495629_0005598 3300046459 Bacteria 9380
384 Ga0495629_0036632 3300046459 Bacteria 3461
385 Ga0495629_0159976 3300046459 Bacteria 1564
386 Ga0495638_0010059 3300046460 Bacteria 6593
387 Ga0495641_0020639 3300046461 Bacteria 3335
388 Ga0495641_0030621 3300046461 Bacteria 2578
389 Ga0495641_0032809 3300046461 Bacteria 2469
390 Ga0495651_0000370 3300046462 Bacteria 34672
391 Ga0495651_0003262 3300046462 Bacteria 12453
392 Ga0495653_0000047 3300046463 Bacteria 111093
393 Ga0495653_0007752 3300046463 Bacteria 8787
394 Ga0495653_0132873 3300046463 Bacteria 1759
395 Ga0495580_0307465 3300046472 Bacteria 1079
396 Ga0495582_0055230 3300046473 Bacteria 2189
397 Ga0495605_0105778 3300046474 Bacteria 1289
398 Ga0495662_0060585 3300046476 Bacteria 1828
399 Ga0495662_0096788 3300046476 Bacteria 1442
400 Ga0495664_0000024 3300046477 Bacteria 126593
401 Ga0495664_0042800 3300046477 Bacteria 2684
402 Ga0495664_0125858 3300046477 Bacteria 1550
403 Ga0495584_0023830 3300046491 Bacteria 3103
404 Ga0495584_0120977 3300046491 Bacteria 1326
405 Ga0495594_0022620 3300046499 Bacteria 3363
406 Ga0495608_0000004 3300046511 Bacteria 355027
407 Ga0495608_0002716 3300046511 Bacteria 12715
408 Ga0495608_0070198 3300046511 Bacteria 2286
409 Ga0495618_0000036 3300046514 Bacteria 101535
410 Ga0495618_0009781 3300046514 Bacteria 5795
411 Ga0495628_0000006 3300046516 Bacteria 306606
412 Ga0495628_0011899 3300046516 Bacteria 7336
413 Ga0495628_0136219 3300046516 Bacteria 1877
414 Ga0495630_0000647 3300046517 Bacteria 25227
415 Ga0495648_0151478 3300046524 Bacteria 1209
416 Ga0495652_0000038 3300046529 Bacteria 129311
417 Ga0495652_0017333 3300046529 Bacteria 6428
418 Ga0495652_0021127 3300046529 Bacteria 5786
419 Ga0495640_0000001 3300046533 Bacteria 853827
420 Ga0495640_0102422 3300046533 Bacteria 1878
421 Ga0495640_0216039 3300046533 Bacteria 1210
422 Ga0495586_0028908 3300046535 Unclassified 2967
423 Ga0495587_0000004 3300046536 Bacteria 358433
424 Ga0495587_0002288 3300046536 Bacteria 12837
425 Ga0495587_0019457 3300046536 Bacteria 4201
426 Ga0495621_0040224 3300046539 Bacteria 1638
427 Ga0495645_0000001 3300046543 Bacteria 657910
428 Ga0495645_0003108 3300046543 Bacteria 11252
429 Ga0495645_0045961 3300046543 Bacteria 3184
430 Ga0495633_0135242 3300046558 Bacteria 1140
431 Ga0495667_0000093 3300046559 Bacteria 65066
432 Ga0495667_0006750 3300046559 Bacteria 7789
433 Ga0495667_0037960 3300046559 Bacteria 3209
434 Ga0495667_0148309 3300046559 Bacteria 1511
435 Ga0495668_0175491 3300046616 Bacteria 1174
436 Ga0495634_0000133 3300046642 Bacteria 64326
437 Ga0495634_0081646 3300046642 Bacteria 2114
438 Ga0495635_0000003 3300046663 Bacteria 390055
439 Ga0495635_0004663 3300046663 Bacteria 9518
440 Ga0495635_0242349 3300046663 Unclassified 1216
441 Ga0495657_0000143 3300046675 Bacteria 64334
442 Ga0495657_0001806 3300046675 Bacteria 18302
443 Ga0495599_0000012 3300046678 Bacteria 181156
444 Ga0495599_0013037 3300046678 Bacteria 5131
445 Ga0495599_0177450 3300046678 Bacteria 1313
446 Ga0495623_0000015 3300046679 Bacteria 117329
447 Ga0495623_0005760 3300046679 Bacteria 8083
448 Ga0495623_0058642 3300046679 Bacteria 2420
449 Ga0495646_0000005 3300046680 Bacteria 266899
450 Ga0495646_0005112 3300046680 Bacteria 8274
451 Ga0495646_0007322 3300046680 Bacteria 7012
452 Ga0495647_0017761 3300046681 Bacteria 2522
453 Ga0495647_0057890 3300046681 Bacteria 1522
454 Ga0495647_0074544 3300046681 Bacteria 1364
455 Ga0495658_0001024 3300046683 Bacteria 14792
456 Ga0495658_0025664 3300046683 Bacteria 3152
457 Ga0495613_0046067 3300046689 Bacteria 3225
458 Ga0495613_0049291 3300046689 Bacteria 3108
459 Ga0495600_0000051 3300046809 Bacteria 69572
460 Ga0495581_0019002 3300047315 Bacteria 3988
461 Ga0495581_0024892 3300047315 Bacteria 3467
462 Ga0495581_0029576 3300047315 Bacteria 3175
463 Ga0495604_0000002 3300047317 Bacteria 530904
464 Ga0495604_0003703 3300047317 Bacteria 12176
465 Ga0495604_0010136 3300047317 Bacteria 7463
466 Ga0495674_0000004 3300047319 Bacteria 531855
467 Ga0495674_0010801 3300047319 Bacteria 8640
468 Ga0495676_0089159 3300047321 Bacteria 2311
469 Ga0495680_0000142 3300047322 Bacteria 72324
470 Ga0495680_0014220 3300047322 Bacteria 6902
471 Ga0495680_0021842 3300047322 Bacteria 5348
472 Ga0495680_0183953 3300047322 Bacteria 1507
473 Ga0495675_0000824 3300047444 Bacteria 19028
474 Ga0495675_0003237 3300047444 Bacteria 9783
475 Ga0495675_0058797 3300047444 Bacteria 2437
476 Ga0495681_0012100 3300047470 Bacteria 5086
477 Ga0495684_0000004 3300047471 Bacteria 307093
478 Ga0495684_0342975 3300047471 Bacteria 1063
479 Ga0495593_0001806 3300047673 Bacteria 12722
480 Ga0495593_0017478 3300047673 Bacteria 4037
481 Ga0495593_0071411 3300047673 Bacteria 1803
482 Ga0495602_0000001 3300048088 Bacteria 510904
483 Ga0496100_0002959 3300048903 Bacteria 8738
484 Ga0496100_0006229 3300048903 Bacteria 6491
485 Ga0496100_0036518 3300048903 Bacteria 3100
486 Ga0496100_0060962 3300048903 Bacteria 2484
487 Ga0496100_0158471 3300048903 Bacteria 1621
488 Ga0496101_0014991 3300048904 Bacteria 5216
489 Ga0496102_0017001 3300048905 Bacteria 6366
490 Ga0496102_0069464 3300048905 Bacteria 3233
491 Ga0496102_0124729 3300048905 Bacteria 2406
492 Ga0496102_0331359 3300048905 Bacteria 1434
493 Ga0496102_0481462 3300048905 Unclassified 1162
494 Ga0496102_0504132 3300048905 Unclassified 1132
495 Ga0496103_0011009 3300048906 Bacteria 5353
496 Ga0496103_0047686 3300048906 Bacteria 2647
497 Ga0496104_0002463 3300048907 Bacteria 15951
498 Ga0496104_0009345 3300048907 Bacteria 8719
499 Ga0496104_0080605 3300048907 Bacteria 3104
500 Ga0496104_0080731 3300048907 Bacteria 3101
501 Ga0496104_0118279 3300048907 Bacteria 2544
502 Ga0496105_0013402 3300048908 Bacteria 6506
503 Ga0496105_0114632 3300048908 Bacteria 2223
504 Ga0496105_0120826 3300048908 Bacteria 2160
505 Ga0496105_0232910 3300048908 Bacteria 1496
506 Ga0496105_0475106 3300048908 Bacteria 984
507 Ga0496106_0027990 3300048909 Bacteria 4196
508 Ga0496106_0058742 3300048909 Bacteria 2912
509 Ga0496106_0319434 3300048909 Bacteria 1246
510 Ga0496107_0012187 3300048910 Bacteria 5999
511 Ga0496107_0013954 3300048910 Bacteria 5621
512 Ga0496107_0016975 3300048910 Bacteria 5118
513 Ga0496108_0000521 3300048911 Bacteria 30116
514 Ga0496108_0003119 3300048911 Bacteria 13326
515 Ga0496108_0003202 3300048911 Bacteria 13163
516 Ga0496108_0016735 3300048911 Bacteria 5990
517 Ga0496108_0122586 3300048911 Bacteria 2230
518 Ga0496109_0000193 3300048912 Bacteria 60451
519 Ga0496109_0003221 3300048912 Bacteria 13593
520 Ga0496109_0004187 3300048912 Bacteria 12035
521 Ga0496109_0107421 3300048912 Bacteria 2592
522 Ga0496109_0534957 3300048912 Bacteria 1106
523 Ga0496110_0000441 3300048913 Bacteria 28247
524 Ga0496110_0003067 3300048913 Bacteria 12664
525 Ga0496110_0013165 3300048913 Bacteria 6830
526 Ga0496110_0072267 3300048913 Bacteria 3060
527 Ga0496110_0097488 3300048913 Bacteria 2634
528 Ga0496110_0166576 3300048913 Bacteria 1998
529 Ga0496110_0273469 3300048913 Bacteria 1538
530 Ga0496111_0009662 3300048914 Bacteria 6446
531 Ga0496111_0013311 3300048914 Bacteria 5594
532 Ga0496111_0017800 3300048914 Bacteria 4914
533 Ga0496111_0036646 3300048914 Bacteria 3508
534 Ga0496111_0064734 3300048914 Bacteria 2652
535 Ga0496111_0168603 3300048914 Bacteria 1626
536 Ga0496112_0005729 3300048915 Bacteria 10797
537 Ga0496112_0012961 3300048915 Bacteria 7683
538 Ga0496112_0017810 3300048915 Bacteria 6685
539 Ga0496112_0043962 3300048915 Bacteria 4374
540 Ga0496112_0180334 3300048915 Bacteria 2076
541 Ga0496113_0000245 3300048916 Bacteria 25607
542 Ga0496113_0001728 3300048916 Bacteria 12369
543 Ga0496113_0146356 3300048916 Bacteria 1861
544 Ga0496114_0003838 3300048917 Bacteria 11590
545 Ga0496114_0043144 3300048917 Bacteria 3740
546 Ga0496114_0227277 3300048917 Bacteria 1639
547 Ga0496115_0010397 3300048918 Bacteria 6951
548 Ga0496115_0014998 3300048918 Bacteria 5874
549 Ga0496115_0177691 3300048918 Bacteria 1760
550 Ga0496116_0000036 3300048919 Bacteria 388508
551 Ga0496116_0080624 3300048919 Bacteria 2020
552 Ga0496116_0108471 3300048919 Bacteria 1639
553 Ga0496117_0000002 3300048920 Bacteria 2483758
554 Ga0496117_0008869 3300048920 Bacteria 9487
555 Ga0496118_0000214 3300048921 Bacteria 100898
556 Ga0496119_0033566 3300048922 Bacteria 3399
557 Ga0496120_0000125 3300048923 Bacteria 128983
558 Ga0496120_0012194 3300048923 Bacteria 5860
559 Ga0496121_0000001 3300048924 Bacteria 1830318
560 Ga0496121_0011173 3300048924 Bacteria 10012
561 Ga0496122_0000001 3300048925 Bacteria 1827766
562 Ga0496123_0000001 3300048926 Bacteria 1831497
563 Ga0496123_0047076 3300048926 Bacteria 2918
564 Ga0496124_0007143 3300048927 Bacteria 11954
565 Ga0496124_0041577 3300048927 Bacteria 3965
566 Ga0496125_0000001 3300048928 Bacteria 1766138
567 Ga0496125_0000180 3300048928 Bacteria 138952
568 Ga0496125_0041483 3300048928 Bacteria 3932
569 Ga0496126_0000156 3300048929 Bacteria 158537
570 Ga0496126_0059922 3300048929 Bacteria 3426
571 Ga0496126_0204233 3300048929 Bacteria 1666
572 Ga0496126_0209148 3300048929 Bacteria 1643
573 Ga0501031_0221443 3300049568 Bacteria 1232
574 Ga0501032_0097409 3300049569 Bacteria 1949
575 Ga0501033_0017045 3300049570 Bacteria 5491
576 Ga0501034_0224139 3300049571 Bacteria 1831
577 Ga0501036_0036305 3300049572 Bacteria 4170
578 Ga0501037_0032929 3300049573 Bacteria 3830
579 Ga0501038_0089124 3300049574 Bacteria 2588
580 Ga0501038_0115930 3300049574 Bacteria 2214
581 Ga0501040_0027784 3300049576 Bacteria 3810
582 Ga0501041_0018427 3300049577 Bacteria 4160
583 Ga0501046_0015157 3300049580 Bacteria 6482
584 Ga0501047_0009379 3300049581 Bacteria 9245
585 Ga0501047_0051691 3300049581 Bacteria 3971
586 Ga0501048_0038408 3300049582 Bacteria 3435
587 Ga0501069_0349140 3300049585 Bacteria 872
588 Ga0501070_0097021 3300049586 Bacteria 2438
589 Ga0501070_0214492 3300049586 Bacteria 1579
590 Ga0501070_0238294 3300049586 Bacteria 1489
591 Ga0501071_0090756 3300049587 Bacteria 2244
592 Ga0501072_0048616 3300049588 Bacteria 3340
593 Ga0501072_0190718 3300049588 Bacteria 1635
594 Ga0501075_0027496 3300049591 Bacteria 4192
595 Ga0501075_0432990 3300049591 Bacteria 1003
596 Ga0501076_0036224 3300049592 Bacteria 3865
597 Ga0501080_0067192 3300049742 Bacteria 3334
598 Ga0501080_0162688 3300049742 Bacteria 2061
599 Ga0501081_0024033 3300049743 Bacteria 4089
600 Ga0501081_0144577 3300049743 Unclassified 1706
601 Ga0501081_0463943 3300049743 Bacteria 942
602 Ga0501035_0016279 3300049822 Bacteria 6861
603 Ga0501035_0129757 3300049822 Bacteria 2198
604 Ga0501035_0245719 3300049822 Bacteria 1521
605 Ga0501044_0016598 3300049823 Bacteria 7903
606 Ga0501044_0091317 3300049823 Bacteria 3071
607 Ga0501045_0000739 3300049824 Bacteria 20855
608 Ga0501045_0363535 3300049824 Bacteria 1077
609 nmdc:mga00v17_187_c1 3300050491 Bacteria 37112
610 nmdc:mga00v17_21845_c1 3300050491 Bacteria 3685
611 nmdc:mga00v17_45908_c1 3300050491 Bacteria 2641
612 nmdc:mga0yw44_165052_c1 3300050492 Bacteria 1451
613 nmdc:mga0yw44_2154_c1 3300050492 Bacteria 8264
614 nmdc:mga0yw44_24154_c1 3300050492 Bacteria 3436
615 nmdc:mga0yw44_2601_c1 3300050492 Bacteria 7754
616 nmdc:mga06z11_83395_c1 3300050494 Bacteria 1720
617 nmdc:mga07m45_155758_c1 3300050496 Bacteria 1325
618 nmdc:mga05p37_102_c1 3300050507 Bacteria 69207
619 nmdc:mga05p37_11802_c1 3300050507 Bacteria 5876
620 nmdc:mga05p37_503256_c1 3300050507 Bacteria 1390
621 nmdc:mga05p37_68171_c1 3300050507 Bacteria 4376
622 nmdc:mga05p37_7504_c2 3300050507 Bacteria 5937
623 nmdc:mga09592_235498_c1 3300050508 Bacteria 1586
624 nmdc:mga09592_431646_c1 3300050508 Bacteria 1137
625 nmdc:mga09592_433134_c1 3300050508 Bacteria 1135
626 nmdc:mga09592_716_c1 3300050508 Bacteria 25471
627 nmdc:mga0qj67_119_c1 3300050509 Bacteria 51910
628 nmdc:mga0qj67_304759_c1 3300050509 Bacteria 1290
629 nmdc:mga0qj67_7849_c1 3300050509 Bacteria 7883
630 nmdc:mga06r32_14315_c1 3300050510 Bacteria 7196
631 nmdc:mga06r32_203117_c1 3300050510 Bacteria 1969
632 nmdc:mga06r32_265661_c1 3300050510 Bacteria 1703
633 nmdc:mga06r32_2969_c1 3300050510 Bacteria 15197
634 nmdc:mga06r32_320250_c1 3300050510 Bacteria 1536
635 nmdc:mga06r32_36988_c1 3300050510 Bacteria 4618
636 nmdc:mga06r32_80542_c1 3300050510 Bacteria 3169
637 nmdc:mga08y16_26909_c1 3300050511 Bacteria 6061
638 nmdc:mga08y16_2739_c1 3300050511 Bacteria 18063
639 nmdc:mga0n895_15595_c1 3300050512 Bacteria 6935
640 nmdc:mga0n895_56080_c1 3300050512 Bacteria 3881
641 nmdc:mga0n895_56490_c2 3300050512 Bacteria 3188
642 nmdc:mga0n895_57667_c1 3300050512 Bacteria 3828
643 nmdc:mga0rr50_494_c1 3300050513 Bacteria 21000
644 nmdc:mga0rr50_58336_c1 3300050513 Bacteria 2892
645 nmdc:mga0rr50_683700_c1 3300050513 Bacteria 876
646 nmdc:mga0rr50_72138_c1 3300050513 Bacteria 2636
647 nmdc:mga08x19_200757_c1 3300050514 Bacteria 1367
648 nmdc:mga0a205_4441_c1 3300050515 Bacteria 12596
649 nmdc:mga0sz30_150_c1 3300050516 Bacteria 25823
650 nmdc:mga0sz30_21896_c1 3300050516 Bacteria 2591
651 Ga0495601_0000026 3300053077 Bacteria 126257
652 Ga0495601_0006164 3300053077 Bacteria 6998
653 Ga0495601_0028123 3300053077 Bacteria 3480
654 Ga0495601_0088744 3300053077 Bacteria 1988
655 Ga0495612_0000005 3300053078 Bacteria 286943
656 Ga0495612_0002387 3300053078 Bacteria 7744
657 Ga0495612_0005295 3300053078 Bacteria 5328
658 Ga0495655_0061394 3300053083 Bacteria 1026
659 Ga0495655_0062935 3300053083 Bacteria 1017
660 Ga0495595_0000058 3300053084 Bacteria 57705
661 Ga0495595_0023153 3300053084 Bacteria 2732
662 Ga0495595_0026857 3300053084 Bacteria 2561
663 Ga0495595_0031240 3300053084 Bacteria 2393
664 Ga0495595_0060709 3300053084 Bacteria 1770
665 Ga0495595_0074460 3300053084 Bacteria 1609
666 Ga0495619_0000003 3300053085 Bacteria 515784
667 Ga0495619_0000439 3300053085 Bacteria 28081
668 Ga0495619_0002107 3300053085 Bacteria 13189
669 Ga0495619_0022694 3300053085 Bacteria 4019
670 Ga0495619_0025324 3300053085 Bacteria 3809
671 Ga0500643_008044 3300053087 Bacteria 4178
672 Ga0500644_0001376 3300053088 Bacteria 6478
673 Ga0500651_0000898 3300053093 Bacteria 14595
674 Ga0500566_0032329 3300053094 Bacteria 3051
675 Ga0500595_000001 3300053119 Bacteria 1088438
676 Ga0500618_000990 3300053125 Bacteria 14364
677 Ga0500642_0028181 3300053130 Bacteria 2314
678 Ga0500652_008214 3300053131 Bacteria 3467
679 Ga0500561_0000283 3300053137 Bacteria 8867
680 Ga0500573_0006853 3300053140 Bacteria 6182
681 Ga0500573_0007517 3300053140 Bacteria 5947
682 Ga0500616_0000006 3300053153 Bacteria 944738
683 Ga0500616_0000949 3300053153 Bacteria 31578
684 Ga0500616_0023203 3300053153 Bacteria 3458
685 Ga0500616_0078056 3300053153 Bacteria 1671
686 Ga0500622_0036278 3300053156 Bacteria 2577
687 Ga0500624_000336 3300053157 Bacteria 15794
688 Ga0500634_0063351 3300053161 Bacteria 1956
689 Ga0500645_001078 3300053730 Bacteria 15075
690 Ga0501084_0134402 3300054114 Bacteria 2082
691 Ga0590071_007032 3300059421 Bacteria 2664
692 Ga0590077_003753 3300059426 Bacteria 3137
693 Ga0501082_0429223 3300060353 Unclassified 1154
694 Ga0501082_0602966 3300060353 Bacteria 961
695 Ga0530510_0139354 3300061734 Bacteria 1786

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026035 Ga0207703_10276456 Ga0207703_102764562 202
2 3300006175 Ga0070712_100004012 Ga0070712_1000040124 219
3 3300025915 Ga0207693_10009968 Ga0207693_100099684 219
4 3300035692 Ga0373935_0300658 Ga0373935_0300658_57_782 221
5 3300036401 Ga0373937_0107061 Ga0373937_0107061_797_1522 221
6 3300046454 Ga0495592_0000943 Ga0495592_0000943_16986_17711 221
7 3300046463 Ga0495653_0132873 Ga0495653_0132873_176_901 221
8 3300046477 Ga0495664_0042800 Ga0495664_0042800_1131_1856 221
9 3300046511 Ga0495608_0070198 Ga0495608_0070198_261_986 221
10 3300046529 Ga0495652_0017333 Ga0495652_0017333_2139_2864 221
11 3300046536 Ga0495587_0019457 Ga0495587_0019457_3151_3876 221
12 3300046543 Ga0495645_0045961 Ga0495645_0045961_563_1288 221
13 3300046559 Ga0495667_0037960 Ga0495667_0037960_102_827 221
14 3300046678 Ga0495599_0013037 Ga0495599_0013037_3184_3909 221
15 3300046679 Ga0495623_0058642 Ga0495623_0058642_452_1177 221
16 3300046680 Ga0495646_0005112 Ga0495646_0005112_3978_4703 221
17 3300047317 Ga0495604_0010136 Ga0495604_0010136_2088_2813 221
18 3300047319 Ga0495674_0010801 Ga0495674_0010801_2100_2825 221
19 3300047322 Ga0495680_0183953 Ga0495680_0183953_391_1116 221
20 3300047444 Ga0495675_0058797 Ga0495675_0058797_1035_1760 221
21 3300048918 Ga0496115_0177691 Ga0496115_0177691_992_1717 221
22 3300053077 Ga0495601_0028123 Ga0495601_0028123_986_1711 221
23 3300053078 Ga0495612_0002387 Ga0495612_0002387_6698_7423 221
24 3300053084 Ga0495595_0031240 Ga0495595_0031240_998_1723 221
25 3300053085 Ga0495619_0002107 Ga0495619_0002107_404_1129 221
26 3300059421 Ga0590071_007032 Ga0590071_007032_1405_2247 221
27 3300006847 Ga0075431_100008096 Ga0075431_10000809610 223
28 3300009098 Ga0105245_10165695 Ga0105245_101656953 223
29 3300009101 Ga0105247_10032174 Ga0105247_100321743 223
30 3300009177 Ga0105248_10027809 Ga0105248_100278096 223
31 3300014968 Ga0157379_10018740 Ga0157379_100187406 223
32 3300017792 Ga0163161_10066517 Ga0163161_100665172 223
33 3300048903 Ga0496100_0060962 Ga0496100_0060962_594_1454 223
34 3300048904 Ga0496101_0014991 Ga0496101_0014991_4329_5189 223
35 3300048905 Ga0496102_0017001 Ga0496102_0017001_2422_3282 223
36 3300048906 Ga0496103_0047686 Ga0496103_0047686_873_1733 223
37 3300048908 Ga0496105_0120826 Ga0496105_0120826_1125_1985 223
38 3300048909 Ga0496106_0058742 Ga0496106_0058742_1631_2491 223
39 3300048915 Ga0496112_0180334 Ga0496112_0180334_620_1480 223
40 3300048917 Ga0496114_0043144 Ga0496114_0043144_428_1288 223
41 3300048918 Ga0496115_0010397 Ga0496115_0010397_4706_5566 223
42 3300050508 nmdc:mga09592_431646_c1 nmdc:mga09592_431646_c1_159_1010 223
43 3300050509 nmdc:mga0qj67_7849_c1 nmdc:mga0qj67_7849_c1_6851_7702 223
44 3300050510 nmdc:mga06r32_36988_c1 nmdc:mga06r32_36988_c1_598_1449 223
45 3300005329 Ga0070683_100116237 Ga0070683_1001162372 224
46 3300005330 Ga0070690_100017371 Ga0070690_1000173711 224
47 3300005330 Ga0070690_100094459 Ga0070690_1000944592 224
48 3300005336 Ga0070680_100032118 Ga0070680_1000321183 224
49 3300005338 Ga0068868_100031126 Ga0068868_1000311266 224
50 3300005344 Ga0070661_100028049 Ga0070661_1000280494 224
51 3300005354 Ga0070675_100414273 Ga0070675_1004142731 224
52 3300005355 Ga0070671_100066381 Ga0070671_1000663812 224
53 3300005355 Ga0070671_100112883 Ga0070671_1001128833 224
54 3300005364 Ga0070673_100277222 Ga0070673_1002772222 224
55 3300005365 Ga0070688_100274645 Ga0070688_1002746452 224
56 3300005366 Ga0070659_100189118 Ga0070659_1001891182 224
57 3300005367 Ga0070667_100028854 Ga0070667_1000288543 224
58 3300005434 Ga0070709_10021066 Ga0070709_100210662 224
59 3300005434 Ga0070709_10108537 Ga0070709_101085372 224
60 3300005436 Ga0070713_100000550 Ga0070713_10000055022 224
61 3300005436 Ga0070713_100128811 Ga0070713_1001288112 224
62 3300005437 Ga0070710_10001391 Ga0070710_100013912 224
63 3300005439 Ga0070711_100022169 Ga0070711_1000221694 224
64 3300005439 Ga0070711_100151821 Ga0070711_1001518213 224
65 3300005441 Ga0070700_100181908 Ga0070700_1001819082 224
66 3300005455 Ga0070663_100038861 Ga0070663_1000388612 224
67 3300005456 Ga0070678_100174090 Ga0070678_1001740902 224
68 3300005457 Ga0070662_100107414 Ga0070662_1001074142 224
69 3300005458 Ga0070681_10090746 Ga0070681_100907462 224
70 3300005466 Ga0070685_10003366 Ga0070685_100033662 224
71 3300005544 Ga0070686_100022671 Ga0070686_1000226715 224
72 3300005547 Ga0070693_100032265 Ga0070693_1000322654 224
73 3300005615 Ga0070702_100151314 Ga0070702_1001513142 224
74 3300005615 Ga0070702_100174959 Ga0070702_1001749592 224
75 3300005616 Ga0068852_100456388 Ga0068852_1004563882 224
76 3300005834 Ga0068851_10136830 Ga0068851_101368302 224
77 3300005842 Ga0068858_100066979 Ga0068858_1000669794 224
78 3300005843 Ga0068860_100173155 Ga0068860_1001731552 224
79 3300005844 Ga0068862_100107449 Ga0068862_1001074493 224
80 3300006028 Ga0070717_10000150 Ga0070717_100001507 224
81 3300006163 Ga0070715_10000967 Ga0070715_100009677 224
82 3300006163 Ga0070715_10014104 Ga0070715_100141042 224
83 3300006175 Ga0070712_100105322 Ga0070712_1001053223 224
84 3300006237 Ga0097621_100074880 Ga0097621_1000748803 224
85 3300006358 Ga0068871_100103835 Ga0068871_1001038352 224
86 3300006871 Ga0075434_100170023 Ga0075434_1001700233 224
87 3300006914 Ga0075436_100221484 Ga0075436_1002214842 224
88 3300009011 Ga0105251_10106778 Ga0105251_101067782 224
89 3300009176 Ga0105242_10190895 Ga0105242_101908952 224
90 3300009545 Ga0105237_10057439 Ga0105237_100574394 224
91 3300009553 Ga0105249_10037876 Ga0105249_100378764 224
92 3300010375 Ga0105239_10117853 Ga0105239_101178532 224
93 3300011119 Ga0105246_10131138 Ga0105246_101311382 224
94 3300013100 Ga0157373_10199073 Ga0157373_101990732 224
95 3300013296 Ga0157374_10866535 Ga0157374_108665351 224
96 3300013297 Ga0157378_10096546 Ga0157378_100965463 224
97 3300013306 Ga0163162_10142571 Ga0163162_101425713 224
98 3300014326 Ga0157380_10181281 Ga0157380_101812812 224
99 3300014745 Ga0157377_10044714 Ga0157377_100447143 224
100 3300025898 Ga0207692_10011833 Ga0207692_100118335 224
101 3300025898 Ga0207692_10045206 Ga0207692_100452063 224
102 3300025903 Ga0207680_10205830 Ga0207680_102058302 224
103 3300025905 Ga0207685_10008065 Ga0207685_100080652 224
104 3300025905 Ga0207685_10079496 Ga0207685_100794962 224
105 3300025906 Ga0207699_10005642 Ga0207699_100056426 224
106 3300025906 Ga0207699_10039047 Ga0207699_100390472 224
107 3300025907 Ga0207645_10127926 Ga0207645_101279262 224
108 3300025911 Ga0207654_10040799 Ga0207654_100407992 224
109 3300025914 Ga0207671_10062226 Ga0207671_100622263 224
110 3300025915 Ga0207693_10001763 Ga0207693_100017632 224
111 3300025915 Ga0207693_10011822 Ga0207693_100118223 224
112 3300025916 Ga0207663_10008055 Ga0207663_100080553 224
113 3300025916 Ga0207663_10039065 Ga0207663_100390652 224
114 3300025917 Ga0207660_10017175 Ga0207660_100171754 224
115 3300025919 Ga0207657_10059369 Ga0207657_100593692 224
116 3300025921 Ga0207652_10349028 Ga0207652_103490281 224
117 3300025927 Ga0207687_10040092 Ga0207687_100400924 224
118 3300025927 Ga0207687_10134032 Ga0207687_101340322 224
119 3300025928 Ga0207700_10027048 Ga0207700_100270484 224
120 3300025928 Ga0207700_10054575 Ga0207700_100545753 224
121 3300025929 Ga0207664_10033634 Ga0207664_100336345 224
122 3300025929 Ga0207664_10282550 Ga0207664_102825502 224
123 3300025932 Ga0207690_10032375 Ga0207690_100323753 224
124 3300025933 Ga0207706_10017172 Ga0207706_100171722 224
125 3300025934 Ga0207686_10185336 Ga0207686_101853362 224
126 3300025938 Ga0207704_10040421 Ga0207704_100404214 224
127 3300025939 Ga0207665_10000228 Ga0207665_1000022834 224
128 3300025939 Ga0207665_10096091 Ga0207665_100960912 224
129 3300025941 Ga0207711_10044811 Ga0207711_100448113 224
130 3300025944 Ga0207661_10381646 Ga0207661_103816462 224
131 3300025961 Ga0207712_10073594 Ga0207712_100735944 224
132 3300026035 Ga0207703_10322309 Ga0207703_103223092 224
133 3300026067 Ga0207678_10078763 Ga0207678_100787633 224
134 3300026095 Ga0207676_10039983 Ga0207676_100399834 224
135 3300026121 Ga0207683_10020028 Ga0207683_100200282 224
136 3300026121 Ga0207683_10241618 Ga0207683_102416182 224
137 3300034819 Ga0373958_0007804 Ga0373958_0007804_100_963 224
138 3300034957 Ga0373938_0007040 Ga0373938_0007040_980_1843 224
139 3300035083 Ga0373926_0102193 Ga0373926_0102193_132_995 224
140 3300035086 Ga0373934_0005408 Ga0373934_0005408_2724_3587 224
141 3300035088 Ga0373940_0040445 Ga0373940_0040445_48_911 224
142 3300035090 Ga0373949_0015114 Ga0373949_0015114_34_897 224
143 3300035111 Ga0373923_0032595 Ga0373923_0032595_261_1124 224
144 3300035112 Ga0373932_0012530 Ga0373932_0012530_1142_2017 224
145 3300035114 Ga0373939_0020751 Ga0373939_0020751_100_963 224
146 3300035119 Ga0373956_0079853 Ga0373956_0079853_257_1120 224
147 3300035120 Ga0373957_0000733 Ga0373957_0000733_2854_3717 224
148 3300035121 Ga0373960_0009997 Ga0373960_0009997_782_1645 224
149 3300035170 Ga0373943_0004643 Ga0373943_0004643_4344_5219 224
150 3300035170 Ga0373943_0031188 Ga0373943_0031188_343_1206 224
151 3300035171 Ga0373946_0007033 Ga0373946_0007033_2036_2899 224
152 3300035171 Ga0373946_0019295 Ga0373946_0019295_641_1516 224
153 3300035242 Ga0373962_0014481 Ga0373962_0014481_870_1733 224
154 3300035692 Ga0373935_0170460 Ga0373935_0170460_560_1435 224
155 3300035695 Ga0373927_0060680 Ga0373927_0060680_1000_1875 224
156 3300035724 Ga0373933_0002170 Ga0373933_0002170_4967_5830 224
157 3300035725 Ga0373947_0031816 Ga0373947_0031816_494_1369 224
158 3300036401 Ga0373937_0003016 Ga0373937_0003016_10453_11316 224
159 3300037068 Ga0373925_0029022 Ga0373925_0029022_1898_2773 224
160 3300046455 Ga0495603_0033207 Ga0495603_0033207_824_1699 224
161 3300046459 Ga0495629_0001744 Ga0495629_0001744_11568_12443 224
162 3300046459 Ga0495629_0159976 Ga0495629_0159976_444_1307 224
163 3300046461 Ga0495641_0020639 Ga0495641_0020639_1492_2367 224
164 3300046461 Ga0495641_0030621 Ga0495641_0030621_1049_1912 224
165 3300046462 Ga0495651_0003262 Ga0495651_0003262_10097_10960 224
166 3300046463 Ga0495653_0007752 Ga0495653_0007752_4741_5604 224
167 3300046473 Ga0495582_0055230 Ga0495582_0055230_45_920 224
168 3300046477 Ga0495664_0125858 Ga0495664_0125858_492_1355 224
169 3300046511 Ga0495608_0002716 Ga0495608_0002716_7212_8075 224
170 3300046514 Ga0495618_0009781 Ga0495618_0009781_4741_5604 224
171 3300046516 Ga0495628_0011899 Ga0495628_0011899_1509_2372 224
172 3300046529 Ga0495652_0021127 Ga0495652_0021127_3235_4098 224
173 3300046533 Ga0495640_0102422 Ga0495640_0102422_569_1432 224
174 3300046533 Ga0495640_0216039 Ga0495640_0216039_257_1120 224
175 3300046535 Ga0495586_0028908 Ga0495586_0028908_2074_2937 224
176 3300046536 Ga0495587_0002288 Ga0495587_0002288_10218_11081 224
177 3300046543 Ga0495645_0003108 Ga0495645_0003108_2933_3796 224
178 3300046559 Ga0495667_0006750 Ga0495667_0006750_5107_5970 224
179 3300046663 Ga0495635_0004663 Ga0495635_0004663_3850_4713 224
180 3300046663 Ga0495635_0242349 Ga0495635_0242349_288_1163 224
181 3300046675 Ga0495657_0001806 Ga0495657_0001806_14672_15535 224
182 3300046678 Ga0495599_0177450 Ga0495599_0177450_193_1056 224
183 3300046679 Ga0495623_0005760 Ga0495623_0005760_2295_3158 224
184 3300046680 Ga0495646_0007322 Ga0495646_0007322_1509_2372 224
185 3300046681 Ga0495647_0017761 Ga0495647_0017761_828_1703 224
186 3300046681 Ga0495647_0074544 Ga0495647_0074544_444_1307 224
187 3300046683 Ga0495658_0001024 Ga0495658_0001024_3516_4391 224
188 3300047315 Ga0495581_0029576 Ga0495581_0029576_754_1629 224
189 3300047317 Ga0495604_0003703 Ga0495604_0003703_11249_12112 224
190 3300047321 Ga0495676_0089159 Ga0495676_0089159_474_1337 224
191 3300047322 Ga0495680_0014220 Ga0495680_0014220_2805_3668 224
192 3300047322 Ga0495680_0021842 Ga0495680_0021842_1069_1944 224
193 3300047444 Ga0495675_0003237 Ga0495675_0003237_4184_5047 224
194 3300047673 Ga0495593_0017478 Ga0495593_0017478_1774_2649 224
195 3300048903 Ga0496100_0006229 Ga0496100_0006229_3214_4077 224
196 3300048905 Ga0496102_0069464 Ga0496102_0069464_1539_2402 224
197 3300048905 Ga0496102_0481462 Ga0496102_0481462_86_949 224
198 3300048905 Ga0496102_0504132 Ga0496102_0504132_82_945 224
199 3300048907 Ga0496104_0009345 Ga0496104_0009345_7785_8648 224
200 3300048910 Ga0496107_0013954 Ga0496107_0013954_3762_4625 224
201 3300048910 Ga0496107_0016975 Ga0496107_0016975_2228_3091 224
202 3300048913 Ga0496110_0097488 Ga0496110_0097488_1497_2360 224
203 3300048917 Ga0496114_0003838 Ga0496114_0003838_804_1667 224
204 3300050514 nmdc:mga08x19_200757_c1 nmdc:mga08x19_200757_c1_310_1173 224
205 3300053077 Ga0495601_0006164 Ga0495601_0006164_4971_5834 224
206 3300053078 Ga0495612_0005295 Ga0495612_0005295_4075_4938 224
207 3300053084 Ga0495595_0074460 Ga0495595_0074460_65_928 224
208 3300053085 Ga0495619_0000439 Ga0495619_0000439_15611_16486 224
209 3300031548 Ga0307408_100121415 Ga0307408_1001214153 225
210 3300050512 nmdc:mga0n895_15595_c1 nmdc:mga0n895_15595_c1_5553_6278 226
211 3300050513 nmdc:mga0rr50_58336_c1 nmdc:mga0rr50_58336_c1_1947_2672 226
212 3300046539 Ga0495621_0040224 Ga0495621_0040224_326_1099 227
213 3300009147 Ga0114129_10138946 Ga0114129_101389462 228
214 3300050507 nmdc:mga05p37_68171_c1 nmdc:mga05p37_68171_c1_1303_2061 228
215 3300050508 nmdc:mga09592_235498_c1 nmdc:mga09592_235498_c1_29_787 228
216 3300025915 Ga0207693_10123504 Ga0207693_101235043 229
217 3300053140 Ga0500573_0007517 Ga0500573_0007517_818_1594 229
218 3300006844 Ga0075428_100091698 Ga0075428_1000916982 231
219 3300006880 Ga0075429_100246846 Ga0075429_1002468462 231
220 3300038443 Ga0395901_0195724 Ga0395901_0195724_890_1750 231
221 3300006173 Ga0070716_100043881 Ga0070716_1000438812 232
222 3300036401 Ga0373937_0179690 Ga0373937_0179690_938_1720 232
223 3300049592 Ga0501076_0036224 Ga0501076_0036224_2741_3583 232
224 3300049742 Ga0501080_0162688 Ga0501080_0162688_868_1710 232
225 3300050507 nmdc:mga05p37_503256_c1 nmdc:mga05p37_503256_c1_15_857 232
226 3300050510 nmdc:mga06r32_14315_c1 nmdc:mga06r32_14315_c1_5873_6715 232
227 3300060353 Ga0501082_0429223 Ga0501082_0429223_295_1137 232
228 3300061734 Ga0530510_0139354 Ga0530510_0139354_330_1172 232
229 3300006871 Ga0075434_100449024 Ga0075434_1004490242 233
230 3300049568 Ga0501031_0221443 Ga0501031_0221443_377_1177 233
231 3300049572 Ga0501036_0036305 Ga0501036_0036305_1092_1892 233
232 3300049576 Ga0501040_0027784 Ga0501040_0027784_2161_2961 233
233 3300049577 Ga0501041_0018427 Ga0501041_0018427_1125_1925 233
234 3300049580 Ga0501046_0015157 Ga0501046_0015157_1926_2726 233
235 3300049582 Ga0501048_0038408 Ga0501048_0038408_1125_1925 233
236 3300049588 Ga0501072_0048616 Ga0501072_0048616_2198_2998 233
237 3300049591 Ga0501075_0027496 Ga0501075_0027496_2289_3089 233
238 3300049743 Ga0501081_0024033 Ga0501081_0024033_2242_3042 233
239 3300049822 Ga0501035_0245719 Ga0501035_0245719_585_1385 233
240 3300049824 Ga0501045_0000739 Ga0501045_0000739_14161_14961 233
241 3300050513 nmdc:mga0rr50_683700_c1 nmdc:mga0rr50_683700_c1_57_827 233
242 3300054114 Ga0501084_0134402 Ga0501084_0134402_159_959 233
243 3300025885 Ga0207653_10005827 Ga0207653_100058274 234
244 3300005981 Ga0081538_10045879 Ga0081538_100458792 235
245 3300006847 Ga0075431_100172342 Ga0075431_1001723423 235
246 3300006880 Ga0075429_100604303 Ga0075429_1006043032 235
247 3300027876 Ga0209974_10057892 Ga0209974_100578922 235
248 3300031911 Ga0307412_10294627 Ga0307412_102946272 235
249 3300042876 Ga0451577_0001529 Ga0451577_0001529_13836_14606 235
250 3300050508 nmdc:mga09592_433134_c1 nmdc:mga09592_433134_c1_227_1000 235
251 3300050510 nmdc:mga06r32_265661_c1 nmdc:mga06r32_265661_c1_571_1344 235
252 3300053153 Ga0500616_0078056 Ga0500616_0078056_125_892 236
253 3300042876 Ga0451577_0001601 Ga0451577_0001601_14394_15164 237
254 3300005444 Ga0070694_100068923 Ga0070694_1000689232 238
255 3300005545 Ga0070695_100123514 Ga0070695_1001235142 238
256 3300005546 Ga0070696_100010689 Ga0070696_1000106893 238
257 3300006178 Ga0075367_10179961 Ga0075367_101799612 239
258 3300049571 Ga0501034_0224139 Ga0501034_0224139_981_1820 239
259 3300014969 Ga0157376_10064616 Ga0157376_100646163 240
260 3300048903 Ga0496100_0158471 Ga0496100_0158471_32_814 240
261 3300048905 Ga0496102_0331359 Ga0496102_0331359_440_1222 240
262 3300053140 Ga0500573_0006853 Ga0500573_0006853_4079_4855 240
263 3300009101 Ga0105247_10017947 Ga0105247_100179473 241
264 3300009177 Ga0105248_10030287 Ga0105248_100302874 241
265 3300014325 Ga0163163_10006448 Ga0163163_100064485 241
266 3300014968 Ga0157379_10037217 Ga0157379_100372174 241
267 3300048907 Ga0496104_0118279 Ga0496104_0118279_296_1156 241
268 3300048908 Ga0496105_0232910 Ga0496105_0232910_241_1101 241
269 3300048911 Ga0496108_0016735 Ga0496108_0016735_1132_1992 241
270 3300048912 Ga0496109_0004187 Ga0496109_0004187_4067_4927 241
271 3300048913 Ga0496110_0166576 Ga0496110_0166576_610_1470 241
272 3300048914 Ga0496111_0017800 Ga0496111_0017800_1629_2489 241
273 3300048915 Ga0496112_0005729 Ga0496112_0005729_7289_8149 241
274 3300048916 Ga0496113_0001728 Ga0496113_0001728_1500_2360 241
275 3300048926 Ga0496123_0047076 Ga0496123_0047076_1699_2517 241
276 3300049570 Ga0501033_0017045 Ga0501033_0017045_963_1745 241
277 3300049574 Ga0501038_0115930 Ga0501038_0115930_1093_1875 241
278 3300049581 Ga0501047_0009379 Ga0501047_0009379_1197_1979 241
279 3300049586 Ga0501070_0097021 Ga0501070_0097021_394_1176 241
280 3300049742 Ga0501080_0067192 Ga0501080_0067192_1430_2212 241
281 3300049822 Ga0501035_0016279 Ga0501035_0016279_3469_4251 241
282 3300049823 Ga0501044_0016598 Ga0501044_0016598_6921_7703 241
283 iso_pu_bacteria 2585427634 2586003790 241
284 3300003203 JGI25406J46586_10048618 JGI25406J46586_100486182 242
285 3300005290 Ga0065712_10069608 Ga0065712_100696083 242
286 3300005365 Ga0070688_100226098 Ga0070688_1002260982 242
287 3300005458 Ga0070681_10142988 Ga0070681_101429883 242
288 3300005564 Ga0070664_100073324 Ga0070664_1000733242 242
289 3300005618 Ga0068864_100262459 Ga0068864_1002624592 242
290 3300005842 Ga0068858_100204034 Ga0068858_1002040342 242
291 3300005985 Ga0081539_10000803 Ga0081539_1000080330 242
292 3300025917 Ga0207660_10142108 Ga0207660_101421083 242
293 3300025941 Ga0207711_10101378 Ga0207711_101013783 242
294 3300025945 Ga0207679_10252622 Ga0207679_102526221 242
295 3300026035 Ga0207703_10177238 Ga0207703_101772382 242
296 3300026095 Ga0207676_10245298 Ga0207676_102452982 242
297 3300049569 Ga0501032_0097409 Ga0501032_0097409_441_1316 242
298 3300049573 Ga0501037_0032929 Ga0501037_0032929_558_1433 242
299 3300049574 Ga0501038_0089124 Ga0501038_0089124_1023_1898 242
300 3300049581 Ga0501047_0051691 Ga0501047_0051691_2569_3444 242
301 3300049586 Ga0501070_0214492 Ga0501070_0214492_679_1551 242
302 3300049586 Ga0501070_0238294 Ga0501070_0238294_484_1359 242
303 3300049587 Ga0501071_0090756 Ga0501071_0090756_82_954 242
304 3300049822 Ga0501035_0129757 Ga0501035_0129757_556_1431 242
305 3300049823 Ga0501044_0091317 Ga0501044_0091317_1700_2575 242
306 3300050509 nmdc:mga0qj67_304759_c1 nmdc:mga0qj67_304759_c1_145_906 242
307 iso_pu_bacteria 2643221733 2644730216 242
308 3300005435 Ga0070714_100028036 Ga0070714_1000280364 243
309 3300005436 Ga0070713_100021301 Ga0070713_1000213013 243
310 3300005439 Ga0070711_100319265 Ga0070711_1003192652 243
311 3300006028 Ga0070717_10011597 Ga0070717_100115973 243
312 3300006051 Ga0075364_10037522 Ga0075364_100375223 243
313 3300006173 Ga0070716_100313921 Ga0070716_1003139212 243
314 3300006871 Ga0075434_100423924 Ga0075434_1004239242 243
315 3300009094 Ga0111539_10014430 Ga0111539_100144306 243
316 3300013102 Ga0157371_10029143 Ga0157371_100291435 243
317 3300013105 Ga0157369_10030046 Ga0157369_100300465 243
318 3300025898 Ga0207692_10020246 Ga0207692_100202462 243
319 3300025905 Ga0207685_10012920 Ga0207685_100129203 243
320 3300025906 Ga0207699_10176664 Ga0207699_101766642 243
321 3300025928 Ga0207700_10049864 Ga0207700_100498642 243
322 3300025929 Ga0207664_10145653 Ga0207664_101456532 243
323 3300025939 Ga0207665_10333274 Ga0207665_103332742 243
324 3300048919 Ga0496116_0000036 Ga0496116_0000036_238360_239178 243
325 3300048929 Ga0496126_0000156 Ga0496126_0000156_135062_135880 243
326 3300048929 Ga0496126_0209148 Ga0496126_0209148_108_878 243
327 3300050511 nmdc:mga08y16_26909_c1 nmdc:mga08y16_26909_c1_2293_3153 243
328 iso_pu_bacteria 2574179768 2574431235 243
329 iso_pu_bacteria 639633007 639788680 243
330 3300003322 rootL2_10000581 rootL2_100005812 244
331 3300005440 Ga0070705_100215980 Ga0070705_1002159802 244
332 3300005546 Ga0070696_100077142 Ga0070696_1000771423 244
333 3300005937 Ga0081455_10062198 Ga0081455_100621983 244
334 3300006058 Ga0075432_10000665 Ga0075432_100006653 244
335 3300006844 Ga0075428_100003032 Ga0075428_1000030328 244
336 3300006846 Ga0075430_100000587 Ga0075430_10000058716 244
337 3300006852 Ga0075433_10000020 Ga0075433_1000002024 244
338 3300006880 Ga0075429_100001660 Ga0075429_10000166014 244
339 3300009094 Ga0111539_10000373 Ga0111539_1000037349 244
340 3300025916 Ga0207663_10033763 Ga0207663_100337632 244
341 3300025945 Ga0207679_10077869 Ga0207679_100778693 244
342 3300027717 Ga0209998_10004731 Ga0209998_100047312 244
343 3300027876 Ga0209974_10011673 Ga0209974_100116734 244
344 3300027907 Ga0207428_10000172 Ga0207428_1000017266 244
345 3300027907 Ga0207428_10021624 Ga0207428_100216245 244
346 3300031238 Ga0265332_10006577 Ga0265332_100065774 244
347 3300035118 Ga0373954_0219689 Ga0373954_0219689_17_796 244
348 3300050507 nmdc:mga05p37_102_c1 nmdc:mga05p37_102_c1_54637_55512 244
349 3300050508 nmdc:mga09592_716_c1 nmdc:mga09592_716_c1_8304_9179 244
350 3300050509 nmdc:mga0qj67_119_c1 nmdc:mga0qj67_119_c1_8721_9596 244
351 3300050510 nmdc:mga06r32_2969_c1 nmdc:mga06r32_2969_c1_10085_10960 244
352 3300050511 nmdc:mga08y16_2739_c1 nmdc:mga08y16_2739_c1_5824_6699 244
353 3300050512 nmdc:mga0n895_56080_c1 nmdc:mga0n895_56080_c1_620_1495 244
354 3300050513 nmdc:mga0rr50_494_c1 nmdc:mga0rr50_494_c1_11686_12561 244
355 3300050513 nmdc:mga0rr50_72138_c1 nmdc:mga0rr50_72138_c1_1539_2414 244
356 3300050515 nmdc:mga0a205_4441_c1 nmdc:mga0a205_4441_c1_1554_2429 244
357 3300053125 Ga0500618_000990 Ga0500618_000990_10805_11575 244
358 3300059426 Ga0590077_003753 Ga0590077_003753_997_1839 244
359 3300005343 Ga0070687_100370820 Ga0070687_1003708201 245
360 3300005354 Ga0070675_100265426 Ga0070675_1002654262 245
361 3300006175 Ga0070712_100404518 Ga0070712_1004045181 245
362 3300006871 Ga0075434_100164402 Ga0075434_1001644022 245
363 3300013104 Ga0157370_10290289 Ga0157370_102902893 245
364 3300013105 Ga0157369_10136236 Ga0157369_101362362 245
365 3300013296 Ga0157374_10051951 Ga0157374_100519512 245
366 3300037418 Ga0395900_0121087 Ga0395900_0121087_452_1222 245
367 3300044842 Ga0466957_0026026 Ga0466957_0026026_1469_2251 245
368 3300048919 Ga0496116_0080624 Ga0496116_0080624_1186_2004 245
369 3300048920 Ga0496117_0008869 Ga0496117_0008869_1714_2532 245
370 3300048923 Ga0496120_0012194 Ga0496120_0012194_2459_3277 245
371 3300048924 Ga0496121_0000001 Ga0496121_0000001_851334_852152 245
372 3300048928 Ga0496125_0000001 Ga0496125_0000001_965269_966087 245
373 3300048929 Ga0496126_0059922 Ga0496126_0059922_692_1510 245
374 3300049591 Ga0501075_0432990 Ga0501075_0432990_190_960 245
375 3300050491 nmdc:mga00v17_21845_c1 nmdc:mga00v17_21845_c1_1597_2415 245
376 iso_pu_bacteria 2897803580 2897806681 245
377 3300005330 Ga0070690_100288032 Ga0070690_1002880322 246
378 3300005347 Ga0070668_100241806 Ga0070668_1002418061 246
379 3300005367 Ga0070667_100133196 Ga0070667_1001331963 246
380 3300005434 Ga0070709_10083604 Ga0070709_100836042 246
381 3300005436 Ga0070713_100043618 Ga0070713_1000436182 246
382 3300005436 Ga0070713_100104000 Ga0070713_1001040002 246
383 3300005439 Ga0070711_100062344 Ga0070711_1000623443 246
384 3300005441 Ga0070700_100167445 Ga0070700_1001674452 246
385 3300005455 Ga0070663_100145095 Ga0070663_1001450952 246
386 3300005458 Ga0070681_10028847 Ga0070681_100288472 246
387 3300005530 Ga0070679_100023809 Ga0070679_1000238097 246
388 3300005530 Ga0070679_100233505 Ga0070679_1002335052 246
389 3300005563 Ga0068855_100364916 Ga0068855_1003649162 246
390 3300005564 Ga0070664_100134166 Ga0070664_1001341663 246
391 3300005564 Ga0070664_100302826 Ga0070664_1003028262 246
392 3300005614 Ga0068856_100012857 Ga0068856_1000128577 246
393 3300005614 Ga0068856_100443432 Ga0068856_1004434322 246
394 3300005937 Ga0081455_10003823 Ga0081455_100038236 246
395 3300005937 Ga0081455_10146836 Ga0081455_101468362 246
396 3300005983 Ga0081540_1004764 Ga0081540_10047644 246
397 3300006038 Ga0075365_10039942 Ga0075365_100399422 246
398 3300006038 Ga0075365_10084424 Ga0075365_100844242 246
399 3300006844 Ga0075428_100519168 Ga0075428_1005191682 246
400 3300009093 Ga0105240_10313559 Ga0105240_103135592 246
401 3300009148 Ga0105243_10105133 Ga0105243_101051334 246
402 3300009174 Ga0105241_10103883 Ga0105241_101038832 246
403 3300009176 Ga0105242_10029702 Ga0105242_100297022 246
404 3300009545 Ga0105237_10232450 Ga0105237_102324502 246
405 3300009551 Ga0105238_10113365 Ga0105238_101133652 246
406 3300013104 Ga0157370_10616500 Ga0157370_106165002 246
407 3300013105 Ga0157369_10785478 Ga0157369_107854782 246
408 3300013307 Ga0157372_10248405 Ga0157372_102484052 246
409 3300013307 Ga0157372_10455554 Ga0157372_104555542 246
410 3300017792 Ga0163161_10265282 Ga0163161_102652822 246
411 3300025898 Ga0207692_10109771 Ga0207692_101097712 246
412 3300025901 Ga0207688_10141195 Ga0207688_101411951 246
413 3300025904 Ga0207647_10278634 Ga0207647_102786342 246
414 3300025911 Ga0207654_10022166 Ga0207654_100221662 246
415 3300025912 Ga0207707_10003237 Ga0207707_1000323713 246
416 3300025914 Ga0207671_10219058 Ga0207671_102190582 246
417 3300025915 Ga0207693_10085574 Ga0207693_100855742 246
418 3300025921 Ga0207652_10168272 Ga0207652_101682722 246
419 3300025921 Ga0207652_10469094 Ga0207652_104690942 246
420 3300025924 Ga0207694_10037464 Ga0207694_100374643 246
421 3300025929 Ga0207664_10059208 Ga0207664_100592082 246
422 3300025929 Ga0207664_10393264 Ga0207664_103932642 246
423 3300025940 Ga0207691_10188433 Ga0207691_101884332 246
424 3300025942 Ga0207689_10077955 Ga0207689_100779554 246
425 3300025945 Ga0207679_10050621 Ga0207679_100506213 246
426 3300025949 Ga0207667_10053509 Ga0207667_100535092 246
427 3300026075 Ga0207708_10143143 Ga0207708_101431432 246
428 3300026078 Ga0207702_10007306 Ga0207702_100073065 246
429 3300026142 Ga0207698_10562599 Ga0207698_105625992 246
430 3300031911 Ga0307412_10167717 Ga0307412_101677172 246
431 3300031995 Ga0307409_100232069 Ga0307409_1002320692 246
432 3300035170 Ga0373943_0030335 Ga0373943_0030335_1015_1791 246
433 3300037068 Ga0373925_0195231 Ga0373925_0195231_116_892 246
434 3300037466 Ga0395898_0059476 Ga0395898_0059476_1789_2559 246
435 3300046474 Ga0495605_0105778 Ga0495605_0105778_499_1275 246
436 3300046516 Ga0495628_0136219 Ga0495628_0136219_424_1200 246
437 3300046524 Ga0495648_0151478 Ga0495648_0151478_150_926 246
438 3300046616 Ga0495668_0175491 Ga0495668_0175491_23_799 246
439 3300046642 Ga0495634_0081646 Ga0495634_0081646_517_1293 246
440 3300046689 Ga0495613_0046067 Ga0495613_0046067_942_1718 246
441 3300047673 Ga0495593_0071411 Ga0495593_0071411_94_870 246
442 3300048906 Ga0496103_0011009 Ga0496103_0011009_4154_4930 246
443 3300048912 Ga0496109_0534957 Ga0496109_0534957_111_887 246
444 3300048917 Ga0496114_0227277 Ga0496114_0227277_800_1576 246
445 3300049585 Ga0501069_0349140 Ga0501069_0349140_90_860 246
446 3300049824 Ga0501045_0363535 Ga0501045_0363535_113_952 246
447 3300050492 nmdc:mga0yw44_165052_c1 nmdc:mga0yw44_165052_c1_41_817 246
448 3300050492 nmdc:mga0yw44_2154_c1 nmdc:mga0yw44_2154_c1_689_1465 246
449 3300053077 Ga0495601_0088744 Ga0495601_0088744_530_1306 246
450 3300053083 Ga0495655_0061394 Ga0495655_0061394_135_911 246
451 3300053085 Ga0495619_0022694 Ga0495619_0022694_881_1657 246
452 3300053156 Ga0500622_0036278 Ga0500622_0036278_868_1638 246
453 3300005331 Ga0070670_100000725 Ga0070670_10000072512 247
454 3300005365 Ga0070688_100462212 Ga0070688_1004622121 247
455 3300005366 Ga0070659_100190179 Ga0070659_1001901792 247
456 3300005366 Ga0070659_100475550 Ga0070659_1004755501 247
457 3300005457 Ga0070662_100225242 Ga0070662_1002252422 247
458 3300005548 Ga0070665_100517707 Ga0070665_1005177072 247
459 3300005616 Ga0068852_100793125 Ga0068852_1007931252 247
460 3300005937 Ga0081455_10000151 Ga0081455_100001518 247
461 3300006038 Ga0075365_10228289 Ga0075365_102282891 247
462 3300006847 Ga0075431_100042771 Ga0075431_1000427714 247
463 3300006847 Ga0075431_100166346 Ga0075431_1001663461 247
464 3300009094 Ga0111539_10056564 Ga0111539_100565643 247
465 3300009101 Ga0105247_10079479 Ga0105247_100794792 247
466 3300009147 Ga0114129_10008524 Ga0114129_100085247 247
467 3300010375 Ga0105239_10206762 Ga0105239_102067622 247
468 3300011119 Ga0105246_10185335 Ga0105246_101853352 247
469 3300014325 Ga0163163_10017610 Ga0163163_100176105 247
470 3300025900 Ga0207710_10026292 Ga0207710_100262922 247
471 3300025929 Ga0207664_10065036 Ga0207664_100650363 247
472 3300025944 Ga0207661_10045706 Ga0207661_100457063 247
473 3300026067 Ga0207678_10013871 Ga0207678_100138714 247
474 3300027907 Ga0207428_10084354 Ga0207428_100843542 247
475 3300046459 Ga0495629_0036632 Ga0495629_0036632_1206_1985 247
476 3300046461 Ga0495641_0032809 Ga0495641_0032809_1370_2149 247
477 3300047315 Ga0495581_0019002 Ga0495581_0019002_2225_3004 247
478 3300048903 Ga0496100_0036518 Ga0496100_0036518_842_1621 247
479 3300048905 Ga0496102_0124729 Ga0496102_0124729_1609_2388 247
480 3300048907 Ga0496104_0002463 Ga0496104_0002463_8863_9642 247
481 3300048908 Ga0496105_0013402 Ga0496105_0013402_1595_2374 247
482 3300048908 Ga0496105_0475106 Ga0496105_0475106_133_912 247
483 3300048909 Ga0496106_0319434 Ga0496106_0319434_258_1037 247
484 3300048910 Ga0496107_0012187 Ga0496107_0012187_1170_1949 247
485 3300048911 Ga0496108_0000521 Ga0496108_0000521_14717_15496 247
486 3300048912 Ga0496109_0000193 Ga0496109_0000193_47651_48430 247
487 3300048913 Ga0496110_0013165 Ga0496110_0013165_1095_1874 247
488 3300048914 Ga0496111_0064734 Ga0496111_0064734_1064_1843 247
489 3300048915 Ga0496112_0043962 Ga0496112_0043962_297_1076 247
490 3300048916 Ga0496113_0000245 Ga0496113_0000245_15838_16617 247
491 3300050496 nmdc:mga07m45_155758_c1 nmdc:mga07m45_155758_c1_268_1047 247
492 3300050507 nmdc:mga05p37_11802_c1 nmdc:mga05p37_11802_c1_586_1446 247
493 3300050507 nmdc:mga05p37_7504_c2 nmdc:mga05p37_7504_c2_1756_2535 247
494 3300050510 nmdc:mga06r32_320250_c1 nmdc:mga06r32_320250_c1_724_1503 247
495 3300050510 nmdc:mga06r32_80542_c1 nmdc:mga06r32_80542_c1_1363_2223 247
496 3300053084 Ga0495595_0060709 Ga0495595_0060709_385_1164 247
497 3300049743 Ga0501081_0144577 Ga0501081_0144577_201_1043 248
498 3300005439 Ga0070711_100386871 Ga0070711_1003868712 250
499 3300006175 Ga0070712_100320963 Ga0070712_1003209631 250
500 3300025915 Ga0207693_10308975 Ga0207693_103089751 250
501 3300025916 Ga0207663_10060283 Ga0207663_100602831 250
502 3300025939 Ga0207665_10002785 Ga0207665_1000278510 250
503 3300005441 Ga0070700_100025387 Ga0070700_1000253873 252
504 3300005444 Ga0070694_100025036 Ga0070694_1000250364 252
505 3300005545 Ga0070695_100002744 Ga0070695_1000027448 252
506 3300006844 Ga0075428_100117704 Ga0075428_1001177042 252
507 3300009094 Ga0111539_10779354 Ga0111539_107793542 252
508 3300009098 Ga0105245_10103130 Ga0105245_101031302 252
509 3300009176 Ga0105242_10241245 Ga0105242_102412452 252
510 3300026075 Ga0207708_10040934 Ga0207708_100409343 252
511 3300026118 Ga0207675_100243518 Ga0207675_1002435182 252
512 3300035116 Ga0373945_0006895 Ga0373945_0006895_291_1136 252
513 3300035171 Ga0373946_0089667 Ga0373946_0089667_195_1040 252
514 3300046472 Ga0495580_0307465 Ga0495580_0307465_152_997 252
515 3300046476 Ga0495662_0060585 Ga0495662_0060585_215_1060 252
516 3300046491 Ga0495584_0023830 Ga0495584_0023830_1474_2322 252
517 3300046499 Ga0495594_0022620 Ga0495594_0022620_1049_1894 252
518 3300046559 Ga0495667_0148309 Ga0495667_0148309_405_1217 252
519 3300046683 Ga0495658_0025664 Ga0495658_0025664_1467_2312 252
520 3300049588 Ga0501072_0190718 Ga0501072_0190718_511_1353 252
521 3300053084 Ga0495595_0023153 Ga0495595_0023153_344_1156 252
522 3300053085 Ga0495619_0025324 Ga0495619_0025324_2836_3648 252
523 3300060353 Ga0501082_0602966 Ga0501082_0602966_72_914 252
524 3300005518 Ga0070699_100772055 Ga0070699_1007720551 253
525 3300039447 Ga0436361_0769631 Ga0436361_0769631_1023_1838 253
526 3300039453 Ga0436362_1062509 Ga0436362_1062509_230_1045 253
527 3300050512 nmdc:mga0n895_57667_c1 nmdc:mga0n895_57667_c1_42_869 253
528 3300053083 Ga0495655_0062935 Ga0495655_0062935_59_904 253
529 3300053084 Ga0495595_0026857 Ga0495595_0026857_1713_2528 253
530 3300005518 Ga0070699_100303955 Ga0070699_1003039552 255
531 3300006175 Ga0070712_100139899 Ga0070712_1001398992 255
532 3300007076 Ga0075435_100097104 Ga0075435_1000971043 255
533 3300007265 Ga0099794_10004996 Ga0099794_100049966 255
534 3300031238 Ga0265332_10007158 Ga0265332_100071583 255
535 3300031241 Ga0265325_10039642 Ga0265325_100396423 255
536 3300031242 Ga0265329_10017186 Ga0265329_100171863 255
537 3300031247 Ga0265340_10002525 Ga0265340_1000252511 255
538 3300031712 Ga0265342_10000039 Ga0265342_10000039112 255
539 3300044694 Ga0466963_0104050 Ga0466963_0104050_55_882 255
540 3300048914 Ga0496111_0036646 Ga0496111_0036646_150_992 255
541 iso_pu_bacteria 2838736955 2838738892 255
542 iso_pu_bacteria 2841840854 2841842791 255
543 iso_pu_bacteria 2842140634 2842142571 255
544 3300046460 Ga0495638_0010059 Ga0495638_0010059_1488_2300 256
545 3300053088 Ga0500644_0001376 Ga0500644_0001376_3297_4109 256
546 3300053093 Ga0500651_0000898 Ga0500651_0000898_782_1594 256
547 3300053153 Ga0500616_0000006 Ga0500616_0000006_26441_27253 256
548 iso_pu_bacteria 8056875544 8056876617 256
549 3300031711 Ga0265314_10001423 Ga0265314_100014232 257
550 3300046558 Ga0495633_0135242 Ga0495633_0135242_232_1050 257
551 3300047470 Ga0495681_0012100 Ga0495681_0012100_4121_4939 257
552 3300047471 Ga0495684_0342975 Ga0495684_0342975_170_1015 257
553 3300053157 Ga0500624_000336 Ga0500624_000336_1451_2269 257
554 3300053161 Ga0500634_0063351 Ga0500634_0063351_256_1074 257
555 iso_pu_bacteria 2510917026 2511173809 257
556 iso_pu_bacteria 2643221591 2643962902 257
557 iso_pu_bacteria 2821123053 2821124082 257
558 iso_pu_bacteria 2854896431 2854897122 257
559 iso_pu_bacteria 2857531043 2857531645 257
560 3300005549 Ga0070704_100490021 Ga0070704_1004900211 258
561 3300005983 Ga0081540_1040244 Ga0081540_10402442 258
562 3300006175 Ga0070712_100047161 Ga0070712_1000471612 258
563 3300009553 Ga0105249_10056111 Ga0105249_100561114 258
564 3300025915 Ga0207693_10124056 Ga0207693_101240562 258
565 3300025961 Ga0207712_10436686 Ga0207712_104366861 258
566 3300025972 Ga0207668_10148064 Ga0207668_101480642 258
567 3300035695 Ga0373927_0077816 Ga0373927_0077816_319_1161 258
568 3300037068 Ga0373925_0160375 Ga0373925_0160375_337_1179 258
569 3300046681 Ga0495647_0057890 Ga0495647_0057890_503_1351 258
570 3300050512 nmdc:mga0n895_56490_c2 nmdc:mga0n895_56490_c2_746_1567 258
571 3300053087 Ga0500643_008044 Ga0500643_008044_886_1707 258
572 3300053094 Ga0500566_0032329 Ga0500566_0032329_707_1528 258
573 3300053119 Ga0500595_000001 Ga0500595_000001_113761_114582 258
574 3300053131 Ga0500652_008214 Ga0500652_008214_265_1086 258
575 3300053730 Ga0500645_001078 Ga0500645_001078_4168_4989 258
576 iso_pu_bacteria 2510461069 2510842852 258
577 3300003215 JGI25153J46596_10001453 JGI25153J46596_100014532 259
578 3300005440 Ga0070705_100365203 Ga0070705_1003652032 259
579 3300005545 Ga0070695_100284146 Ga0070695_1002841462 259
580 3300005546 Ga0070696_100006859 Ga0070696_1000068598 259
581 3300025297 Ga0209758_1000223 Ga0209758_100022340 259
582 3300053153 Ga0500616_0023203 Ga0500616_0023203_526_1368 259
583 iso_pu_bacteria 2738543031 2739349957 259
584 iso_pu_bacteria 2854916844 2854918260 259
585 iso_pu_bacteria 2919166419 2919167326 259
586 iso_pu_bacteria 2919171160 2919171480 259
587 3300006195 Ga0075366_10027788 Ga0075366_100277882 260
588 3300006844 Ga0075428_100016992 Ga0075428_1000169925 260
589 3300046491 Ga0495584_0120977 Ga0495584_0120977_132_971 260
590 3300048903 Ga0496100_0002959 Ga0496100_0002959_2245_3081 260
591 3300048907 Ga0496104_0080605 Ga0496104_0080605_150_986 260
592 3300048908 Ga0496105_0114632 Ga0496105_0114632_1208_2044 260
593 3300048909 Ga0496106_0027990 Ga0496106_0027990_612_1448 260
594 3300048911 Ga0496108_0003119 Ga0496108_0003119_4121_4957 260
595 3300048911 Ga0496108_0003202 Ga0496108_0003202_8949_9785 260
596 3300048912 Ga0496109_0003221 Ga0496109_0003221_9634_10470 260
597 3300048912 Ga0496109_0107421 Ga0496109_0107421_301_1137 260
598 3300048913 Ga0496110_0000441 Ga0496110_0000441_9167_10003 260
599 3300048913 Ga0496110_0003067 Ga0496110_0003067_1501_2337 260
600 3300048914 Ga0496111_0009662 Ga0496111_0009662_1803_2639 260
601 3300048914 Ga0496111_0013311 Ga0496111_0013311_3166_4002 260
602 3300048915 Ga0496112_0012961 Ga0496112_0012961_3646_4482 260
603 3300048915 Ga0496112_0017810 Ga0496112_0017810_3855_4691 260
604 3300048916 Ga0496113_0146356 Ga0496113_0146356_959_1795 260
605 3300048918 Ga0496115_0014998 Ga0496115_0014998_381_1217 260
606 3300049743 Ga0501081_0463943 Ga0501081_0463943_61_903 260
607 3300006844 Ga0075428_100209789 Ga0075428_1002097893 261
608 3300006946 Ga0079104_1000010 Ga0079104_1000010144 261
609 3300010375 Ga0105239_10189397 Ga0105239_101893972 261
610 3300017792 Ga0163161_10395886 Ga0163161_103958862 261
611 3300027111 Ga0209281_1000078 Ga0209281_100007826 261
612 3300028379 Ga0268266_10747861 Ga0268266_107478611 261
613 3300048907 Ga0496104_0080731 Ga0496104_0080731_1688_2530 261
614 3300048911 Ga0496108_0122586 Ga0496108_0122586_102_944 261
615 3300048913 Ga0496110_0072267 Ga0496110_0072267_960_1802 261
616 3300048913 Ga0496110_0273469 Ga0496110_0273469_193_1008 261
617 3300048914 Ga0496111_0168603 Ga0496111_0168603_592_1434 261
618 3300048924 Ga0496121_0011173 Ga0496121_0011173_7862_8680 261
619 3300048927 Ga0496124_0041577 Ga0496124_0041577_325_1143 261
620 3300048928 Ga0496125_0000180 Ga0496125_0000180_114872_115687 261
621 3300050510 nmdc:mga06r32_203117_c1 nmdc:mga06r32_203117_c1_349_1191 261
622 3300053153 Ga0500616_0000949 Ga0500616_0000949_926_1738 261
623 3300009147 Ga0114129_10063256 Ga0114129_100632564 262
624 3300025939 Ga0207665_10038422 Ga0207665_100384223 262
625 3300035111 Ga0373923_0006894 Ga0373923_0006894_1035_1895 262
626 3300035113 Ga0373936_0001699 Ga0373936_0001699_2590_3450 262
627 3300035117 Ga0373953_0030324 Ga0373953_0030324_1160_2020 262
628 3300035118 Ga0373954_0000751 Ga0373954_0000751_9156_10016 262
629 3300035119 Ga0373956_0043891 Ga0373956_0043891_891_1751 262
630 3300035170 Ga0373943_0008319 Ga0373943_0008319_2258_3118 262
631 3300035171 Ga0373946_0006737 Ga0373946_0006737_706_1566 262
632 3300035172 Ga0373955_0276130 Ga0373955_0276130_98_958 262
633 3300035410 Ga0373924_0041422 Ga0373924_0041422_138_998 262
634 3300035692 Ga0373935_0000086 Ga0373935_0000086_26120_26980 262
635 3300035724 Ga0373933_0006542 Ga0373933_0006542_4694_5554 262
636 3300035725 Ga0373947_0000096 Ga0373947_0000096_30301_31161 262
637 3300036401 Ga0373937_0000198 Ga0373937_0000198_29894_30754 262
638 3300037068 Ga0373925_0000071 Ga0373925_0000071_21196_22056 262
639 3300046454 Ga0495592_0000117 Ga0495592_0000117_25738_26598 262
640 3300046459 Ga0495629_0005598 Ga0495629_0005598_8369_9229 262
641 3300046462 Ga0495651_0000370 Ga0495651_0000370_18343_19203 262
642 3300046463 Ga0495653_0000047 Ga0495653_0000047_78821_79681 262
643 3300046476 Ga0495662_0096788 Ga0495662_0096788_85_945 262
644 3300046477 Ga0495664_0000024 Ga0495664_0000024_49668_50528 262
645 3300046511 Ga0495608_0000004 Ga0495608_0000004_92498_93358 262
646 3300046514 Ga0495618_0000036 Ga0495618_0000036_43308_44168 262
647 3300046516 Ga0495628_0000006 Ga0495628_0000006_57375_58235 262
648 3300046517 Ga0495630_0000647 Ga0495630_0000647_9854_10714 262
649 3300046529 Ga0495652_0000038 Ga0495652_0000038_52386_53246 262
650 3300046533 Ga0495640_0000001 Ga0495640_0000001_40885_41745 262
651 3300046536 Ga0495587_0000004 Ga0495587_0000004_95963_96823 262
652 3300046543 Ga0495645_0000001 Ga0495645_0000001_261758_262618 262
653 3300046559 Ga0495667_0000093 Ga0495667_0000093_43504_44364 262
654 3300046642 Ga0495634_0000133 Ga0495634_0000133_25728_26588 262
655 3300046663 Ga0495635_0000003 Ga0495635_0000003_261389_262249 262
656 3300046675 Ga0495657_0000143 Ga0495657_0000143_25695_26555 262
657 3300046678 Ga0495599_0000012 Ga0495599_0000012_35977_36837 262
658 3300046679 Ga0495623_0000015 Ga0495623_0000015_73040_73900 262
659 3300046680 Ga0495646_0000005 Ga0495646_0000005_173929_174789 262
660 3300046689 Ga0495613_0049291 Ga0495613_0049291_78_938 262
661 3300046809 Ga0495600_0000051 Ga0495600_0000051_28873_29733 262
662 3300047315 Ga0495581_0024892 Ga0495581_0024892_2042_2902 262
663 3300047317 Ga0495604_0000002 Ga0495604_0000002_268400_269260 262
664 3300047319 Ga0495674_0000004 Ga0495674_0000004_267949_268809 262
665 3300047322 Ga0495680_0000142 Ga0495680_0000142_56400_57260 262
666 3300047444 Ga0495675_0000824 Ga0495675_0000824_2540_3400 262
667 3300047471 Ga0495684_0000004 Ga0495684_0000004_248825_249685 262
668 3300047673 Ga0495593_0001806 Ga0495593_0001806_11791_12651 262
669 3300048088 Ga0495602_0000001 Ga0495602_0000001_261431_262291 262
670 3300053077 Ga0495601_0000026 Ga0495601_0000026_49460_50320 262
671 3300053078 Ga0495612_0000005 Ga0495612_0000005_37712_38572 262
672 3300053084 Ga0495595_0000058 Ga0495595_0000058_31923_32783 262
673 3300053085 Ga0495619_0000003 Ga0495619_0000003_266553_267413 262
674 3300053130 Ga0500642_0028181 Ga0500642_0028181_909_1814 262
675 3300003187 JGI25151J46595_10011179 JGI25151J46595_100111791 263
676 3300005353 Ga0070669_100202067 Ga0070669_1002020671 263
677 3300005548 Ga0070665_100013778 Ga0070665_1000137784 263
678 3300006051 Ga0075364_10011379 Ga0075364_100113793 263
679 3300006178 Ga0075367_10081989 Ga0075367_100819892 263
680 3300006186 Ga0075369_10001766 Ga0075369_100017666 263
681 3300006195 Ga0075366_10097275 Ga0075366_100972752 263
682 3300007788 Ga0099795_10016233 Ga0099795_100162333 263
683 3300009148 Ga0105243_10015381 Ga0105243_100153816 263
684 3300013100 Ga0157373_10002050 Ga0157373_100020506 263
685 3300013102 Ga0157371_10000380 Ga0157371_1000038032 263
686 3300013104 Ga0157370_10000748 Ga0157370_1000074817 263
687 3300025294 Ga0209025_1000074 Ga0209025_1000074213 263
688 3300025294 Ga0209025_1000080 Ga0209025_100008080 263
689 3300025297 Ga0209758_1002322 Ga0209758_10023224 263
690 3300025297 Ga0209758_1011638 Ga0209758_10116385 263
691 3300025298 Ga0209050_1015422 Ga0209050_10154223 263
692 3300025303 Ga0209051_1002851 Ga0209051_10028512 263
693 3300025304 Ga0209257_1002587 Ga0209257_100258713 263
694 3300027512 Ga0209179_1002629 Ga0209179_10026292 263
695 3300028379 Ga0268266_10002687 Ga0268266_100026878 263
696 3300030744 Ga0316181_1162723 Ga0316181_11627234 263
697 3300048919 Ga0496116_0108471 Ga0496116_0108471_145_963 263
698 3300048920 Ga0496117_0000002 Ga0496117_0000002_1529941_1530759 263
699 3300048921 Ga0496118_0000214 Ga0496118_0000214_18231_19049 263
700 3300048922 Ga0496119_0033566 Ga0496119_0033566_1682_2500 263
701 3300048923 Ga0496120_0000125 Ga0496120_0000125_98588_99406 263
702 3300048925 Ga0496122_0000001 Ga0496122_0000001_900730_901548 263
703 3300048926 Ga0496123_0000001 Ga0496123_0000001_904461_905279 263
704 3300048927 Ga0496124_0007143 Ga0496124_0007143_689_1507 263
705 3300048928 Ga0496125_0041483 Ga0496125_0041483_1705_2523 263
706 3300048929 Ga0496126_0204233 Ga0496126_0204233_139_957 263
707 3300050491 nmdc:mga00v17_187_c1 nmdc:mga00v17_187_c1_22486_23304 263
708 3300050491 nmdc:mga00v17_45908_c1 nmdc:mga00v17_45908_c1_498_1316 263
709 3300050492 nmdc:mga0yw44_24154_c1 nmdc:mga0yw44_24154_c1_864_1682 263
710 3300050492 nmdc:mga0yw44_2601_c1 nmdc:mga0yw44_2601_c1_4410_5231 263
711 3300050494 nmdc:mga06z11_83395_c1 nmdc:mga06z11_83395_c1_449_1267 263
712 3300050516 nmdc:mga0sz30_150_c1 nmdc:mga0sz30_150_c1_144_962 263
713 3300050516 nmdc:mga0sz30_21896_c1 nmdc:mga0sz30_21896_c1_59_877 263
714 3300053137 Ga0500561_0000283 Ga0500561_0000283_4599_5417 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

279

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7456 61 253
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.686 62 247
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.6828 61 256
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6795 61 253
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.6718 22 261
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9048 69 249 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9008 71 251 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9005 68 250 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8898 73 250 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8736 68 252 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1F4FIS4-F1-model_v4 ABC transporter permease 0.9464 23 261 GO:0005886
GO:0055085
AF-A0A2D6YM04-F1-model_v4 ABC transporter permease 0.9441 19 259 GO:0005886
GO:0055085
AF-A0A6N7GG86-F1-model_v4 ABC transporter permease subunit 0.944 48 260 GO:0005886
GO:0055085
AF-A0A1E7TV73-F1-model_v4 deleted 0.9405 31 256
AF-A0A2E2DT26-F1-model_v4 deleted 0.9404 32 260

Feature Viewer

pLDDT pTM Quality
81.93 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map