F476846
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 294 | 698 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0694182|Ga0436365_0694182_1124_1852 |
| Length | 242 |
| Sequence | MRRSQAIEKALACRLAPRYREAMAGQRKTTIGNRLAPPRFILFVVVEVAVTAGLLLSGLVDTRQATMIGFDAAALIFLVACLPLFAGSDAASMRTHAERNDANRVLLLAITGAVMVAILVAVASEVVGGSPEPFQKILVLATLVLAWLFSNTVYALHYADLCYHPEETKRRGGGLGLEFPTTPAPDYADFAYFAFTLGMTFQTSDVSITSRRIRAVVTVHCFAAFVFNLGVLAFTINVLGSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 5 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 6 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 7 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 8 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 9 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 10 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 11 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 12 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 13 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 14 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 15 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 16 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 17 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 207 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 208 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 240 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 241 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 242 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 263 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 273 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 274 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 275 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 276 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 277 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 278 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 279 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 280 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 283 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 284 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 286 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 287 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 289 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 291 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 292 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 294 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.75 |
| Metatranscriptomes | 0.28 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.57 |
| Nodule | 0 |
| Rhizoplane | 0.98 |
| Rhizosphere | 83.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1002432 | 3300001904 | Bacteria | 3291 |
| 2 | JGI24741J21665_1000810 | 3300001915 | Bacteria | 9394 |
| 3 | JGI24752J21851_1006200 | 3300001976 | Bacteria | 1561 |
| 4 | JGI24740J21852_10008231 | 3300001979 | Bacteria | 4173 |
| 5 | JGI24740J21852_10059086 | 3300001979 | Bacteria | 1064 |
| 6 | JGI24739J22299_10031369 | 3300001989 | Bacteria | 1836 |
| 7 | JGI24737J22298_10024139 | 3300001990 | Bacteria | 1926 |
| 8 | JGI24735J21928_10000764 | 3300002067 | Bacteria | 11442 |
| 9 | JGI24738J21930_10002662 | 3300002075 | Bacteria | 4604 |
| 10 | JGI25151J46595_10019050 | 3300003187 | Bacteria | 2928 |
| 11 | rootH1_10025996 | 3300003316 | Bacteria | 1382 |
| 12 | rootH2_10206796 | 3300003320 | Bacteria | 1395 |
| 13 | rootL2_10096988 | 3300003322 | Bacteria | 2318 |
| 14 | rootL2_10112214 | 3300003322 | Bacteria | 4236 |
| 15 | Ga0055536_1000943 | 3300003781 | Bacteria | 18711 |
| 16 | Ga0055536_1001481 | 3300003781 | Bacteria | 14130 |
| 17 | Ga0055536_1005438 | 3300003781 | Bacteria | 6226 |
| 18 | Ga0055530_10000092 | 3300003791 | Bacteria | 77982 |
| 19 | Ga0055531_10002266 | 3300003794 | Bacteria | 13019 |
| 20 | Ga0055531_10003124 | 3300003794 | Bacteria | 10691 |
| 21 | Ga0055531_10006170 | 3300003794 | Bacteria | 6853 |
| 22 | Ga0065704_10005861 | 3300005289 | Bacteria | 4388 |
| 23 | Ga0065715_10036833 | 3300005293 | Bacteria | 1810 |
| 24 | Ga0065707_10081805 | 3300005295 | Bacteria | 38502 |
| 25 | Ga0070658_10000003 | 3300005327 | Bacteria | 465963 |
| 26 | Ga0070658_10037754 | 3300005327 | Bacteria | 3894 |
| 27 | Ga0070658_10079426 | 3300005327 | Bacteria | 2694 |
| 28 | Ga0070658_10204152 | 3300005327 | Bacteria | 1668 |
| 29 | Ga0070658_10401929 | 3300005327 | Bacteria | 1177 |
| 30 | Ga0070676_10005451 | 3300005328 | Bacteria | 6778 |
| 31 | Ga0070676_10043173 | 3300005328 | Bacteria | 2619 |
| 32 | Ga0070683_100006299 | 3300005329 | Bacteria | 9957 |
| 33 | Ga0070683_100251284 | 3300005329 | Bacteria | 1682 |
| 34 | Ga0070683_100605363 | 3300005329 | Bacteria | 1049 |
| 35 | Ga0070670_100000586 | 3300005331 | Bacteria | 28767 |
| 36 | Ga0070670_100001053 | 3300005331 | Bacteria | 21912 |
| 37 | Ga0070670_100036985 | 3300005331 | Bacteria | 4200 |
| 38 | Ga0070670_100062557 | 3300005331 | Bacteria | 3195 |
| 39 | Ga0070670_100084749 | 3300005331 | Bacteria | 2723 |
| 40 | Ga0068869_100144129 | 3300005334 | Bacteria | 1842 |
| 41 | Ga0068869_100212021 | 3300005334 | Bacteria | 1531 |
| 42 | Ga0070666_10000908 | 3300005335 | Bacteria | 17985 |
| 43 | Ga0070666_10004770 | 3300005335 | Bacteria | 8285 |
| 44 | Ga0070666_10023039 | 3300005335 | Bacteria | 4049 |
| 45 | Ga0070666_10077145 | 3300005335 | Bacteria | 2274 |
| 46 | Ga0070680_100004587 | 3300005336 | Bacteria | 10387 |
| 47 | Ga0070680_100269244 | 3300005336 | Bacteria | 1442 |
| 48 | Ga0070682_100023894 | 3300005337 | Bacteria | 3633 |
| 49 | Ga0068868_100000090 | 3300005338 | Bacteria | 55967 |
| 50 | Ga0068868_100203493 | 3300005338 | Bacteria | 1652 |
| 51 | Ga0068868_100360898 | 3300005338 | Bacteria | 1246 |
| 52 | Ga0070660_100001199 | 3300005339 | Bacteria | 17568 |
| 53 | Ga0070660_100002551 | 3300005339 | Bacteria | 12486 |
| 54 | Ga0070660_100003259 | 3300005339 | Bacteria | 11135 |
| 55 | Ga0070660_100007800 | 3300005339 | Bacteria | 7465 |
| 56 | Ga0070660_100011384 | 3300005339 | Bacteria | 6317 |
| 57 | Ga0070660_100029820 | 3300005339 | Bacteria | 4090 |
| 58 | Ga0070660_100134541 | 3300005339 | Bacteria | 1980 |
| 59 | Ga0070660_100432910 | 3300005339 | Bacteria | 1090 |
| 60 | Ga0070661_100000113 | 3300005344 | Bacteria | 67566 |
| 61 | Ga0070661_100025440 | 3300005344 | Bacteria | 4254 |
| 62 | Ga0070661_100043382 | 3300005344 | Bacteria | 3285 |
| 63 | Ga0070661_100096755 | 3300005344 | Bacteria | 2191 |
| 64 | Ga0070661_100474888 | 3300005344 | Bacteria | 998 |
| 65 | Ga0070668_100000056 | 3300005347 | Bacteria | 70052 |
| 66 | Ga0070668_100000112 | 3300005347 | Bacteria | 50544 |
| 67 | Ga0070668_100002391 | 3300005347 | Bacteria | 13795 |
| 68 | Ga0070668_100086043 | 3300005347 | Bacteria | 2471 |
| 69 | Ga0070668_100088515 | 3300005347 | Bacteria | 2438 |
| 70 | Ga0070668_100093379 | 3300005347 | Bacteria | 2374 |
| 71 | Ga0070669_100000113 | 3300005353 | Bacteria | 77341 |
| 72 | Ga0070669_100018859 | 3300005353 | Bacteria | 4931 |
| 73 | Ga0070669_100022511 | 3300005353 | Bacteria | 4505 |
| 74 | Ga0070669_100028059 | 3300005353 | Bacteria | 4052 |
| 75 | Ga0070669_100044837 | 3300005353 | Bacteria | 3222 |
| 76 | Ga0070669_100049600 | 3300005353 | Bacteria | 3065 |
| 77 | Ga0070669_100412491 | 3300005353 | Bacteria | 1107 |
| 78 | Ga0070669_100583389 | 3300005353 | Unclassified | 935 |
| 79 | Ga0070675_100052628 | 3300005354 | Bacteria | 3348 |
| 80 | Ga0070675_100210104 | 3300005354 | Bacteria | 1691 |
| 81 | Ga0070671_100000038 | 3300005355 | Bacteria | 94972 |
| 82 | Ga0070671_100000601 | 3300005355 | Bacteria | 25698 |
| 83 | Ga0070671_100797283 | 3300005355 | Bacteria | 822 |
| 84 | Ga0070674_100023631 | 3300005356 | Bacteria | 3981 |
| 85 | Ga0070674_100142313 | 3300005356 | Bacteria | 1801 |
| 86 | Ga0070673_100447586 | 3300005364 | Bacteria | 1161 |
| 87 | Ga0070659_100000017 | 3300005366 | Bacteria | 163966 |
| 88 | Ga0070659_100002449 | 3300005366 | Bacteria | 13190 |
| 89 | Ga0070659_100029300 | 3300005366 | Bacteria | 4254 |
| 90 | Ga0070659_100050509 | 3300005366 | Bacteria | 3269 |
| 91 | Ga0070659_100107204 | 3300005366 | Bacteria | 2253 |
| 92 | Ga0070659_100423701 | 3300005366 | Bacteria | 1126 |
| 93 | Ga0070667_100000058 | 3300005367 | Bacteria | 148071 |
| 94 | Ga0070667_100000215 | 3300005367 | Bacteria | 67317 |
| 95 | Ga0070667_100000710 | 3300005367 | Bacteria | 32106 |
| 96 | Ga0070667_100005459 | 3300005367 | Bacteria | 10620 |
| 97 | Ga0070667_100013316 | 3300005367 | Bacteria | 6794 |
| 98 | Ga0070667_100049062 | 3300005367 | Bacteria | 3555 |
| 99 | Ga0070667_100053412 | 3300005367 | Bacteria | 3410 |
| 100 | Ga0070667_100077148 | 3300005367 | Bacteria | 2845 |
| 101 | Ga0070667_100630742 | 3300005367 | Bacteria | 989 |
| 102 | Ga0070701_10126630 | 3300005438 | Bacteria | 1446 |
| 103 | Ga0070705_100039054 | 3300005440 | Bacteria | 2691 |
| 104 | Ga0070663_100003727 | 3300005455 | Bacteria | 8837 |
| 105 | Ga0070663_100006853 | 3300005455 | Bacteria | 6893 |
| 106 | Ga0070663_100110401 | 3300005455 | Bacteria | 2065 |
| 107 | Ga0070663_100128922 | 3300005455 | Bacteria | 1919 |
| 108 | Ga0070663_100826306 | 3300005455 | Bacteria | 796 |
| 109 | Ga0070662_100002519 | 3300005457 | Bacteria | 11285 |
| 110 | Ga0070662_100009237 | 3300005457 | Bacteria | 6440 |
| 111 | Ga0070662_100077150 | 3300005457 | Bacteria | 2472 |
| 112 | Ga0070662_100093853 | 3300005457 | Bacteria | 2258 |
| 113 | Ga0070662_100195741 | 3300005457 | Bacteria | 1601 |
| 114 | Ga0070662_100462248 | 3300005457 | Bacteria | 1055 |
| 115 | Ga0070681_10092271 | 3300005458 | Bacteria | 2977 |
| 116 | Ga0068867_100013276 | 3300005459 | Bacteria | 5835 |
| 117 | Ga0070679_100002379 | 3300005530 | Bacteria | 17052 |
| 118 | Ga0070679_100009942 | 3300005530 | Bacteria | 9006 |
| 119 | Ga0070679_100041996 | 3300005530 | Bacteria | 4554 |
| 120 | Ga0070679_100079830 | 3300005530 | Bacteria | 3261 |
| 121 | Ga0070679_100279968 | 3300005530 | Bacteria | 1621 |
| 122 | Ga0070684_100332375 | 3300005535 | Bacteria | 1396 |
| 123 | Ga0068853_100152672 | 3300005539 | Bacteria | 2079 |
| 124 | Ga0068853_100172730 | 3300005539 | Bacteria | 1956 |
| 125 | Ga0068853_100178109 | 3300005539 | Bacteria | 1927 |
| 126 | Ga0068853_100208611 | 3300005539 | Bacteria | 1780 |
| 127 | Ga0070672_100020073 | 3300005543 | Bacteria | 4867 |
| 128 | Ga0070672_100022570 | 3300005543 | Bacteria | 4625 |
| 129 | Ga0070686_100000179 | 3300005544 | Bacteria | 44874 |
| 130 | Ga0070695_100416424 | 3300005545 | Bacteria | 1022 |
| 131 | Ga0070696_100005859 | 3300005546 | Bacteria | 8203 |
| 132 | Ga0070696_100006865 | 3300005546 | Bacteria | 7597 |
| 133 | Ga0070665_100000207 | 3300005548 | Bacteria | 102416 |
| 134 | Ga0070665_100061478 | 3300005548 | Bacteria | 3765 |
| 135 | Ga0070665_100094918 | 3300005548 | Bacteria | 2987 |
| 136 | Ga0070665_100162807 | 3300005548 | Bacteria | 2233 |
| 137 | Ga0068855_100011310 | 3300005563 | Bacteria | 10777 |
| 138 | Ga0068855_100023513 | 3300005563 | Bacteria | 7378 |
| 139 | Ga0068855_100170191 | 3300005563 | Bacteria | 2468 |
| 140 | Ga0068855_100198967 | 3300005563 | Bacteria | 2257 |
| 141 | Ga0070664_100035435 | 3300005564 | Bacteria | 4189 |
| 142 | Ga0070664_100066308 | 3300005564 | Bacteria | 3082 |
| 143 | Ga0070664_100117579 | 3300005564 | Bacteria | 2325 |
| 144 | Ga0068857_100007442 | 3300005577 | Bacteria | 9424 |
| 145 | Ga0068857_100013825 | 3300005577 | Bacteria | 7028 |
| 146 | Ga0068857_100064807 | 3300005577 | Bacteria | 3249 |
| 147 | Ga0068857_100089005 | 3300005577 | Bacteria | 2762 |
| 148 | Ga0068857_100126576 | 3300005577 | Bacteria | 2302 |
| 149 | Ga0068857_100237643 | 3300005577 | Bacteria | 1667 |
| 150 | Ga0068854_100002842 | 3300005578 | Bacteria | 10755 |
| 151 | Ga0068854_100086016 | 3300005578 | Bacteria | 2330 |
| 152 | Ga0068854_100298201 | 3300005578 | Bacteria | 1303 |
| 153 | Ga0068856_100005769 | 3300005614 | Bacteria | 12203 |
| 154 | Ga0068852_100019423 | 3300005616 | Bacteria | 5378 |
| 155 | Ga0068852_100045264 | 3300005616 | Bacteria | 3742 |
| 156 | Ga0068852_100120158 | 3300005616 | Bacteria | 2404 |
| 157 | Ga0068859_100000085 | 3300005617 | Bacteria | 85748 |
| 158 | Ga0068859_100018076 | 3300005617 | Bacteria | 7085 |
| 159 | Ga0068859_100022219 | 3300005617 | Bacteria | 6361 |
| 160 | Ga0068859_100037442 | 3300005617 | Bacteria | 4868 |
| 161 | Ga0068859_100117719 | 3300005617 | Bacteria | 2722 |
| 162 | Ga0068859_100866421 | 3300005617 | Bacteria | 989 |
| 163 | Ga0068864_100000041 | 3300005618 | Bacteria | 165878 |
| 164 | Ga0068864_100000352 | 3300005618 | Bacteria | 40434 |
| 165 | Ga0068864_100002862 | 3300005618 | Bacteria | 14259 |
| 166 | Ga0068866_10078161 | 3300005718 | Bacteria | 1769 |
| 167 | Ga0068861_100000282 | 3300005719 | Bacteria | 28556 |
| 168 | Ga0068861_100076201 | 3300005719 | Bacteria | 2613 |
| 169 | Ga0068861_100211253 | 3300005719 | Bacteria | 1635 |
| 170 | Ga0068861_100836461 | 3300005719 | Bacteria | 867 |
| 171 | Ga0068851_10161858 | 3300005834 | Bacteria | 1230 |
| 172 | Ga0068863_100000031 | 3300005841 | Bacteria | 175602 |
| 173 | Ga0068863_100000035 | 3300005841 | Bacteria | 165877 |
| 174 | Ga0068863_100007196 | 3300005841 | Bacteria | 10916 |
| 175 | Ga0068863_100010763 | 3300005841 | Bacteria | 8876 |
| 176 | Ga0068863_100016737 | 3300005841 | Bacteria | 7034 |
| 177 | Ga0068863_100098058 | 3300005841 | Bacteria | 2783 |
| 178 | Ga0068863_100176774 | 3300005841 | Bacteria | 2049 |
| 179 | Ga0068858_100000444 | 3300005842 | Bacteria | 43311 |
| 180 | Ga0068858_100001395 | 3300005842 | Bacteria | 24879 |
| 181 | Ga0068858_100001826 | 3300005842 | Bacteria | 21672 |
| 182 | Ga0068858_100054018 | 3300005842 | Bacteria | 3715 |
| 183 | Ga0068858_100082600 | 3300005842 | Bacteria | 2987 |
| 184 | Ga0068860_100000049 | 3300005843 | Bacteria | 208782 |
| 185 | Ga0068860_100001699 | 3300005843 | Bacteria | 23523 |
| 186 | Ga0068860_100004766 | 3300005843 | Bacteria | 13819 |
| 187 | Ga0068860_100005214 | 3300005843 | Bacteria | 13197 |
| 188 | Ga0068860_100007900 | 3300005843 | Bacteria | 10619 |
| 189 | Ga0068860_100031421 | 3300005843 | Bacteria | 5104 |
| 190 | Ga0068862_100000042 | 3300005844 | Bacteria | 165084 |
| 191 | Ga0068862_100001040 | 3300005844 | Bacteria | 26611 |
| 192 | Ga0068862_100003039 | 3300005844 | Bacteria | 14609 |
| 193 | Ga0068862_100018982 | 3300005844 | Bacteria | 5732 |
| 194 | Ga0068862_100071963 | 3300005844 | Bacteria | 2986 |
| 195 | Ga0068862_100091969 | 3300005844 | Bacteria | 2643 |
| 196 | Ga0068862_100110063 | 3300005844 | Bacteria | 2417 |
| 197 | Ga0068862_100122744 | 3300005844 | Bacteria | 2291 |
| 198 | Ga0068862_100139529 | 3300005844 | Bacteria | 2150 |
| 199 | Ga0075368_10001383 | 3300006042 | Bacteria | 7729 |
| 200 | Ga0075364_10025101 | 3300006051 | Bacteria | 3792 |
| 201 | Ga0075432_10000674 | 3300006058 | Bacteria | 10501 |
| 202 | Ga0075367_10002205 | 3300006178 | Bacteria | 8788 |
| 203 | Ga0075366_10004156 | 3300006195 | Bacteria | 7755 |
| 204 | Ga0097621_100006688 | 3300006237 | Bacteria | 8193 |
| 205 | Ga0075370_10026878 | 3300006353 | Bacteria | 3190 |
| 206 | Ga0075370_10058548 | 3300006353 | Bacteria | 2192 |
| 207 | Ga0068871_100001230 | 3300006358 | Bacteria | 17096 |
| 208 | Ga0068871_100060613 | 3300006358 | Bacteria | 3087 |
| 209 | Ga0075434_100220874 | 3300006871 | Bacteria | 1914 |
| 210 | Ga0075434_100450853 | 3300006871 | Bacteria | 1308 |
| 211 | Ga0075434_100550281 | 3300006871 | Unclassified | 1174 |
| 212 | Ga0068865_100034970 | 3300006881 | Bacteria | 3375 |
| 213 | Ga0068865_100047012 | 3300006881 | Bacteria | 2963 |
| 214 | Ga0097620_100000085 | 3300006931 | Bacteria | 85748 |
| 215 | Ga0097620_100018077 | 3300006931 | Bacteria | 7085 |
| 216 | Ga0097620_100022219 | 3300006931 | Bacteria | 6361 |
| 217 | Ga0097620_100037440 | 3300006931 | Bacteria | 4868 |
| 218 | Ga0097620_100117721 | 3300006931 | Bacteria | 2722 |
| 219 | Ga0097620_100866482 | 3300006931 | Bacteria | 989 |
| 220 | Ga0075435_100141620 | 3300007076 | Bacteria | 2018 |
| 221 | Ga0105251_10000180 | 3300009011 | Bacteria | 63702 |
| 222 | Ga0105251_10012298 | 3300009011 | Bacteria | 4849 |
| 223 | Ga0105240_10072933 | 3300009093 | Bacteria | 4241 |
| 224 | Ga0105240_10074677 | 3300009093 | Bacteria | 4184 |
| 225 | Ga0105240_10682812 | 3300009093 | Bacteria | 1123 |
| 226 | Ga0105240_10738808 | 3300009093 | Bacteria | 1071 |
| 227 | Ga0111539_10116009 | 3300009094 | Bacteria | 3140 |
| 228 | Ga0111539_10165127 | 3300009094 | Bacteria | 2589 |
| 229 | Ga0111539_10479863 | 3300009094 | Bacteria | 1448 |
| 230 | Ga0105245_10269152 | 3300009098 | Bacteria | 1661 |
| 231 | Ga0105245_10547729 | 3300009098 | Bacteria | 1178 |
| 232 | Ga0105247_10005830 | 3300009101 | Bacteria | 7700 |
| 233 | Ga0105247_10010754 | 3300009101 | Bacteria | 5527 |
| 234 | Ga0105243_10144357 | 3300009148 | Bacteria | 2035 |
| 235 | Ga0105243_10213196 | 3300009148 | Bacteria | 1702 |
| 236 | Ga0105241_10002299 | 3300009174 | Bacteria | 14362 |
| 237 | Ga0105242_10595371 | 3300009176 | Bacteria | 1067 |
| 238 | Ga0105248_10000045 | 3300009177 | Bacteria | 165909 |
| 239 | Ga0105248_10000296 | 3300009177 | Bacteria | 59123 |
| 240 | Ga0105248_10004622 | 3300009177 | Bacteria | 15222 |
| 241 | Ga0105248_10010024 | 3300009177 | Bacteria | 10432 |
| 242 | Ga0105248_10027704 | 3300009177 | Bacteria | 6310 |
| 243 | Ga0105248_10080237 | 3300009177 | Bacteria | 3667 |
| 244 | Ga0105248_10086290 | 3300009177 | Bacteria | 3532 |
| 245 | Ga0105248_10132717 | 3300009177 | Bacteria | 2810 |
| 246 | Ga0105248_10230124 | 3300009177 | Bacteria | 2087 |
| 247 | Ga0105248_11277878 | 3300009177 | Bacteria | 830 |
| 248 | Ga0105237_10004065 | 3300009545 | Bacteria | 17062 |
| 249 | Ga0105237_10488760 | 3300009545 | Bacteria | 1237 |
| 250 | Ga0105238_10226677 | 3300009551 | Bacteria | 1845 |
| 251 | Ga0105249_10000055 | 3300009553 | Bacteria | 161674 |
| 252 | Ga0105249_10007728 | 3300009553 | Bacteria | 9371 |
| 253 | Ga0105249_10022022 | 3300009553 | Bacteria | 5707 |
| 254 | Ga0105249_10059373 | 3300009553 | Bacteria | 3508 |
| 255 | Ga0105249_10196155 | 3300009553 | Bacteria | 1973 |
| 256 | Ga0105249_10749480 | 3300009553 | Bacteria | 1039 |
| 257 | Ga0105249_11160037 | 3300009553 | Bacteria | 843 |
| 258 | Ga0105239_10002689 | 3300010375 | Bacteria | 22375 |
| 259 | Ga0105239_10329108 | 3300010375 | Bacteria | 1723 |
| 260 | Ga0105246_10002637 | 3300011119 | Bacteria | 10862 |
| 261 | Ga0105246_10055468 | 3300011119 | Bacteria | 2735 |
| 262 | Ga0105246_10273048 | 3300011119 | Bacteria | 1352 |
| 263 | Ga0157373_10051195 | 3300013100 | Bacteria | 2942 |
| 264 | Ga0157373_10070595 | 3300013100 | Bacteria | 2468 |
| 265 | Ga0157373_10122487 | 3300013100 | Bacteria | 1828 |
| 266 | Ga0157371_10389594 | 3300013102 | Bacteria | 1018 |
| 267 | Ga0157370_10070441 | 3300013104 | Bacteria | 3300 |
| 268 | Ga0157370_10555801 | 3300013104 | Bacteria | 1052 |
| 269 | Ga0157370_10598150 | 3300013104 | Bacteria | 1010 |
| 270 | Ga0163162_10003520 | 3300013306 | Bacteria | 14982 |
| 271 | Ga0163162_10058628 | 3300013306 | Bacteria | 3880 |
| 272 | Ga0163162_10099028 | 3300013306 | Bacteria | 3005 |
| 273 | Ga0163162_10798385 | 3300013306 | Bacteria | 1061 |
| 274 | Ga0157372_10130324 | 3300013307 | Bacteria | 2893 |
| 275 | Ga0157372_10361414 | 3300013307 | Bacteria | 1692 |
| 276 | Ga0157372_10975682 | 3300013307 | Bacteria | 982 |
| 277 | Ga0157372_11008636 | 3300013307 | Bacteria | 964 |
| 278 | Ga0157375_10174162 | 3300013308 | Bacteria | 2301 |
| 279 | Ga0157375_10308550 | 3300013308 | Bacteria | 1746 |
| 280 | Ga0157375_10460611 | 3300013308 | Bacteria | 1437 |
| 281 | Ga0157375_10617352 | 3300013308 | Bacteria | 1242 |
| 282 | Ga0157375_10840495 | 3300013308 | Bacteria | 1065 |
| 283 | Ga0163163_10169888 | 3300014325 | Bacteria | 2227 |
| 284 | Ga0157380_10001987 | 3300014326 | Bacteria | 13613 |
| 285 | Ga0157380_10415209 | 3300014326 | Bacteria | 1282 |
| 286 | Ga0157380_10463201 | 3300014326 | Bacteria | 1221 |
| 287 | Ga0157377_10018629 | 3300014745 | Bacteria | 3611 |
| 288 | Ga0157379_10004695 | 3300014968 | Bacteria | 11728 |
| 289 | Ga0157379_10014954 | 3300014968 | Bacteria | 6806 |
| 290 | Ga0163161_10022483 | 3300017792 | Bacteria | 4441 |
| 291 | Ga0163161_10292968 | 3300017792 | Bacteria | 1280 |
| 292 | Ga0206354_10118545 | 3300020081 | Bacteria | 1515 |
| 293 | Ga0206353_11409418 | 3300020082 | Bacteria | 3019 |
| 294 | Ga0213876_10012578 | 3300021384 | Bacteria | 4503 |
| 295 | Ga0213875_10002279 | 3300021388 | Bacteria | 11630 |
| 296 | Ga0209675_1000366 | 3300025291 | Bacteria | 38418 |
| 297 | Ga0209676_1000081 | 3300025292 | Bacteria | 285297 |
| 298 | Ga0209676_1000133 | 3300025292 | Bacteria | 184430 |
| 299 | Ga0209676_1000187 | 3300025292 | Bacteria | 141338 |
| 300 | Ga0209025_1000669 | 3300025294 | Bacteria | 59314 |
| 301 | Ga0209025_1007910 | 3300025294 | Bacteria | 7787 |
| 302 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 303 | Ga0209050_1002482 | 3300025298 | Bacteria | 15635 |
| 304 | Ga0209050_1011468 | 3300025298 | Bacteria | 4195 |
| 305 | Ga0209051_1014308 | 3300025303 | Bacteria | 3710 |
| 306 | Ga0209257_1000132 | 3300025304 | Bacteria | 210870 |
| 307 | Ga0209257_1000359 | 3300025304 | Bacteria | 93026 |
| 308 | Ga0209257_1043464 | 3300025304 | Bacteria | 1318 |
| 309 | Ga0207697_10002053 | 3300025315 | Bacteria | 10604 |
| 310 | Ga0207697_10006670 | 3300025315 | Bacteria | 5199 |
| 311 | Ga0207697_10016025 | 3300025315 | Bacteria | 3092 |
| 312 | Ga0207697_10141693 | 3300025315 | Bacteria | 1043 |
| 313 | Ga0207656_10057054 | 3300025321 | Bacteria | 1703 |
| 314 | Ga0207656_10098746 | 3300025321 | Bacteria | 1336 |
| 315 | Ga0207713_1000939 | 3300025735 | Bacteria | 26164 |
| 316 | Ga0207713_1014924 | 3300025735 | Bacteria | 4008 |
| 317 | Ga0207682_10024490 | 3300025893 | Bacteria | 2390 |
| 318 | Ga0207642_10150799 | 3300025899 | Bacteria | 1237 |
| 319 | Ga0207710_10002951 | 3300025900 | Bacteria | 7704 |
| 320 | Ga0207710_10004160 | 3300025900 | Bacteria | 6351 |
| 321 | Ga0207680_10000082 | 3300025903 | Bacteria | 42968 |
| 322 | Ga0207680_10003667 | 3300025903 | Bacteria | 7217 |
| 323 | Ga0207680_10011910 | 3300025903 | Bacteria | 4414 |
| 324 | Ga0207680_10039981 | 3300025903 | Bacteria | 2725 |
| 325 | Ga0207680_10043943 | 3300025903 | Bacteria | 2624 |
| 326 | Ga0207680_10488542 | 3300025903 | Bacteria | 876 |
| 327 | Ga0207647_10000297 | 3300025904 | Bacteria | 40885 |
| 328 | Ga0207647_10022931 | 3300025904 | Bacteria | 4139 |
| 329 | Ga0207647_10030168 | 3300025904 | Bacteria | 3501 |
| 330 | Ga0207645_10009118 | 3300025907 | Bacteria | 6882 |
| 331 | Ga0207645_10025449 | 3300025907 | Bacteria | 3829 |
| 332 | Ga0207643_10041090 | 3300025908 | Bacteria | 2605 |
| 333 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 334 | Ga0207705_10001221 | 3300025909 | Bacteria | 20793 |
| 335 | Ga0207705_10001485 | 3300025909 | Bacteria | 18661 |
| 336 | Ga0207705_10297955 | 3300025909 | Bacteria | 1236 |
| 337 | Ga0207707_10073708 | 3300025912 | Bacteria | 2977 |
| 338 | Ga0207695_10015828 | 3300025913 | Bacteria | 8859 |
| 339 | Ga0207695_10023626 | 3300025913 | Bacteria | 6937 |
| 340 | Ga0207695_10060858 | 3300025913 | Bacteria | 3905 |
| 341 | Ga0207671_10001440 | 3300025914 | Bacteria | 27565 |
| 342 | Ga0207671_10186288 | 3300025914 | Bacteria | 1617 |
| 343 | Ga0207660_10003861 | 3300025917 | Bacteria | 9764 |
| 344 | Ga0207660_10100600 | 3300025917 | Bacteria | 2159 |
| 345 | Ga0207662_10226556 | 3300025918 | Bacteria | 1219 |
| 346 | Ga0207657_10000530 | 3300025919 | Bacteria | 40507 |
| 347 | Ga0207657_10002188 | 3300025919 | Bacteria | 21178 |
| 348 | Ga0207657_10003138 | 3300025919 | Bacteria | 17677 |
| 349 | Ga0207657_10004555 | 3300025919 | Bacteria | 14650 |
| 350 | Ga0207657_10008611 | 3300025919 | Bacteria | 10327 |
| 351 | Ga0207657_10009149 | 3300025919 | Bacteria | 9995 |
| 352 | Ga0207657_10014090 | 3300025919 | Bacteria | 7824 |
| 353 | Ga0207649_10000089 | 3300025920 | Bacteria | 76923 |
| 354 | Ga0207649_10003198 | 3300025920 | Bacteria | 8977 |
| 355 | Ga0207649_10305131 | 3300025920 | Bacteria | 1165 |
| 356 | Ga0207652_10000008 | 3300025921 | Bacteria | 286698 |
| 357 | Ga0207652_10001310 | 3300025921 | Bacteria | 22105 |
| 358 | Ga0207652_10229839 | 3300025921 | Bacteria | 1672 |
| 359 | Ga0207681_10000042 | 3300025923 | Bacteria | 137167 |
| 360 | Ga0207681_10016480 | 3300025923 | Bacteria | 4624 |
| 361 | Ga0207681_10020048 | 3300025923 | Bacteria | 4234 |
| 362 | Ga0207681_10031170 | 3300025923 | Bacteria | 3480 |
| 363 | Ga0207681_10583643 | 3300025923 | Unclassified | 922 |
| 364 | Ga0207694_10015661 | 3300025924 | Bacteria | 5719 |
| 365 | Ga0207650_10000238 | 3300025925 | Bacteria | 61061 |
| 366 | Ga0207650_10020631 | 3300025925 | Bacteria | 4648 |
| 367 | Ga0207650_10031130 | 3300025925 | Bacteria | 3850 |
| 368 | Ga0207650_10037426 | 3300025925 | Bacteria | 3535 |
| 369 | Ga0207650_10051546 | 3300025925 | Bacteria | 3046 |
| 370 | Ga0207650_10273210 | 3300025925 | Bacteria | 1374 |
| 371 | Ga0207659_10074272 | 3300025926 | Bacteria | 2492 |
| 372 | Ga0207687_10073443 | 3300025927 | Bacteria | 2449 |
| 373 | Ga0207644_10000071 | 3300025931 | Bacteria | 74753 |
| 374 | Ga0207644_10000316 | 3300025931 | Bacteria | 31524 |
| 375 | Ga0207644_10227767 | 3300025931 | Bacteria | 1480 |
| 376 | Ga0207644_10382401 | 3300025931 | Bacteria | 1148 |
| 377 | Ga0207690_10000035 | 3300025932 | Bacteria | 149201 |
| 378 | Ga0207690_10006633 | 3300025932 | Bacteria | 6858 |
| 379 | Ga0207690_10120910 | 3300025932 | Bacteria | 1902 |
| 380 | Ga0207690_10181700 | 3300025932 | Bacteria | 1584 |
| 381 | Ga0207706_10001755 | 3300025933 | Bacteria | 21276 |
| 382 | Ga0207706_10004081 | 3300025933 | Bacteria | 13792 |
| 383 | Ga0207706_10086680 | 3300025933 | Bacteria | 2753 |
| 384 | Ga0207706_10103828 | 3300025933 | Bacteria | 2500 |
| 385 | Ga0207706_10163511 | 3300025933 | Bacteria | 1956 |
| 386 | Ga0207706_10169249 | 3300025933 | Bacteria | 1920 |
| 387 | Ga0207706_10291421 | 3300025933 | Bacteria | 1423 |
| 388 | Ga0207709_10057335 | 3300025935 | Bacteria | 2415 |
| 389 | Ga0207709_10410467 | 3300025935 | Bacteria | 1038 |
| 390 | Ga0207709_10511494 | 3300025935 | Bacteria | 939 |
| 391 | Ga0207670_10086186 | 3300025936 | Bacteria | 2209 |
| 392 | Ga0207704_10011088 | 3300025938 | Bacteria | 4423 |
| 393 | Ga0207704_10025224 | 3300025938 | Bacteria | 3241 |
| 394 | Ga0207704_10464209 | 3300025938 | Bacteria | 1013 |
| 395 | Ga0207691_10005722 | 3300025940 | Bacteria | 12020 |
| 396 | Ga0207691_10485005 | 3300025940 | Bacteria | 1050 |
| 397 | Ga0207711_10000027 | 3300025941 | Bacteria | 236548 |
| 398 | Ga0207711_10000251 | 3300025941 | Bacteria | 57860 |
| 399 | Ga0207711_10003263 | 3300025941 | Bacteria | 14119 |
| 400 | Ga0207711_10005768 | 3300025941 | Bacteria | 10458 |
| 401 | Ga0207711_10090815 | 3300025941 | Bacteria | 2685 |
| 402 | Ga0207711_10106021 | 3300025941 | Bacteria | 2493 |
| 403 | Ga0207689_10468943 | 3300025942 | Bacteria | 1053 |
| 404 | Ga0207689_10470168 | 3300025942 | Bacteria | 1052 |
| 405 | Ga0207661_10334706 | 3300025944 | Bacteria | 1363 |
| 406 | Ga0207661_10449628 | 3300025944 | Bacteria | 1173 |
| 407 | Ga0207679_10010952 | 3300025945 | Bacteria | 5851 |
| 408 | Ga0207679_10429798 | 3300025945 | Bacteria | 1167 |
| 409 | Ga0207667_10019183 | 3300025949 | Bacteria | 7648 |
| 410 | Ga0207667_10023225 | 3300025949 | Bacteria | 6830 |
| 411 | Ga0207667_10027762 | 3300025949 | Bacteria | 6156 |
| 412 | Ga0207667_10117138 | 3300025949 | Bacteria | 2745 |
| 413 | Ga0207651_10106858 | 3300025960 | Bacteria | 2090 |
| 414 | Ga0207651_10118780 | 3300025960 | Bacteria | 2001 |
| 415 | Ga0207712_10000262 | 3300025961 | Bacteria | 51101 |
| 416 | Ga0207712_10000373 | 3300025961 | Bacteria | 39590 |
| 417 | Ga0207712_10009082 | 3300025961 | Bacteria | 6288 |
| 418 | Ga0207712_10109591 | 3300025961 | Bacteria | 2068 |
| 419 | Ga0207668_10000011 | 3300025972 | Bacteria | 184484 |
| 420 | Ga0207668_10000038 | 3300025972 | Bacteria | 112486 |
| 421 | Ga0207668_10000194 | 3300025972 | Bacteria | 41743 |
| 422 | Ga0207668_10001489 | 3300025972 | Bacteria | 13707 |
| 423 | Ga0207668_10013873 | 3300025972 | Bacteria | 4975 |
| 424 | Ga0207668_10573712 | 3300025972 | Bacteria | 980 |
| 425 | Ga0207668_10625506 | 3300025972 | Bacteria | 940 |
| 426 | Ga0207640_10073602 | 3300025981 | Bacteria | 2309 |
| 427 | Ga0207640_10111752 | 3300025981 | Bacteria | 1938 |
| 428 | Ga0207640_10161070 | 3300025981 | Bacteria | 1660 |
| 429 | Ga0207640_10433416 | 3300025981 | Bacteria | 1079 |
| 430 | Ga0207640_10765466 | 3300025981 | Bacteria | 834 |
| 431 | Ga0207658_10000014 | 3300025986 | Bacteria | 218248 |
| 432 | Ga0207658_10000037 | 3300025986 | Bacteria | 148087 |
| 433 | Ga0207658_10000362 | 3300025986 | Bacteria | 44869 |
| 434 | Ga0207658_10001094 | 3300025986 | Bacteria | 21877 |
| 435 | Ga0207658_10008451 | 3300025986 | Bacteria | 7006 |
| 436 | Ga0207658_10024756 | 3300025986 | Bacteria | 4200 |
| 437 | Ga0207658_10049566 | 3300025986 | Bacteria | 3086 |
| 438 | Ga0207658_10107262 | 3300025986 | Bacteria | 2201 |
| 439 | Ga0207658_10122634 | 3300025986 | Bacteria | 2075 |
| 440 | Ga0207677_10000317 | 3300026023 | Bacteria | 35378 |
| 441 | Ga0207677_10236952 | 3300026023 | Bacteria | 1474 |
| 442 | Ga0207677_10335334 | 3300026023 | Bacteria | 1262 |
| 443 | Ga0207703_10000974 | 3300026035 | Bacteria | 27552 |
| 444 | Ga0207703_10006783 | 3300026035 | Bacteria | 9127 |
| 445 | Ga0207703_10009090 | 3300026035 | Bacteria | 7822 |
| 446 | Ga0207703_10057481 | 3300026035 | Bacteria | 3172 |
| 447 | Ga0207639_10001542 | 3300026041 | Bacteria | 15463 |
| 448 | Ga0207639_10231492 | 3300026041 | Bacteria | 1602 |
| 449 | Ga0207639_10262778 | 3300026041 | Bacteria | 1510 |
| 450 | Ga0207678_10000079 | 3300026067 | Bacteria | 78764 |
| 451 | Ga0207678_10000487 | 3300026067 | Bacteria | 35968 |
| 452 | Ga0207678_10010495 | 3300026067 | Bacteria | 8136 |
| 453 | Ga0207678_10050109 | 3300026067 | Bacteria | 3608 |
| 454 | Ga0207678_10769227 | 3300026067 | Bacteria | 849 |
| 455 | Ga0207702_10001332 | 3300026078 | Bacteria | 24705 |
| 456 | Ga0207702_10337007 | 3300026078 | Bacteria | 1440 |
| 457 | Ga0207641_10000041 | 3300026088 | Bacteria | 191595 |
| 458 | Ga0207641_10000050 | 3300026088 | Bacteria | 175954 |
| 459 | Ga0207641_10000545 | 3300026088 | Bacteria | 42249 |
| 460 | Ga0207641_10007111 | 3300026088 | Bacteria | 9349 |
| 461 | Ga0207641_10033746 | 3300026088 | Bacteria | 4252 |
| 462 | Ga0207641_10100056 | 3300026088 | Bacteria | 2552 |
| 463 | Ga0207641_10228784 | 3300026088 | Bacteria | 1727 |
| 464 | Ga0207641_10245420 | 3300026088 | Bacteria | 1670 |
| 465 | Ga0207648_10029444 | 3300026089 | Bacteria | 4869 |
| 466 | Ga0207648_10247331 | 3300026089 | Bacteria | 1589 |
| 467 | Ga0207676_10000039 | 3300026095 | Bacteria | 171142 |
| 468 | Ga0207676_10001160 | 3300026095 | Bacteria | 19812 |
| 469 | Ga0207676_10001198 | 3300026095 | Bacteria | 19470 |
| 470 | Ga0207676_10001939 | 3300026095 | Bacteria | 15104 |
| 471 | Ga0207676_10012289 | 3300026095 | Bacteria | 6129 |
| 472 | Ga0207674_10002967 | 3300026116 | Bacteria | 21070 |
| 473 | Ga0207674_10014537 | 3300026116 | Bacteria | 8691 |
| 474 | Ga0207674_10019266 | 3300026116 | Bacteria | 7396 |
| 475 | Ga0207674_10031369 | 3300026116 | Bacteria | 5584 |
| 476 | Ga0207674_10042124 | 3300026116 | Bacteria | 4719 |
| 477 | Ga0207674_10329837 | 3300026116 | Bacteria | 1476 |
| 478 | Ga0207675_100000041 | 3300026118 | Bacteria | 90476 |
| 479 | Ga0207675_100001141 | 3300026118 | Bacteria | 26317 |
| 480 | Ga0207675_100022883 | 3300026118 | Bacteria | 5813 |
| 481 | Ga0207675_100104868 | 3300026118 | Bacteria | 2664 |
| 482 | Ga0207698_10020773 | 3300026142 | Bacteria | 4526 |
| 483 | Ga0207698_10417051 | 3300026142 | Bacteria | 1287 |
| 484 | Ga0209371_1016952 | 3300027312 | Bacteria | 1903 |
| 485 | Ga0209984_1017895 | 3300027424 | Bacteria | 954 |
| 486 | Ga0209813_10000033 | 3300027866 | Bacteria | 61945 |
| 487 | Ga0209974_10017606 | 3300027876 | Bacteria | 2369 |
| 488 | Ga0207428_10041256 | 3300027907 | Bacteria | 3737 |
| 489 | Ga0207428_10380124 | 3300027907 | Bacteria | 1036 |
| 490 | Ga0268266_10000171 | 3300028379 | Bacteria | 118317 |
| 491 | Ga0268266_10038807 | 3300028379 | Bacteria | 4054 |
| 492 | Ga0268266_10116312 | 3300028379 | Bacteria | 2375 |
| 493 | Ga0268265_10000043 | 3300028380 | Bacteria | 186081 |
| 494 | Ga0268265_10000061 | 3300028380 | Bacteria | 148625 |
| 495 | Ga0268265_10000162 | 3300028380 | Bacteria | 81713 |
| 496 | Ga0268265_10001829 | 3300028380 | Bacteria | 16980 |
| 497 | Ga0268265_10031292 | 3300028380 | Bacteria | 3842 |
| 498 | Ga0268265_10051589 | 3300028380 | Bacteria | 3105 |
| 499 | Ga0268265_10120734 | 3300028380 | Bacteria | 2158 |
| 500 | Ga0268265_10152024 | 3300028380 | Bacteria | 1953 |
| 501 | Ga0268265_10393094 | 3300028380 | Bacteria | 1279 |
| 502 | Ga0268264_10000121 | 3300028381 | Bacteria | 190368 |
| 503 | Ga0268264_10000154 | 3300028381 | Bacteria | 156992 |
| 504 | Ga0268264_10001121 | 3300028381 | Bacteria | 26366 |
| 505 | Ga0268264_10002411 | 3300028381 | Bacteria | 16456 |
| 506 | Ga0268264_10005031 | 3300028381 | Bacteria | 11184 |
| 507 | Ga0268264_10203364 | 3300028381 | Bacteria | 1813 |
| 508 | Ga0268264_10331890 | 3300028381 | Bacteria | 1441 |
| 509 | Ga0307517_10299091 | 3300028786 | Bacteria | 904 |
| 510 | Ga0307513_10064765 | 3300031456 | Bacteria | 3849 |
| 511 | Ga0307513_10489333 | 3300031456 | Bacteria | 949 |
| 512 | Ga0307408_100014219 | 3300031548 | Bacteria | 5287 |
| 513 | Ga0307408_100016941 | 3300031548 | Bacteria | 4871 |
| 514 | Ga0307410_10009509 | 3300031852 | Bacteria | 5454 |
| 515 | Ga0307410_10081926 | 3300031852 | Bacteria | 2268 |
| 516 | Ga0307410_10165176 | 3300031852 | Bacteria | 1663 |
| 517 | Ga0307406_10029153 | 3300031901 | Bacteria | 3341 |
| 518 | Ga0307406_10049021 | 3300031901 | Bacteria | 2671 |
| 519 | Ga0307406_10200758 | 3300031901 | Bacteria | 1467 |
| 520 | Ga0307407_10731479 | 3300031903 | Bacteria | 748 |
| 521 | Ga0307412_10138085 | 3300031911 | Bacteria | 1781 |
| 522 | Ga0307412_10149265 | 3300031911 | Bacteria | 1722 |
| 523 | Ga0307412_10198588 | 3300031911 | Bacteria | 1521 |
| 524 | Ga0307412_10221242 | 3300031911 | Bacteria | 1451 |
| 525 | Ga0307412_10481380 | 3300031911 | Bacteria | 1029 |
| 526 | Ga0307409_100010756 | 3300031995 | Bacteria | 5715 |
| 527 | Ga0307409_100150664 | 3300031995 | Bacteria | 2018 |
| 528 | Ga0307409_100227934 | 3300031995 | Bacteria | 1687 |
| 529 | Ga0307416_100031382 | 3300032002 | Bacteria | 3999 |
| 530 | Ga0307416_100960420 | 3300032002 | Bacteria | 957 |
| 531 | Ga0307414_10000526 | 3300032004 | Bacteria | 19940 |
| 532 | Ga0307414_10008741 | 3300032004 | Bacteria | 5772 |
| 533 | Ga0307414_10009185 | 3300032004 | Bacteria | 5664 |
| 534 | Ga0307414_10368995 | 3300032004 | Bacteria | 1237 |
| 535 | Ga0307414_10423179 | 3300032004 | Bacteria | 1162 |
| 536 | Ga0307411_10432969 | 3300032005 | Bacteria | 1096 |
| 537 | Ga0307415_100095893 | 3300032126 | Bacteria | 2161 |
| 538 | Ga0307415_100237248 | 3300032126 | Bacteria | 1473 |
| 539 | Ga0307510_10007749 | 3300033180 | Bacteria | 12806 |
| 540 | Ga0395899_0205000 | 3300037312 | Bacteria | 1373 |
| 541 | Ga0395899_0218316 | 3300037312 | Bacteria | 1322 |
| 542 | Ga0395899_0375388 | 3300037312 | Bacteria | 946 |
| 543 | Ga0395900_0431843 | 3300037418 | Bacteria | 1276 |
| 544 | Ga0395900_0734985 | 3300037418 | Bacteria | 918 |
| 545 | Ga0395900_0957267 | 3300037418 | Bacteria | 777 |
| 546 | Ga0395905_0097211 | 3300037471 | Bacteria | 2764 |
| 547 | Ga0395905_0169267 | 3300037471 | Bacteria | 2052 |
| 548 | Ga0395905_0226337 | 3300037471 | Bacteria | 1749 |
| 549 | Ga0395905_0236268 | 3300037471 | Bacteria | 1708 |
| 550 | Ga0395905_0256023 | 3300037471 | Bacteria | 1635 |
| 551 | Ga0395905_0335021 | 3300037471 | Bacteria | 1404 |
| 552 | Ga0436364_1246610 | 3300037853 | Bacteria | 2209 |
| 553 | Ga0436364_1327079 | 3300037853 | Bacteria | 11250 |
| 554 | Ga0395901_0098696 | 3300038443 | Bacteria | 3062 |
| 555 | Ga0395901_0197552 | 3300038443 | Bacteria | 2109 |
| 556 | Ga0395901_0288582 | 3300038443 | Bacteria | 1703 |
| 557 | Ga0395901_0379827 | 3300038443 | Bacteria | 1454 |
| 558 | Ga0395901_0468390 | 3300038443 | Bacteria | 1286 |
| 559 | Ga0237819_01234 | 3300038705 | Bacteria | 7076 |
| 560 | Ga0237816_00146 | 3300039145 | Bacteria | 5561 |
| 561 | Ga0436365_0448892 | 3300039437 | Bacteria | 728 |
| 562 | Ga0436365_0694182 | 3300039437 | Bacteria | 1885 |
| 563 | Ga0436365_1006646 | 3300039437 | Bacteria | 1466 |
| 564 | Ga0436365_1526847 | 3300039437 | Bacteria | 2484 |
| 565 | Ga0495638_0073074 | 3300046460 | Bacteria | 2094 |
| 566 | Ga0495584_0135094 | 3300046491 | Bacteria | 1252 |
| 567 | Ga0495596_0122534 | 3300046500 | Bacteria | 1009 |
| 568 | Ga0495583_0022192 | 3300046506 | Bacteria | 3246 |
| 569 | Ga0495632_0000149 | 3300046519 | Bacteria | 72208 |
| 570 | Ga0495637_0000292 | 3300046520 | Bacteria | 38995 |
| 571 | Ga0495637_0081728 | 3300046520 | Bacteria | 1287 |
| 572 | Ga0495643_0000046 | 3300046522 | Bacteria | 220912 |
| 573 | Ga0495643_0087679 | 3300046522 | Bacteria | 1610 |
| 574 | Ga0495643_0221962 | 3300046522 | Bacteria | 896 |
| 575 | Ga0495648_0004854 | 3300046524 | Bacteria | 11350 |
| 576 | Ga0495648_0069933 | 3300046524 | Bacteria | 2041 |
| 577 | Ga0495663_0000027 | 3300046525 | Bacteria | 89947 |
| 578 | Ga0495663_0009781 | 3300046525 | Bacteria | 2661 |
| 579 | Ga0495642_0092360 | 3300046528 | Bacteria | 1282 |
| 580 | Ga0495621_0013465 | 3300046539 | Bacteria | 2571 |
| 581 | Ga0495621_0018098 | 3300046539 | Bacteria | 2284 |
| 582 | Ga0495621_0045123 | 3300046539 | Bacteria | 1560 |
| 583 | Ga0495597_0023154 | 3300046542 | Bacteria | 2875 |
| 584 | Ga0495633_0000054 | 3300046558 | Bacteria | 151646 |
| 585 | Ga0495633_0001284 | 3300046558 | Bacteria | 19912 |
| 586 | Ga0495633_0185960 | 3300046558 | Bacteria | 956 |
| 587 | Ga0495633_0228021 | 3300046558 | Bacteria | 852 |
| 588 | Ga0495668_0000002 | 3300046616 | Bacteria | 763179 |
| 589 | Ga0495668_0011306 | 3300046616 | Bacteria | 5354 |
| 590 | Ga0495668_0013395 | 3300046616 | Bacteria | 4838 |
| 591 | Ga0495668_0039091 | 3300046616 | Bacteria | 2649 |
| 592 | Ga0495625_0000430 | 3300046660 | Bacteria | 63143 |
| 593 | Ga0495625_0028039 | 3300046660 | Bacteria | 4227 |
| 594 | Ga0495625_0028243 | 3300046660 | Bacteria | 4209 |
| 595 | Ga0495625_0042676 | 3300046660 | Bacteria | 3294 |
| 596 | Ga0495588_0001577 | 3300046674 | Bacteria | 9748 |
| 597 | Ga0495669_0000559 | 3300046684 | Bacteria | 16484 |
| 598 | Ga0495669_0020240 | 3300046684 | Bacteria | 2878 |
| 599 | Ga0495669_0145714 | 3300046684 | Bacteria | 1119 |
| 600 | Ga0495671_0000029 | 3300046692 | Bacteria | 220912 |
| 601 | Ga0495671_0038954 | 3300046692 | Bacteria | 2401 |
| 602 | Ga0495687_000109 | 3300047443 | Bacteria | 125648 |
| 603 | Ga0495677_0002453 | 3300047445 | Bacteria | 7286 |
| 604 | Ga0495677_0002522 | 3300047445 | Bacteria | 7164 |
| 605 | Ga0495673_0018930 | 3300047469 | Bacteria | 3461 |
| 606 | Ga0495681_0001599 | 3300047470 | Bacteria | 16838 |
| 607 | Ga0495681_0001980 | 3300047470 | Bacteria | 14965 |
| 608 | Ga0495686_0000834 | 3300047472 | Bacteria | 39641 |
| 609 | Ga0495686_0009162 | 3300047472 | Bacteria | 7166 |
| 610 | Ga0495686_0134115 | 3300047472 | Bacteria | 1466 |
| 611 | Ga0495615_0003147 | 3300048090 | Bacteria | 2737 |
| 612 | Ga0496101_0534452 | 3300048904 | Bacteria | 927 |
| 613 | Ga0496103_0221582 | 3300048906 | Bacteria | 1217 |
| 614 | Ga0496108_0425600 | 3300048911 | Bacteria | 1160 |
| 615 | Ga0496109_0279750 | 3300048912 | Bacteria | 1573 |
| 616 | Ga0496110_0040358 | 3300048913 | Bacteria | 4068 |
| 617 | Ga0496111_0038087 | 3300048914 | Bacteria | 3444 |
| 618 | Ga0496111_0165946 | 3300048914 | Bacteria | 1640 |
| 619 | Ga0496116_0030132 | 3300048919 | Bacteria | 3903 |
| 620 | Ga0496117_0007511 | 3300048920 | Bacteria | 10630 |
| 621 | Ga0496117_0020388 | 3300048920 | Bacteria | 5405 |
| 622 | Ga0496118_0006582 | 3300048921 | Bacteria | 12689 |
| 623 | Ga0496118_0011622 | 3300048921 | Bacteria | 8563 |
| 624 | Ga0496118_0034473 | 3300048921 | Bacteria | 4129 |
| 625 | Ga0496119_0164085 | 3300048922 | Bacteria | 1178 |
| 626 | Ga0496121_0001042 | 3300048924 | Bacteria | 49414 |
| 627 | Ga0496121_0001342 | 3300048924 | Bacteria | 42142 |
| 628 | Ga0496121_0009334 | 3300048924 | Bacteria | 11310 |
| 629 | Ga0496121_0018140 | 3300048924 | Bacteria | 7119 |
| 630 | Ga0496121_0018792 | 3300048924 | Bacteria | 6944 |
| 631 | Ga0496122_0044380 | 3300048925 | Bacteria | 3470 |
| 632 | Ga0496123_0066831 | 3300048926 | Bacteria | 2275 |
| 633 | Ga0496124_0020554 | 3300048927 | Bacteria | 6096 |
| 634 | Ga0496124_0022868 | 3300048927 | Bacteria | 5723 |
| 635 | Ga0496125_0006572 | 3300048928 | Bacteria | 12529 |
| 636 | Ga0496125_0011958 | 3300048928 | Bacteria | 8644 |
| 637 | Ga0496126_0001140 | 3300048929 | Bacteria | 44190 |
| 638 | Ga0496126_0010396 | 3300048929 | Bacteria | 9760 |
| 639 | Ga0496126_0151434 | 3300048929 | Bacteria | 1988 |
| 640 | Ga0496126_0292369 | 3300048929 | Bacteria | 1347 |
| 641 | Ga0496126_0307426 | 3300048929 | Bacteria | 1306 |
| 642 | Ga0501033_0272032 | 3300049570 | Bacteria | 1197 |
| 643 | Ga0501033_0288556 | 3300049570 | Bacteria | 1157 |
| 644 | Ga0501034_0242461 | 3300049571 | Bacteria | 1748 |
| 645 | Ga0501038_0073474 | 3300049574 | Bacteria | 2896 |
| 646 | Ga0501043_0333457 | 3300049579 | Bacteria | 1155 |
| 647 | Ga0501047_0000976 | 3300049581 | Bacteria | 28788 |
| 648 | Ga0501047_0136029 | 3300049581 | Bacteria | 2338 |
| 649 | Ga0501047_0289415 | 3300049581 | Bacteria | 1482 |
| 650 | Ga0501047_0482037 | 3300049581 | Bacteria | 1068 |
| 651 | Ga0501048_0033006 | 3300049582 | Bacteria | 3741 |
| 652 | Ga0501069_0011202 | 3300049585 | Bacteria | 4757 |
| 653 | Ga0501070_0046748 | 3300049586 | Bacteria | 3599 |
| 654 | Ga0501070_0132796 | 3300049586 | Bacteria | 2056 |
| 655 | Ga0501073_0288481 | 3300049589 | Bacteria | 1132 |
| 656 | Ga0501249_001316 | 3300049679 | Bacteria | 5169 |
| 657 | Ga0501080_0724356 | 3300049742 | Bacteria | 876 |
| 658 | Ga0501035_0085938 | 3300049822 | Bacteria | 2772 |
| 659 | Ga0501044_0182393 | 3300049823 | Bacteria | 2065 |
| 660 | Ga0501044_0939811 | 3300049823 | Bacteria | 738 |
| 661 | Ga0501204_003357 | 3300049850 | Bacteria | 1677 |
| 662 | nmdc:mga00v17_8194_c1 | 3300050491 | Bacteria | 5616 |
| 663 | nmdc:mga06z11_67_c1 | 3300050494 | Bacteria | 42818 |
| 664 | nmdc:mga04h51_55_c1 | 3300050495 | Bacteria | 36672 |
| 665 | nmdc:mga07m45_148388_c1 | 3300050496 | Bacteria | 1359 |
| 666 | nmdc:mga07m45_193634_c1 | 3300050496 | Bacteria | 1182 |
| 667 | nmdc:mga07m45_46981_c1 | 3300050496 | Bacteria | 2426 |
| 668 | nmdc:mga08y16_187160_c1 | 3300050511 | Bacteria | 2148 |
| 669 | nmdc:mga0n895_79968_c1 | 3300050512 | Bacteria | 3256 |
| 670 | nmdc:mga0rr50_488788_c1 | 3300050513 | Bacteria | 1046 |
| 671 | nmdc:mga0a205_63805_c1 | 3300050515 | Bacteria | 3558 |
| 672 | nmdc:mga0sz30_19396_c1 | 3300050516 | Bacteria | 2734 |
| 673 | Ga0500643_001652 | 3300053087 | Bacteria | 12426 |
| 674 | Ga0500643_008089 | 3300053087 | Bacteria | 4165 |
| 675 | Ga0500643_011361 | 3300053087 | Bacteria | 3252 |
| 676 | Ga0500647_0140591 | 3300053091 | Bacteria | 1133 |
| 677 | Ga0500583_0260929 | 3300053092 | Bacteria | 854 |
| 678 | Ga0500651_0012624 | 3300053093 | Bacteria | 5124 |
| 679 | Ga0500641_0029203 | 3300053096 | Bacteria | 2159 |
| 680 | Ga0500560_000120 | 3300053107 | Bacteria | 8276 |
| 681 | Ga0500592_011530 | 3300053116 | Bacteria | 1414 |
| 682 | Ga0500594_0057756 | 3300053118 | Bacteria | 1110 |
| 683 | Ga0500608_000764 | 3300053122 | Bacteria | 11718 |
| 684 | Ga0500618_007082 | 3300053125 | Bacteria | 3230 |
| 685 | Ga0500642_0001618 | 3300053130 | Bacteria | 6494 |
| 686 | Ga0500655_000099 | 3300053133 | Bacteria | 22591 |
| 687 | Ga0500658_0041146 | 3300053134 | Bacteria | 1853 |
| 688 | Ga0500559_0009516 | 3300053136 | Bacteria | 4199 |
| 689 | Ga0500559_0022995 | 3300053136 | Bacteria | 2645 |
| 690 | Ga0500568_0002453 | 3300053139 | Bacteria | 10903 |
| 691 | Ga0500577_0034132 | 3300053142 | Bacteria | 1804 |
| 692 | Ga0500590_003333 | 3300053148 | Bacteria | 7379 |
| 693 | Ga0500604_0100783 | 3300053151 | Bacteria | 952 |
| 694 | Ga0500622_0003263 | 3300053156 | Bacteria | 11009 |
| 695 | Ga0500639_072633 | 3300053163 | Bacteria | 1750 |
| 696 | Ga0500636_0052440 | 3300053177 | Bacteria | 2396 |
| 697 | Ga0500552_038175 | 3300053733 | Bacteria | 771 |
| 698 | Ga0500587_002251 | 3300053739 | Bacteria | 2750 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050495 | nmdc:mga04h51_55_c1 | nmdc:mga04h51_55_c1_36122_36643 | 168 |
| 2 | 3300050496 | nmdc:mga07m45_193634_c1 | nmdc:mga07m45_193634_c1_424_1143 | 175 |
| 3 | 3300005356 | Ga0070674_100142313 | Ga0070674_1001423132 | 176 |
| 4 | 3300005548 | Ga0070665_100162807 | Ga0070665_1001628072 | 176 |
| 5 | 3300028379 | Ga0268266_10116312 | Ga0268266_101163122 | 176 |
| 6 | 3300003320 | rootH2_10206796 | rootH2_102067961 | 182 |
| 7 | 3300032004 | Ga0307414_10368995 | Ga0307414_103689952 | 183 |
| 8 | 3300046522 | Ga0495643_0221962 | Ga0495643_0221962_289_882 | 183 |
| 9 | 3300006058 | Ga0075432_10000674 | Ga0075432_100006747 | 185 |
| 10 | 3300027907 | Ga0207428_10041256 | Ga0207428_100412563 | 185 |
| 11 | 3300048924 | Ga0496121_0001042 | Ga0496121_0001042_10453_11094 | 185 |
| 12 | 3300005617 | Ga0068859_100022219 | Ga0068859_1000222197 | 186 |
| 13 | 3300005841 | Ga0068863_100010763 | Ga0068863_1000107637 | 186 |
| 14 | 3300006931 | Ga0097620_100022219 | Ga0097620_1000222192 | 186 |
| 15 | 3300021388 | Ga0213875_10002279 | Ga0213875_100022793 | 186 |
| 16 | 3300025903 | Ga0207680_10043943 | Ga0207680_100439432 | 186 |
| 17 | 3300025925 | Ga0207650_10031130 | Ga0207650_100311303 | 186 |
| 18 | 3300025931 | Ga0207644_10000316 | Ga0207644_1000031622 | 186 |
| 19 | 3300025972 | Ga0207668_10000011 | Ga0207668_10000011161 | 186 |
| 20 | 3300026088 | Ga0207641_10007111 | Ga0207641_100071114 | 186 |
| 21 | 3300028380 | Ga0268265_10000162 | Ga0268265_1000016212 | 186 |
| 22 | 3300037853 | Ga0436364_1327079 | Ga0436364_1327079_1707_2363 | 186 |
| 23 | 3300039437 | Ga0436365_1526847 | Ga0436365_1526847_1772_2428 | 186 |
| 24 | 3300005331 | Ga0070670_100036985 | Ga0070670_1000369854 | 187 |
| 25 | 3300005335 | Ga0070666_10004770 | Ga0070666_100047702 | 187 |
| 26 | 3300005347 | Ga0070668_100000112 | Ga0070668_1000001124 | 187 |
| 27 | 3300005353 | Ga0070669_100049600 | Ga0070669_1000496002 | 187 |
| 28 | 3300005367 | Ga0070667_100000058 | Ga0070667_10000005873 | 187 |
| 29 | 3300005438 | Ga0070701_10126630 | Ga0070701_101266301 | 187 |
| 30 | 3300005841 | Ga0068863_100000031 | Ga0068863_10000003174 | 187 |
| 31 | 3300005843 | Ga0068860_100005214 | Ga0068860_1000052149 | 187 |
| 32 | 3300005844 | Ga0068862_100091969 | Ga0068862_1000919691 | 187 |
| 33 | 3300009094 | Ga0111539_10479863 | Ga0111539_104798632 | 187 |
| 34 | 3300014326 | Ga0157380_10463201 | Ga0157380_104632012 | 187 |
| 35 | 3300025903 | Ga0207680_10003667 | Ga0207680_100036675 | 187 |
| 36 | 3300025923 | Ga0207681_10031170 | Ga0207681_100311703 | 187 |
| 37 | 3300025925 | Ga0207650_10037426 | Ga0207650_100374264 | 187 |
| 38 | 3300025972 | Ga0207668_10000038 | Ga0207668_1000003881 | 187 |
| 39 | 3300025986 | Ga0207658_10000037 | Ga0207658_1000003773 | 187 |
| 40 | 3300026088 | Ga0207641_10000050 | Ga0207641_1000005057 | 187 |
| 41 | 3300028380 | Ga0268265_10031292 | Ga0268265_100312923 | 187 |
| 42 | 3300028381 | Ga0268264_10331890 | Ga0268264_103318902 | 187 |
| 43 | 3300046539 | Ga0495621_0013465 | Ga0495621_0013465_951_1601 | 188 |
| 44 | 3300053134 | Ga0500658_0041146 | Ga0500658_0041146_798_1448 | 188 |
| 45 | 3300053151 | Ga0500604_0100783 | Ga0500604_0100783_254_907 | 188 |
| 46 | 3300005295 | Ga0065707_10081805 | Ga0065707_1008180530 | 189 |
| 47 | 3300014326 | Ga0157380_10001987 | Ga0157380_100019875 | 189 |
| 48 | 3300038705 | Ga0237819_01234 | Ga0237819_01234_3956_4600 | 189 |
| 49 | 3300039145 | Ga0237816_00146 | Ga0237816_00146_3321_3965 | 189 |
| 50 | 3300049581 | Ga0501047_0136029 | Ga0501047_0136029_570_1214 | 189 |
| 51 | 3300046616 | Ga0495668_0011306 | Ga0495668_0011306_3704_4360 | 190 |
| 52 | 3300053122 | Ga0500608_000764 | Ga0500608_000764_5687_6322 | 190 |
| 53 | 3300031456 | Ga0307513_10064765 | Ga0307513_100647652 | 191 |
| 54 | 3300046660 | Ga0495625_0042676 | Ga0495625_0042676_407_1045 | 191 |
| 55 | 3300047443 | Ga0495687_000109 | Ga0495687_000109_33308_33946 | 191 |
| 56 | 3300005337 | Ga0070682_100023894 | Ga0070682_1000238942 | 192 |
| 57 | 3300005577 | Ga0068857_100089005 | Ga0068857_1000890053 | 192 |
| 58 | 3300027312 | Ga0209371_1016952 | Ga0209371_10169521 | 192 |
| 59 | 3300046660 | Ga0495625_0000430 | Ga0495625_0000430_23541_24191 | 192 |
| 60 | 3300046674 | Ga0495588_0001577 | Ga0495588_0001577_5775_6407 | 192 |
| 61 | 3300047470 | Ga0495681_0001980 | Ga0495681_0001980_197_829 | 192 |
| 62 | 3300048929 | Ga0496126_0001140 | Ga0496126_0001140_2458_3090 | 192 |
| 63 | 3300053107 | Ga0500560_000120 | Ga0500560_000120_1936_2568 | 192 |
| 64 | 3300005336 | Ga0070680_100004587 | Ga0070680_10000458711 | 193 |
| 65 | 3300005458 | Ga0070681_10092271 | Ga0070681_100922712 | 193 |
| 66 | 3300005530 | Ga0070679_100002379 | Ga0070679_1000023791 | 193 |
| 67 | 3300005577 | Ga0068857_100126576 | Ga0068857_1001265763 | 193 |
| 68 | 3300025912 | Ga0207707_10073708 | Ga0207707_100737083 | 193 |
| 69 | 3300025917 | Ga0207660_10003861 | Ga0207660_100038612 | 193 |
| 70 | 3300025921 | Ga0207652_10000008 | Ga0207652_1000000878 | 193 |
| 71 | 3300026116 | Ga0207674_10014537 | Ga0207674_100145374 | 193 |
| 72 | 3300031456 | Ga0307513_10489333 | Ga0307513_104893331 | 193 |
| 73 | 3300049570 | Ga0501033_0272032 | Ga0501033_0272032_251_916 | 193 |
| 74 | 3300049579 | Ga0501043_0333457 | Ga0501043_0333457_308_973 | 193 |
| 75 | 3300049581 | Ga0501047_0289415 | Ga0501047_0289415_159_824 | 193 |
| 76 | 3300049586 | Ga0501070_0132796 | Ga0501070_0132796_1194_1859 | 193 |
| 77 | 3300049589 | Ga0501073_0288481 | Ga0501073_0288481_251_916 | 193 |
| 78 | 3300003781 | Ga0055536_1005438 | Ga0055536_10054383 | 194 |
| 79 | 3300003791 | Ga0055530_10000092 | Ga0055530_1000009226 | 194 |
| 80 | 3300003794 | Ga0055531_10002266 | Ga0055531_100022661 | 194 |
| 81 | 3300003794 | Ga0055531_10003124 | Ga0055531_100031244 | 194 |
| 82 | 3300005457 | Ga0070662_100009237 | Ga0070662_1000092375 | 194 |
| 83 | 3300005563 | Ga0068855_100011310 | Ga0068855_1000113105 | 194 |
| 84 | 3300006358 | Ga0068871_100060613 | Ga0068871_1000606132 | 194 |
| 85 | 3300011119 | Ga0105246_10002637 | Ga0105246_100026378 | 194 |
| 86 | 3300013308 | Ga0157375_10617352 | Ga0157375_106173522 | 194 |
| 87 | 3300025292 | Ga0209676_1000133 | Ga0209676_1000133171 | 194 |
| 88 | 3300025298 | Ga0209050_1000067 | Ga0209050_1000067165 | 194 |
| 89 | 3300025304 | Ga0209257_1000132 | Ga0209257_100013216 | 194 |
| 90 | 3300025942 | Ga0207689_10468943 | Ga0207689_104689432 | 194 |
| 91 | 3300025949 | Ga0207667_10027762 | Ga0207667_100277622 | 194 |
| 92 | 3300032004 | Ga0307414_10423179 | Ga0307414_104231792 | 194 |
| 93 | 3300005329 | Ga0070683_100251284 | Ga0070683_1002512842 | 195 |
| 94 | 3300005535 | Ga0070684_100332375 | Ga0070684_1003323752 | 195 |
| 95 | 3300013104 | Ga0157370_10598150 | Ga0157370_105981501 | 195 |
| 96 | 3300025944 | Ga0207661_10449628 | Ga0207661_104496281 | 195 |
| 97 | 3300028786 | Ga0307517_10299091 | Ga0307517_102990911 | 195 |
| 98 | 3300048911 | Ga0496108_0425600 | Ga0496108_0425600_437_1117 | 195 |
| 99 | 3300031911 | Ga0307412_10221242 | Ga0307412_102212423 | 196 |
| 100 | 3300032005 | Ga0307411_10432969 | Ga0307411_104329692 | 196 |
| 101 | iso_pu_bacteria | 2898795034 | 2898795840 | 196 |
| 102 | 3300005367 | Ga0070667_100000710 | Ga0070667_10000071022 | 197 |
| 103 | 3300005618 | Ga0068864_100000041 | Ga0068864_10000004112 | 197 |
| 104 | 3300005841 | Ga0068863_100000035 | Ga0068863_10000003512 | 197 |
| 105 | 3300005844 | Ga0068862_100000042 | Ga0068862_100000042164 | 197 |
| 106 | 3300009011 | Ga0105251_10000180 | Ga0105251_1000018012 | 197 |
| 107 | 3300009101 | Ga0105247_10005830 | Ga0105247_100058307 | 197 |
| 108 | 3300009177 | Ga0105248_10000045 | Ga0105248_1000004512 | 197 |
| 109 | 3300009553 | Ga0105249_10000055 | Ga0105249_10000055160 | 197 |
| 110 | 3300013306 | Ga0163162_10058628 | Ga0163162_100586284 | 197 |
| 111 | 3300013308 | Ga0157375_10460611 | Ga0157375_104606112 | 197 |
| 112 | 3300014325 | Ga0163163_10169888 | Ga0163163_101698882 | 197 |
| 113 | 3300014968 | Ga0157379_10004695 | Ga0157379_1000469511 | 197 |
| 114 | 3300025291 | Ga0209675_1000366 | Ga0209675_100036621 | 197 |
| 115 | 3300025294 | Ga0209025_1007910 | Ga0209025_10079105 | 197 |
| 116 | 3300025735 | Ga0207713_1000939 | Ga0207713_100093916 | 197 |
| 117 | 3300025900 | Ga0207710_10002951 | Ga0207710_100029514 | 197 |
| 118 | 3300025925 | Ga0207650_10000238 | Ga0207650_1000023812 | 197 |
| 119 | 3300025941 | Ga0207711_10000027 | Ga0207711_10000027226 | 197 |
| 120 | 3300025961 | Ga0207712_10000262 | Ga0207712_1000026211 | 197 |
| 121 | 3300025986 | Ga0207658_10000362 | Ga0207658_1000036235 | 197 |
| 122 | 3300026088 | Ga0207641_10000041 | Ga0207641_1000004111 | 197 |
| 123 | 3300026095 | Ga0207676_10000039 | Ga0207676_10000039166 | 197 |
| 124 | 3300028380 | Ga0268265_10000061 | Ga0268265_10000061141 | 197 |
| 125 | 3300031911 | Ga0307412_10481380 | Ga0307412_104813801 | 197 |
| 126 | 3300048920 | Ga0496117_0007511 | Ga0496117_0007511_4915_5574 | 197 |
| 127 | 3300048921 | Ga0496118_0006582 | Ga0496118_0006582_8831_9490 | 197 |
| 128 | 3300003781 | Ga0055536_1001481 | Ga0055536_10014819 | 198 |
| 129 | 3300005719 | Ga0068861_100000282 | Ga0068861_10000028225 | 198 |
| 130 | 3300025292 | Ga0209676_1000187 | Ga0209676_100018713 | 198 |
| 131 | 3300026118 | Ga0207675_100000041 | Ga0207675_10000004129 | 198 |
| 132 | 3300048929 | Ga0496126_0151434 | Ga0496126_0151434_1055_1708 | 198 |
| 133 | 3300005339 | Ga0070660_100432910 | Ga0070660_1004329101 | 199 |
| 134 | 3300005577 | Ga0068857_100064807 | Ga0068857_1000648073 | 199 |
| 135 | 3300009551 | Ga0105238_10226677 | Ga0105238_102266773 | 199 |
| 136 | 3300026116 | Ga0207674_10031369 | Ga0207674_100313695 | 199 |
| 137 | 3300031911 | Ga0307412_10198588 | Ga0307412_101985882 | 199 |
| 138 | 3300046460 | Ga0495638_0073074 | Ga0495638_0073074_1044_1700 | 199 |
| 139 | 3300046520 | Ga0495637_0081728 | Ga0495637_0081728_313_969 | 199 |
| 140 | 3300046522 | Ga0495643_0087679 | Ga0495643_0087679_334_990 | 199 |
| 141 | 3300046539 | Ga0495621_0045123 | Ga0495621_0045123_591_1247 | 199 |
| 142 | 3300046542 | Ga0495597_0023154 | Ga0495597_0023154_1839_2495 | 199 |
| 143 | 3300046558 | Ga0495633_0228021 | Ga0495633_0228021_57_713 | 199 |
| 144 | 3300046616 | Ga0495668_0039091 | Ga0495668_0039091_1637_2293 | 199 |
| 145 | 3300053091 | Ga0500647_0140591 | Ga0500647_0140591_26_682 | 199 |
| 146 | 3300053092 | Ga0500583_0260929 | Ga0500583_0260929_32_688 | 199 |
| 147 | 3300053093 | Ga0500651_0012624 | Ga0500651_0012624_3422_4078 | 199 |
| 148 | 3300053096 | Ga0500641_0029203 | Ga0500641_0029203_740_1396 | 199 |
| 149 | 3300053125 | Ga0500618_007082 | Ga0500618_007082_1928_2584 | 199 |
| 150 | 3300053130 | Ga0500642_0001618 | Ga0500642_0001618_2414_3070 | 199 |
| 151 | 3300053133 | Ga0500655_000099 | Ga0500655_000099_3453_4109 | 199 |
| 152 | 3300053142 | Ga0500577_0034132 | Ga0500577_0034132_701_1357 | 199 |
| 153 | 3300053148 | Ga0500590_003333 | Ga0500590_003333_1652_2308 | 199 |
| 154 | 3300053163 | Ga0500639_072633 | Ga0500639_072633_626_1282 | 199 |
| 155 | 3300053177 | Ga0500636_0052440 | Ga0500636_0052440_1098_1754 | 199 |
| 156 | 3300053733 | Ga0500552_038175 | Ga0500552_038175_40_696 | 199 |
| 157 | iso_pu_bacteria | 2775507255 | 2778125687 | 199 |
| 158 | 3300005616 | Ga0068852_100120158 | Ga0068852_1001201582 | 200 |
| 159 | 3300025303 | Ga0209051_1014308 | Ga0209051_10143083 | 200 |
| 160 | 3300026078 | Ga0207702_10337007 | Ga0207702_103370072 | 200 |
| 161 | 3300005338 | Ga0068868_100000090 | Ga0068868_10000009045 | 201 |
| 162 | 3300005339 | Ga0070660_100001199 | Ga0070660_1000011992 | 201 |
| 163 | 3300005366 | Ga0070659_100000017 | Ga0070659_10000001721 | 201 |
| 164 | 3300013308 | Ga0157375_10308550 | Ga0157375_103085504 | 201 |
| 165 | 3300025919 | Ga0207657_10003138 | Ga0207657_100031383 | 201 |
| 166 | 3300025932 | Ga0207690_10000035 | Ga0207690_1000003521 | 201 |
| 167 | 3300026023 | Ga0207677_10000317 | Ga0207677_1000031721 | 201 |
| 168 | 3300046500 | Ga0495596_0122534 | Ga0495596_0122534_27_677 | 201 |
| 169 | iso_pu_bacteria | 2512564014 | 2512642275 | 201 |
| 170 | 3300005336 | Ga0070680_100269244 | Ga0070680_1002692442 | 202 |
| 171 | 3300005339 | Ga0070660_100007800 | Ga0070660_1000078006 | 202 |
| 172 | 3300005344 | Ga0070661_100025440 | Ga0070661_1000254403 | 202 |
| 173 | 3300005455 | Ga0070663_100110401 | Ga0070663_1001104013 | 202 |
| 174 | 3300005457 | Ga0070662_100077150 | Ga0070662_1000771501 | 202 |
| 175 | 3300005457 | Ga0070662_100195741 | Ga0070662_1001957412 | 202 |
| 176 | 3300005530 | Ga0070679_100041996 | Ga0070679_1000419964 | 202 |
| 177 | 3300005530 | Ga0070679_100079830 | Ga0070679_1000798303 | 202 |
| 178 | 3300005530 | Ga0070679_100279968 | Ga0070679_1002799682 | 202 |
| 179 | 3300005539 | Ga0068853_100172730 | Ga0068853_1001727302 | 202 |
| 180 | 3300005544 | Ga0070686_100000179 | Ga0070686_10000017919 | 202 |
| 181 | 3300005548 | Ga0070665_100000207 | Ga0070665_100000207103 | 202 |
| 182 | 3300005834 | Ga0068851_10161858 | Ga0068851_101618582 | 202 |
| 183 | 3300006871 | Ga0075434_100220874 | Ga0075434_1002208742 | 202 |
| 184 | 3300009011 | Ga0105251_10012298 | Ga0105251_100122983 | 202 |
| 185 | 3300009098 | Ga0105245_10547729 | Ga0105245_105477292 | 202 |
| 186 | 3300009553 | Ga0105249_10059373 | Ga0105249_100593733 | 202 |
| 187 | 3300017792 | Ga0163161_10022483 | Ga0163161_100224834 | 202 |
| 188 | 3300025321 | Ga0207656_10098746 | Ga0207656_100987462 | 202 |
| 189 | 3300025735 | Ga0207713_1014924 | Ga0207713_10149243 | 202 |
| 190 | 3300025909 | Ga0207705_10001485 | Ga0207705_1000148511 | 202 |
| 191 | 3300025917 | Ga0207660_10100600 | Ga0207660_101006002 | 202 |
| 192 | 3300025919 | Ga0207657_10009149 | Ga0207657_100091494 | 202 |
| 193 | 3300025920 | Ga0207649_10003198 | Ga0207649_1000319810 | 202 |
| 194 | 3300025921 | Ga0207652_10229839 | Ga0207652_102298392 | 202 |
| 195 | 3300025932 | Ga0207690_10120910 | Ga0207690_101209102 | 202 |
| 196 | 3300025933 | Ga0207706_10103828 | Ga0207706_101038282 | 202 |
| 197 | 3300025933 | Ga0207706_10291421 | Ga0207706_102914212 | 202 |
| 198 | 3300025961 | Ga0207712_10109591 | Ga0207712_101095912 | 202 |
| 199 | 3300026041 | Ga0207639_10262778 | Ga0207639_102627782 | 202 |
| 200 | 3300026067 | Ga0207678_10050109 | Ga0207678_100501094 | 202 |
| 201 | 3300027424 | Ga0209984_1017895 | Ga0209984_10178952 | 202 |
| 202 | 3300027876 | Ga0209974_10017606 | Ga0209974_100176062 | 202 |
| 203 | 3300028379 | Ga0268266_10000171 | Ga0268266_10000171119 | 202 |
| 204 | 3300048912 | Ga0496109_0279750 | Ga0496109_0279750_275_901 | 202 |
| 205 | 3300048913 | Ga0496110_0040358 | Ga0496110_0040358_2387_3013 | 202 |
| 206 | 3300048914 | Ga0496111_0038087 | Ga0496111_0038087_1650_2276 | 202 |
| 207 | 3300048924 | Ga0496121_0018792 | Ga0496121_0018792_4663_5289 | 202 |
| 208 | 3300048925 | Ga0496122_0044380 | Ga0496122_0044380_1751_2377 | 202 |
| 209 | 3300048926 | Ga0496123_0066831 | Ga0496123_0066831_1367_1993 | 202 |
| 210 | 3300048927 | Ga0496124_0020554 | Ga0496124_0020554_3352_3978 | 202 |
| 211 | 3300048928 | Ga0496125_0006572 | Ga0496125_0006572_8679_9305 | 202 |
| 212 | 3300048929 | Ga0496126_0307426 | Ga0496126_0307426_631_1257 | 202 |
| 213 | 3300049574 | Ga0501038_0073474 | Ga0501038_0073474_1229_1858 | 202 |
| 214 | 3300050512 | nmdc:mga0n895_79968_c1 | nmdc:mga0n895_79968_c1_106_747 | 202 |
| 215 | iso_pu_bacteria | 2643221563 | 2643833040 | 202 |
| 216 | iso_pu_bacteria | 2643221608 | 2644053165 | 202 |
| 217 | 3300005328 | Ga0070676_10043173 | Ga0070676_100431731 | 203 |
| 218 | 3300005366 | Ga0070659_100107204 | Ga0070659_1001072042 | 203 |
| 219 | 3300005457 | Ga0070662_100462248 | Ga0070662_1004622482 | 203 |
| 220 | 3300005546 | Ga0070696_100006865 | Ga0070696_10000686510 | 203 |
| 221 | 3300005578 | Ga0068854_100086016 | Ga0068854_1000860163 | 203 |
| 222 | 3300013100 | Ga0157373_10051195 | Ga0157373_100511954 | 203 |
| 223 | 3300025907 | Ga0207645_10025449 | Ga0207645_100254493 | 203 |
| 224 | 3300025933 | Ga0207706_10169249 | Ga0207706_101692492 | 203 |
| 225 | 3300025972 | Ga0207668_10573712 | Ga0207668_105737122 | 203 |
| 226 | 3300025981 | Ga0207640_10073602 | Ga0207640_100736022 | 203 |
| 227 | 3300026089 | Ga0207648_10247331 | Ga0207648_102473312 | 203 |
| 228 | 3300031852 | Ga0307410_10009509 | Ga0307410_100095093 | 203 |
| 229 | 3300031901 | Ga0307406_10029153 | Ga0307406_100291532 | 203 |
| 230 | 3300031903 | Ga0307407_10731479 | Ga0307407_107314791 | 203 |
| 231 | 3300031911 | Ga0307412_10138085 | Ga0307412_101380852 | 203 |
| 232 | 3300031995 | Ga0307409_100010756 | Ga0307409_1000107565 | 203 |
| 233 | 3300046684 | Ga0495669_0020240 | Ga0495669_0020240_1414_2064 | 203 |
| 234 | 3300053739 | Ga0500587_002251 | Ga0500587_002251_40_684 | 203 |
| 235 | 3300001915 | JGI24741J21665_1000810 | JGI24741J21665_10008105 | 204 |
| 236 | 3300001979 | JGI24740J21852_10059086 | JGI24740J21852_100590862 | 204 |
| 237 | 3300002067 | JGI24735J21928_10000764 | JGI24735J21928_100007648 | 204 |
| 238 | 3300005327 | Ga0070658_10037754 | Ga0070658_100377543 | 204 |
| 239 | 3300005329 | Ga0070683_100605363 | Ga0070683_1006053631 | 204 |
| 240 | 3300005339 | Ga0070660_100134541 | Ga0070660_1001345412 | 204 |
| 241 | 3300005366 | Ga0070659_100050509 | Ga0070659_1000505092 | 204 |
| 242 | 3300005455 | Ga0070663_100006853 | Ga0070663_1000068535 | 204 |
| 243 | 3300005564 | Ga0070664_100117579 | Ga0070664_1001175792 | 204 |
| 244 | 3300005614 | Ga0068856_100005769 | Ga0068856_1000057695 | 204 |
| 245 | 3300005719 | Ga0068861_100211253 | Ga0068861_1002112532 | 204 |
| 246 | 3300006042 | Ga0075368_10001383 | Ga0075368_100013833 | 204 |
| 247 | 3300006178 | Ga0075367_10002205 | Ga0075367_100022057 | 204 |
| 248 | 3300006353 | Ga0075370_10026878 | Ga0075370_100268782 | 204 |
| 249 | 3300009093 | Ga0105240_10738808 | Ga0105240_107388082 | 204 |
| 250 | 3300009174 | Ga0105241_10002299 | Ga0105241_100022996 | 204 |
| 251 | 3300013100 | Ga0157373_10070595 | Ga0157373_100705954 | 204 |
| 252 | 3300013104 | Ga0157370_10070441 | Ga0157370_100704412 | 204 |
| 253 | 3300025321 | Ga0207656_10057054 | Ga0207656_100570542 | 204 |
| 254 | 3300025904 | Ga0207647_10022931 | Ga0207647_100229313 | 204 |
| 255 | 3300025913 | Ga0207695_10023626 | Ga0207695_100236261 | 204 |
| 256 | 3300025914 | Ga0207671_10186288 | Ga0207671_101862882 | 204 |
| 257 | 3300025919 | Ga0207657_10002188 | Ga0207657_100021886 | 204 |
| 258 | 3300025924 | Ga0207694_10015661 | Ga0207694_100156614 | 204 |
| 259 | 3300025933 | Ga0207706_10086680 | Ga0207706_100866804 | 204 |
| 260 | 3300025940 | Ga0207691_10485005 | Ga0207691_104850052 | 204 |
| 261 | 3300025949 | Ga0207667_10117138 | Ga0207667_101171382 | 204 |
| 262 | 3300025981 | Ga0207640_10161070 | Ga0207640_101610702 | 204 |
| 263 | 3300026041 | Ga0207639_10001542 | Ga0207639_100015429 | 204 |
| 264 | 3300026067 | Ga0207678_10000079 | Ga0207678_1000007967 | 204 |
| 265 | 3300026078 | Ga0207702_10001332 | Ga0207702_100013328 | 204 |
| 266 | 3300026116 | Ga0207674_10042124 | Ga0207674_100421243 | 204 |
| 267 | 3300026142 | Ga0207698_10020773 | Ga0207698_100207732 | 204 |
| 268 | 3300027866 | Ga0209813_10000033 | Ga0209813_1000003313 | 204 |
| 269 | 3300031548 | Ga0307408_100016941 | Ga0307408_1000169413 | 204 |
| 270 | 3300031852 | Ga0307410_10081926 | Ga0307410_100819262 | 204 |
| 271 | 3300031852 | Ga0307410_10165176 | Ga0307410_101651761 | 204 |
| 272 | 3300031901 | Ga0307406_10200758 | Ga0307406_102007581 | 204 |
| 273 | 3300031911 | Ga0307412_10149265 | Ga0307412_101492652 | 204 |
| 274 | 3300031995 | Ga0307409_100150664 | Ga0307409_1001506642 | 204 |
| 275 | 3300032002 | Ga0307416_100031382 | Ga0307416_1000313823 | 204 |
| 276 | 3300037418 | Ga0395900_0431843 | Ga0395900_0431843_23_637 | 204 |
| 277 | 3300046491 | Ga0495584_0135094 | Ga0495584_0135094_261_893 | 204 |
| 278 | 3300046519 | Ga0495632_0000149 | Ga0495632_0000149_17579_18211 | 204 |
| 279 | 3300046520 | Ga0495637_0000292 | Ga0495637_0000292_22965_23597 | 204 |
| 280 | 3300046522 | Ga0495643_0000046 | Ga0495643_0000046_22965_23597 | 204 |
| 281 | 3300046524 | Ga0495648_0004854 | Ga0495648_0004854_9546_10178 | 204 |
| 282 | 3300046525 | Ga0495663_0000027 | Ga0495663_0000027_17579_18211 | 204 |
| 283 | 3300046558 | Ga0495633_0001284 | Ga0495633_0001284_17579_18211 | 204 |
| 284 | 3300046558 | Ga0495633_0185960 | Ga0495633_0185960_285_920 | 204 |
| 285 | 3300046692 | Ga0495671_0000029 | Ga0495671_0000029_197316_197948 | 204 |
| 286 | 3300046692 | Ga0495671_0038954 | Ga0495671_0038954_1571_2206 | 204 |
| 287 | 3300047470 | Ga0495681_0001599 | Ga0495681_0001599_9824_10456 | 204 |
| 288 | 3300047472 | Ga0495686_0134115 | Ga0495686_0134115_244_876 | 204 |
| 289 | 3300050494 | nmdc:mga06z11_67_c1 | nmdc:mga06z11_67_c1_6045_6680 | 204 |
| 290 | 3300050496 | nmdc:mga07m45_46981_c1 | nmdc:mga07m45_46981_c1_1171_1806 | 204 |
| 291 | 3300053087 | Ga0500643_008089 | Ga0500643_008089_880_1536 | 204 |
| 292 | 3300053116 | Ga0500592_011530 | Ga0500592_011530_277_927 | 204 |
| 293 | 3300053118 | Ga0500594_0057756 | Ga0500594_0057756_12_647 | 204 |
| 294 | iso_pu_bacteria | 2643221541 | 2643728431 | 204 |
| 295 | iso_pu_bacteria | 2643221606 | 2644042393 | 204 |
| 296 | iso_pu_bacteria | 2643221671 | 2644392031 | 204 |
| 297 | iso_pu_bacteria | 2852653556 | 2852654209 | 204 |
| 298 | 3300001976 | JGI24752J21851_1006200 | JGI24752J21851_10062002 | 205 |
| 299 | 3300003781 | Ga0055536_1000943 | Ga0055536_100094320 | 205 |
| 300 | 3300003794 | Ga0055531_10006170 | Ga0055531_100061706 | 205 |
| 301 | 3300005327 | Ga0070658_10401929 | Ga0070658_104019292 | 205 |
| 302 | 3300005331 | Ga0070670_100000586 | Ga0070670_10000058639 | 205 |
| 303 | 3300005335 | Ga0070666_10000908 | Ga0070666_1000090813 | 205 |
| 304 | 3300005347 | Ga0070668_100093379 | Ga0070668_1000933792 | 205 |
| 305 | 3300005353 | Ga0070669_100000113 | Ga0070669_10000011385 | 205 |
| 306 | 3300005355 | Ga0070671_100000038 | Ga0070671_1000000387 | 205 |
| 307 | 3300005440 | Ga0070705_100039054 | Ga0070705_1000390542 | 205 |
| 308 | 3300005548 | Ga0070665_100094918 | Ga0070665_1000949182 | 205 |
| 309 | 3300005617 | Ga0068859_100000085 | Ga0068859_10000008522 | 205 |
| 310 | 3300005841 | Ga0068863_100098058 | Ga0068863_1000980582 | 205 |
| 311 | 3300005843 | Ga0068860_100031421 | Ga0068860_1000314214 | 205 |
| 312 | 3300005844 | Ga0068862_100001040 | Ga0068862_10000104023 | 205 |
| 313 | 3300006931 | Ga0097620_100000085 | Ga0097620_10000008522 | 205 |
| 314 | 3300009101 | Ga0105247_10010754 | Ga0105247_100107542 | 205 |
| 315 | 3300009177 | Ga0105248_10080237 | Ga0105248_100802373 | 205 |
| 316 | 3300009553 | Ga0105249_10022022 | Ga0105249_100220223 | 205 |
| 317 | 3300014968 | Ga0157379_10014954 | Ga0157379_100149542 | 205 |
| 318 | 3300017792 | Ga0163161_10292968 | Ga0163161_102929682 | 205 |
| 319 | 3300025292 | Ga0209676_1000081 | Ga0209676_1000081241 | 205 |
| 320 | 3300025298 | Ga0209050_1011468 | Ga0209050_10114683 | 205 |
| 321 | 3300025304 | Ga0209257_1000359 | Ga0209257_100035948 | 205 |
| 322 | 3300025315 | Ga0207697_10002053 | Ga0207697_100020537 | 205 |
| 323 | 3300025900 | Ga0207710_10004160 | Ga0207710_100041602 | 205 |
| 324 | 3300025903 | Ga0207680_10000082 | Ga0207680_100000827 | 205 |
| 325 | 3300025923 | Ga0207681_10000042 | Ga0207681_1000004282 | 205 |
| 326 | 3300025925 | Ga0207650_10020631 | Ga0207650_100206313 | 205 |
| 327 | 3300025931 | Ga0207644_10000071 | Ga0207644_100000717 | 205 |
| 328 | 3300025961 | Ga0207712_10009082 | Ga0207712_100090823 | 205 |
| 329 | 3300025972 | Ga0207668_10000194 | Ga0207668_1000019429 | 205 |
| 330 | 3300025986 | Ga0207658_10008451 | Ga0207658_100084516 | 205 |
| 331 | 3300026088 | Ga0207641_10033746 | Ga0207641_100337464 | 205 |
| 332 | 3300026095 | Ga0207676_10001160 | Ga0207676_100011602 | 205 |
| 333 | 3300026118 | Ga0207675_100001141 | Ga0207675_10000114122 | 205 |
| 334 | 3300028380 | Ga0268265_10000043 | Ga0268265_10000043123 | 205 |
| 335 | 3300028381 | Ga0268264_10000154 | Ga0268264_1000015481 | 205 |
| 336 | 3300037853 | Ga0436364_1246610 | Ga0436364_1246610_438_1088 | 205 |
| 337 | 3300048906 | Ga0496103_0221582 | Ga0496103_0221582_205_849 | 205 |
| 338 | 3300053087 | Ga0500643_011361 | Ga0500643_011361_1103_1741 | 205 |
| 339 | 3300053139 | Ga0500568_0002453 | Ga0500568_0002453_9696_10328 | 205 |
| 340 | iso_pu_bacteria | 2830075706 | 2830077251 | 205 |
| 341 | 3300003316 | rootH1_10025996 | rootH1_100259962 | 206 |
| 342 | 3300003322 | rootL2_10112214 | rootL2_101122144 | 206 |
| 343 | 3300005344 | Ga0070661_100096755 | Ga0070661_1000967551 | 206 |
| 344 | 3300005353 | Ga0070669_100022511 | Ga0070669_1000225114 | 206 |
| 345 | 3300005354 | Ga0070675_100210104 | Ga0070675_1002101042 | 206 |
| 346 | 3300005455 | Ga0070663_100128922 | Ga0070663_1001289223 | 206 |
| 347 | 3300005564 | Ga0070664_100066308 | Ga0070664_1000663084 | 206 |
| 348 | 3300005577 | Ga0068857_100007442 | Ga0068857_1000074424 | 206 |
| 349 | 3300005617 | Ga0068859_100018076 | Ga0068859_1000180765 | 206 |
| 350 | 3300005617 | Ga0068859_100037442 | Ga0068859_1000374424 | 206 |
| 351 | 3300005618 | Ga0068864_100000352 | Ga0068864_10000035238 | 206 |
| 352 | 3300005841 | Ga0068863_100016737 | Ga0068863_1000167373 | 206 |
| 353 | 3300005842 | Ga0068858_100000444 | Ga0068858_10000044410 | 206 |
| 354 | 3300005842 | Ga0068858_100054018 | Ga0068858_1000540183 | 206 |
| 355 | 3300006931 | Ga0097620_100018077 | Ga0097620_1000180773 | 206 |
| 356 | 3300006931 | Ga0097620_100037440 | Ga0097620_1000374404 | 206 |
| 357 | 3300009177 | Ga0105248_10000296 | Ga0105248_1000029659 | 206 |
| 358 | 3300009177 | Ga0105248_10010024 | Ga0105248_100100243 | 206 |
| 359 | 3300009553 | Ga0105249_10196155 | Ga0105249_101961552 | 206 |
| 360 | 3300009553 | Ga0105249_10749480 | Ga0105249_107494801 | 206 |
| 361 | 3300009553 | Ga0105249_11160037 | Ga0105249_111600371 | 206 |
| 362 | 3300011119 | Ga0105246_10055468 | Ga0105246_100554682 | 206 |
| 363 | 3300013306 | Ga0163162_10003520 | Ga0163162_100035207 | 206 |
| 364 | 3300025315 | Ga0207697_10006670 | Ga0207697_100066702 | 206 |
| 365 | 3300025918 | Ga0207662_10226556 | Ga0207662_102265562 | 206 |
| 366 | 3300025923 | Ga0207681_10020048 | Ga0207681_100200483 | 206 |
| 367 | 3300025935 | Ga0207709_10410467 | Ga0207709_104104672 | 206 |
| 368 | 3300025936 | Ga0207670_10086186 | Ga0207670_100861862 | 206 |
| 369 | 3300025941 | Ga0207711_10000251 | Ga0207711_1000025156 | 206 |
| 370 | 3300025941 | Ga0207711_10005768 | Ga0207711_1000576814 | 206 |
| 371 | 3300025945 | Ga0207679_10429798 | Ga0207679_104297982 | 206 |
| 372 | 3300025960 | Ga0207651_10118780 | Ga0207651_101187803 | 206 |
| 373 | 3300026035 | Ga0207703_10057481 | Ga0207703_100574814 | 206 |
| 374 | 3300026067 | Ga0207678_10010495 | Ga0207678_1001049512 | 206 |
| 375 | 3300026088 | Ga0207641_10245420 | Ga0207641_102454202 | 206 |
| 376 | 3300026095 | Ga0207676_10001198 | Ga0207676_1000119810 | 206 |
| 377 | 3300026095 | Ga0207676_10012289 | Ga0207676_100122895 | 206 |
| 378 | 3300026116 | Ga0207674_10019266 | Ga0207674_100192665 | 206 |
| 379 | 3300026118 | Ga0207675_100104868 | Ga0207675_1001048684 | 206 |
| 380 | 3300028380 | Ga0268265_10051589 | Ga0268265_100515894 | 206 |
| 381 | 3300028381 | Ga0268264_10203364 | Ga0268264_102033642 | 206 |
| 382 | 3300048929 | Ga0496126_0292369 | Ga0496126_0292369_667_1314 | 206 |
| 383 | iso_pu_bacteria | 2643221605 | 2644039446 | 206 |
| 384 | 3300005543 | Ga0070672_100020073 | Ga0070672_1000200735 | 207 |
| 385 | 3300005563 | Ga0068855_100023513 | Ga0068855_1000235132 | 207 |
| 386 | 3300005616 | Ga0068852_100045264 | Ga0068852_1000452644 | 207 |
| 387 | 3300005617 | Ga0068859_100866421 | Ga0068859_1008664212 | 207 |
| 388 | 3300005843 | Ga0068860_100004766 | Ga0068860_1000047668 | 207 |
| 389 | 3300006931 | Ga0097620_100866482 | Ga0097620_1008664821 | 207 |
| 390 | 3300007076 | Ga0075435_100141620 | Ga0075435_1001416203 | 207 |
| 391 | 3300013306 | Ga0163162_10099028 | Ga0163162_100990282 | 207 |
| 392 | 3300013307 | Ga0157372_10975682 | Ga0157372_109756821 | 207 |
| 393 | 3300025904 | Ga0207647_10000297 | Ga0207647_1000029736 | 207 |
| 394 | 3300025919 | Ga0207657_10014090 | Ga0207657_100140905 | 207 |
| 395 | 3300025932 | Ga0207690_10006633 | Ga0207690_100066331 | 207 |
| 396 | 3300025933 | Ga0207706_10001755 | Ga0207706_1000175524 | 207 |
| 397 | 3300025949 | Ga0207667_10019183 | Ga0207667_100191835 | 207 |
| 398 | 3300025961 | Ga0207712_10000373 | Ga0207712_1000037343 | 207 |
| 399 | 3300028381 | Ga0268264_10001121 | Ga0268264_100011217 | 207 |
| 400 | 3300032126 | Ga0307415_100237248 | Ga0307415_1002372482 | 207 |
| 401 | 3300038443 | Ga0395901_0288582 | Ga0395901_0288582_1005_1643 | 207 |
| 402 | 3300038443 | Ga0395901_0379827 | Ga0395901_0379827_489_1127 | 207 |
| 403 | 3300039437 | Ga0436365_1006646 | Ga0436365_1006646_88_729 | 207 |
| 404 | 3300046506 | Ga0495583_0022192 | Ga0495583_0022192_261_899 | 207 |
| 405 | 3300046524 | Ga0495648_0069933 | Ga0495648_0069933_270_908 | 207 |
| 406 | 3300046539 | Ga0495621_0018098 | Ga0495621_0018098_1166_1828 | 207 |
| 407 | 3300046558 | Ga0495633_0000054 | Ga0495633_0000054_44276_44932 | 207 |
| 408 | 3300046616 | Ga0495668_0013395 | Ga0495668_0013395_2606_3244 | 207 |
| 409 | 3300046660 | Ga0495625_0028243 | Ga0495625_0028243_1040_1678 | 207 |
| 410 | 3300047445 | Ga0495677_0002522 | Ga0495677_0002522_4785_5423 | 207 |
| 411 | 3300047472 | Ga0495686_0009162 | Ga0495686_0009162_3349_4002 | 207 |
| 412 | 3300048090 | Ga0495615_0003147 | Ga0495615_0003147_380_1042 | 207 |
| 413 | 3300048919 | Ga0496116_0030132 | Ga0496116_0030132_1654_2298 | 207 |
| 414 | 3300048921 | Ga0496118_0034473 | Ga0496118_0034473_2181_2825 | 207 |
| 415 | 3300048922 | Ga0496119_0164085 | Ga0496119_0164085_411_1055 | 207 |
| 416 | 3300048927 | Ga0496124_0022868 | Ga0496124_0022868_4586_5230 | 207 |
| 417 | 3300049571 | Ga0501034_0242461 | Ga0501034_0242461_962_1603 | 207 |
| 418 | 3300049581 | Ga0501047_0482037 | Ga0501047_0482037_200_841 | 207 |
| 419 | 3300049585 | Ga0501069_0011202 | Ga0501069_0011202_149_790 | 207 |
| 420 | 3300049586 | Ga0501070_0046748 | Ga0501070_0046748_615_1256 | 207 |
| 421 | 3300053136 | Ga0500559_0022995 | Ga0500559_0022995_28_666 | 207 |
| 422 | iso_pu_bacteria | 2582581305 | 2585261341 | 207 |
| 423 | iso_pu_bacteria | 2643221560 | 2643822230 | 207 |
| 424 | iso_pu_bacteria | 2643221588 | 2643951440 | 207 |
| 425 | 3300003322 | rootL2_10096988 | rootL2_100969882 | 208 |
| 426 | 3300005719 | Ga0068861_100836461 | Ga0068861_1008364611 | 208 |
| 427 | 3300026118 | Ga0207675_100022883 | Ga0207675_1000228837 | 208 |
| 428 | 3300032004 | Ga0307414_10000526 | Ga0307414_1000052611 | 208 |
| 429 | 3300033180 | Ga0307510_10007749 | Ga0307510_100077494 | 208 |
| 430 | 3300049581 | Ga0501047_0000976 | Ga0501047_0000976_9913_10557 | 208 |
| 431 | 3300049582 | Ga0501048_0033006 | Ga0501048_0033006_110_754 | 208 |
| 432 | 3300049822 | Ga0501035_0085938 | Ga0501035_0085938_59_703 | 208 |
| 433 | 3300049823 | Ga0501044_0939811 | Ga0501044_0939811_78_722 | 208 |
| 434 | 3300053087 | Ga0500643_001652 | Ga0500643_001652_2474_3115 | 208 |
| 435 | 3300005331 | Ga0070670_100001053 | Ga0070670_10000105320 | 209 |
| 436 | 3300005335 | Ga0070666_10077145 | Ga0070666_100771451 | 209 |
| 437 | 3300005347 | Ga0070668_100000056 | Ga0070668_10000005611 | 209 |
| 438 | 3300005353 | Ga0070669_100583389 | Ga0070669_1005833891 | 209 |
| 439 | 3300005355 | Ga0070671_100000601 | Ga0070671_10000060123 | 209 |
| 440 | 3300005367 | Ga0070667_100000215 | Ga0070667_1000002157 | 209 |
| 441 | 3300005367 | Ga0070667_100005459 | Ga0070667_1000054599 | 209 |
| 442 | 3300005618 | Ga0068864_100002862 | Ga0068864_1000028629 | 209 |
| 443 | 3300005841 | Ga0068863_100007196 | Ga0068863_1000071967 | 209 |
| 444 | 3300005842 | Ga0068858_100082600 | Ga0068858_1000826004 | 209 |
| 445 | 3300005843 | Ga0068860_100000049 | Ga0068860_10000004958 | 209 |
| 446 | 3300005843 | Ga0068860_100007900 | Ga0068860_1000079009 | 209 |
| 447 | 3300005844 | Ga0068862_100003039 | Ga0068862_10000303918 | 209 |
| 448 | 3300006051 | Ga0075364_10025101 | Ga0075364_100251012 | 209 |
| 449 | 3300006353 | Ga0075370_10058548 | Ga0075370_100585482 | 209 |
| 450 | 3300009177 | Ga0105248_10230124 | Ga0105248_102301244 | 209 |
| 451 | 3300014326 | Ga0157380_10415209 | Ga0157380_104152092 | 209 |
| 452 | 3300025903 | Ga0207680_10011910 | Ga0207680_100119104 | 209 |
| 453 | 3300025923 | Ga0207681_10583643 | Ga0207681_105836432 | 209 |
| 454 | 3300025925 | Ga0207650_10273210 | Ga0207650_102732103 | 209 |
| 455 | 3300025986 | Ga0207658_10000014 | Ga0207658_1000001466 | 209 |
| 456 | 3300025986 | Ga0207658_10001094 | Ga0207658_1000109424 | 209 |
| 457 | 3300026035 | Ga0207703_10006783 | Ga0207703_1000678311 | 209 |
| 458 | 3300026088 | Ga0207641_10000545 | Ga0207641_100005458 | 209 |
| 459 | 3300026088 | Ga0207641_10100056 | Ga0207641_101000561 | 209 |
| 460 | 3300026095 | Ga0207676_10001939 | Ga0207676_1000193910 | 209 |
| 461 | 3300028381 | Ga0268264_10000121 | Ga0268264_1000012146 | 209 |
| 462 | 3300028381 | Ga0268264_10005031 | Ga0268264_1000503110 | 209 |
| 463 | 3300039437 | Ga0436365_0448892 | Ga0436365_0448892_37_693 | 209 |
| 464 | 3300046660 | Ga0495625_0028039 | Ga0495625_0028039_3386_4054 | 209 |
| 465 | 3300048924 | Ga0496121_0018140 | Ga0496121_0018140_4553_5200 | 209 |
| 466 | 3300049679 | Ga0501249_001316 | Ga0501249_001316_2236_2892 | 209 |
| 467 | 3300049742 | Ga0501080_0724356 | Ga0501080_0724356_131_778 | 209 |
| 468 | 3300049850 | Ga0501204_003357 | Ga0501204_003357_476_1132 | 209 |
| 469 | 3300050491 | nmdc:mga00v17_8194_c1 | nmdc:mga00v17_8194_c1_1739_2413 | 209 |
| 470 | 3300050496 | nmdc:mga07m45_148388_c1 | nmdc:mga07m45_148388_c1_177_851 | 209 |
| 471 | 3300050516 | nmdc:mga0sz30_19396_c1 | nmdc:mga0sz30_19396_c1_1234_1908 | 209 |
| 472 | 3300053136 | Ga0500559_0009516 | Ga0500559_0009516_547_1224 | 209 |
| 473 | 3300053156 | Ga0500622_0003263 | Ga0500622_0003263_4878_5546 | 209 |
| 474 | 3300003187 | JGI25151J46595_10019050 | JGI25151J46595_100190503 | 210 |
| 475 | 3300005355 | Ga0070671_100797283 | Ga0070671_1007972831 | 210 |
| 476 | 3300005455 | Ga0070663_100826306 | Ga0070663_1008263061 | 210 |
| 477 | 3300005539 | Ga0068853_100208611 | Ga0068853_1002086112 | 210 |
| 478 | 3300005563 | Ga0068855_100198967 | Ga0068855_1001989673 | 210 |
| 479 | 3300009093 | Ga0105240_10072933 | Ga0105240_100729332 | 210 |
| 480 | 3300009093 | Ga0105240_10074677 | Ga0105240_100746774 | 210 |
| 481 | 3300009177 | Ga0105248_10027704 | Ga0105248_100277049 | 210 |
| 482 | 3300009545 | Ga0105237_10004065 | Ga0105237_1000406511 | 210 |
| 483 | 3300009545 | Ga0105237_10488760 | Ga0105237_104887602 | 210 |
| 484 | 3300010375 | Ga0105239_10002689 | Ga0105239_1000268911 | 210 |
| 485 | 3300013104 | Ga0157370_10555801 | Ga0157370_105558012 | 210 |
| 486 | 3300025294 | Ga0209025_1000669 | Ga0209025_100066930 | 210 |
| 487 | 3300025298 | Ga0209050_1002482 | Ga0209050_10024829 | 210 |
| 488 | 3300025304 | Ga0209257_1043464 | Ga0209257_10434642 | 210 |
| 489 | 3300025913 | Ga0207695_10015828 | Ga0207695_1001582810 | 210 |
| 490 | 3300025913 | Ga0207695_10060858 | Ga0207695_100608585 | 210 |
| 491 | 3300025914 | Ga0207671_10001440 | Ga0207671_1000144023 | 210 |
| 492 | 3300025931 | Ga0207644_10382401 | Ga0207644_103824011 | 210 |
| 493 | 3300025935 | Ga0207709_10511494 | Ga0207709_105114942 | 210 |
| 494 | 3300026067 | Ga0207678_10769227 | Ga0207678_107692272 | 210 |
| 495 | 3300026116 | Ga0207674_10329837 | Ga0207674_103298372 | 210 |
| 496 | 3300032004 | Ga0307414_10008741 | Ga0307414_100087413 | 210 |
| 497 | 3300032004 | Ga0307414_10009185 | Ga0307414_100091855 | 210 |
| 498 | 3300037471 | Ga0395905_0169267 | Ga0395905_0169267_387_1037 | 210 |
| 499 | 3300048920 | Ga0496117_0020388 | Ga0496117_0020388_631_1293 | 210 |
| 500 | 3300048921 | Ga0496118_0011622 | Ga0496118_0011622_6893_7555 | 210 |
| 501 | 3300048924 | Ga0496121_0001342 | Ga0496121_0001342_10291_10947 | 210 |
| 502 | 3300048924 | Ga0496121_0009334 | Ga0496121_0009334_2525_3181 | 210 |
| 503 | 3300048928 | Ga0496125_0011958 | Ga0496125_0011958_6896_7552 | 210 |
| 504 | 3300048929 | Ga0496126_0010396 | Ga0496126_0010396_4051_4707 | 210 |
| 505 | 3300005289 | Ga0065704_10005861 | Ga0065704_100058613 | 211 |
| 506 | 3300005327 | Ga0070658_10000003 | Ga0070658_1000000320 | 211 |
| 507 | 3300005327 | Ga0070658_10204152 | Ga0070658_102041522 | 211 |
| 508 | 3300005339 | Ga0070660_100002551 | Ga0070660_10000255111 | 211 |
| 509 | 3300005339 | Ga0070660_100011384 | Ga0070660_1000113845 | 211 |
| 510 | 3300005339 | Ga0070660_100029820 | Ga0070660_1000298204 | 211 |
| 511 | 3300005344 | Ga0070661_100000113 | Ga0070661_10000011329 | 211 |
| 512 | 3300005344 | Ga0070661_100474888 | Ga0070661_1004748881 | 211 |
| 513 | 3300005366 | Ga0070659_100029300 | Ga0070659_1000293004 | 211 |
| 514 | 3300009177 | Ga0105248_10004622 | Ga0105248_1000462213 | 211 |
| 515 | 3300013307 | Ga0157372_10361414 | Ga0157372_103614142 | 211 |
| 516 | 3300025909 | Ga0207705_10000005 | Ga0207705_1000000523 | 211 |
| 517 | 3300025909 | Ga0207705_10001221 | Ga0207705_1000122115 | 211 |
| 518 | 3300025919 | Ga0207657_10000530 | Ga0207657_1000053019 | 211 |
| 519 | 3300025919 | Ga0207657_10004555 | Ga0207657_100045559 | 211 |
| 520 | 3300025919 | Ga0207657_10008611 | Ga0207657_100086112 | 211 |
| 521 | 3300025920 | Ga0207649_10000089 | Ga0207649_1000008959 | 211 |
| 522 | 3300025941 | Ga0207711_10003263 | Ga0207711_1000326311 | 211 |
| 523 | 3300025972 | Ga0207668_10013873 | Ga0207668_100138733 | 211 |
| 524 | 3300046616 | Ga0495668_0000002 | Ga0495668_0000002_613418_614071 | 211 |
| 525 | 3300048904 | Ga0496101_0534452 | Ga0496101_0534452_194_847 | 211 |
| 526 | 3300049570 | Ga0501033_0288556 | Ga0501033_0288556_470_1135 | 211 |
| 527 | 3300049823 | Ga0501044_0182393 | Ga0501044_0182393_1010_1675 | 211 |
| 528 | 3300005347 | Ga0070668_100088515 | Ga0070668_1000885152 | 212 |
| 529 | 3300005353 | Ga0070669_100044837 | Ga0070669_1000448374 | 212 |
| 530 | 3300005354 | Ga0070675_100052628 | Ga0070675_1000526283 | 212 |
| 531 | 3300005367 | Ga0070667_100049062 | Ga0070667_1000490622 | 212 |
| 532 | 3300005530 | Ga0070679_100009942 | Ga0070679_1000099422 | 212 |
| 533 | 3300005719 | Ga0068861_100076201 | Ga0068861_1000762013 | 212 |
| 534 | 3300005842 | Ga0068858_100001395 | Ga0068858_1000013953 | 212 |
| 535 | 3300006195 | Ga0075366_10004156 | Ga0075366_100041563 | 212 |
| 536 | 3300006881 | Ga0068865_100047012 | Ga0068865_1000470124 | 212 |
| 537 | 3300009094 | Ga0111539_10165127 | Ga0111539_101651275 | 212 |
| 538 | 3300009177 | Ga0105248_10086290 | Ga0105248_100862901 | 212 |
| 539 | 3300025921 | Ga0207652_10001310 | Ga0207652_1000131011 | 212 |
| 540 | 3300025926 | Ga0207659_10074272 | Ga0207659_100742722 | 212 |
| 541 | 3300025941 | Ga0207711_10090815 | Ga0207711_100908152 | 212 |
| 542 | 3300025949 | Ga0207667_10023225 | Ga0207667_100232255 | 212 |
| 543 | 3300025972 | Ga0207668_10625506 | Ga0207668_106255061 | 212 |
| 544 | 3300025986 | Ga0207658_10107262 | Ga0207658_101072622 | 212 |
| 545 | 3300026035 | Ga0207703_10009090 | Ga0207703_100090907 | 212 |
| 546 | 3300047469 | Ga0495673_0018930 | Ga0495673_0018930_968_1636 | 212 |
| 547 | 3300047472 | Ga0495686_0000834 | Ga0495686_0000834_10133_10801 | 212 |
| 548 | 3300048914 | Ga0496111_0165946 | Ga0496111_0165946_921_1610 | 212 |
| 549 | 3300001979 | JGI24740J21852_10008231 | JGI24740J21852_100082315 | 213 |
| 550 | 3300001989 | JGI24739J22299_10031369 | JGI24739J22299_100313692 | 213 |
| 551 | 3300002075 | JGI24738J21930_10002662 | JGI24738J21930_100026623 | 213 |
| 552 | 3300005327 | Ga0070658_10079426 | Ga0070658_100794264 | 213 |
| 553 | 3300005329 | Ga0070683_100006299 | Ga0070683_1000062992 | 213 |
| 554 | 3300005331 | Ga0070670_100062557 | Ga0070670_1000625572 | 213 |
| 555 | 3300005335 | Ga0070666_10023039 | Ga0070666_100230391 | 213 |
| 556 | 3300005344 | Ga0070661_100043382 | Ga0070661_1000433824 | 213 |
| 557 | 3300005353 | Ga0070669_100412491 | Ga0070669_1004124912 | 213 |
| 558 | 3300005366 | Ga0070659_100423701 | Ga0070659_1004237012 | 213 |
| 559 | 3300005367 | Ga0070667_100013316 | Ga0070667_1000133165 | 213 |
| 560 | 3300005367 | Ga0070667_100630742 | Ga0070667_1006307421 | 213 |
| 561 | 3300005455 | Ga0070663_100003727 | Ga0070663_1000037278 | 213 |
| 562 | 3300005457 | Ga0070662_100093853 | Ga0070662_1000938534 | 213 |
| 563 | 3300005539 | Ga0068853_100178109 | Ga0068853_1001781092 | 213 |
| 564 | 3300005545 | Ga0070695_100416424 | Ga0070695_1004164242 | 213 |
| 565 | 3300005546 | Ga0070696_100005859 | Ga0070696_1000058598 | 213 |
| 566 | 3300005563 | Ga0068855_100170191 | Ga0068855_1001701913 | 213 |
| 567 | 3300005564 | Ga0070664_100035435 | Ga0070664_1000354355 | 213 |
| 568 | 3300005577 | Ga0068857_100013825 | Ga0068857_1000138255 | 213 |
| 569 | 3300005578 | Ga0068854_100002842 | Ga0068854_1000028424 | 213 |
| 570 | 3300005578 | Ga0068854_100298201 | Ga0068854_1002982012 | 213 |
| 571 | 3300005616 | Ga0068852_100019423 | Ga0068852_1000194235 | 213 |
| 572 | 3300005844 | Ga0068862_100071963 | Ga0068862_1000719632 | 213 |
| 573 | 3300005844 | Ga0068862_100139529 | Ga0068862_1001395292 | 213 |
| 574 | 3300009094 | Ga0111539_10116009 | Ga0111539_101160094 | 213 |
| 575 | 3300013100 | Ga0157373_10122487 | Ga0157373_101224872 | 213 |
| 576 | 3300013307 | Ga0157372_10130324 | Ga0157372_101303242 | 213 |
| 577 | 3300020081 | Ga0206354_10118545 | Ga0206354_101185452 | 213 |
| 578 | 3300020082 | Ga0206353_11409418 | Ga0206353_114094182 | 213 |
| 579 | 3300021384 | Ga0213876_10012578 | Ga0213876_100125782 | 213 |
| 580 | 3300025893 | Ga0207682_10024490 | Ga0207682_100244903 | 213 |
| 581 | 3300025903 | Ga0207680_10039981 | Ga0207680_100399812 | 213 |
| 582 | 3300025903 | Ga0207680_10488542 | Ga0207680_104885422 | 213 |
| 583 | 3300025904 | Ga0207647_10030168 | Ga0207647_100301683 | 213 |
| 584 | 3300025909 | Ga0207705_10297955 | Ga0207705_102979552 | 213 |
| 585 | 3300025920 | Ga0207649_10305131 | Ga0207649_103051311 | 213 |
| 586 | 3300025931 | Ga0207644_10227767 | Ga0207644_102277672 | 213 |
| 587 | 3300025932 | Ga0207690_10181700 | Ga0207690_101817001 | 213 |
| 588 | 3300025933 | Ga0207706_10004081 | Ga0207706_1000408115 | 213 |
| 589 | 3300025933 | Ga0207706_10163511 | Ga0207706_101635113 | 213 |
| 590 | 3300025944 | Ga0207661_10334706 | Ga0207661_103347062 | 213 |
| 591 | 3300025945 | Ga0207679_10010952 | Ga0207679_100109525 | 213 |
| 592 | 3300025981 | Ga0207640_10111752 | Ga0207640_101117522 | 213 |
| 593 | 3300025981 | Ga0207640_10433416 | Ga0207640_104334162 | 213 |
| 594 | 3300025981 | Ga0207640_10765466 | Ga0207640_107654662 | 213 |
| 595 | 3300025986 | Ga0207658_10122634 | Ga0207658_101226343 | 213 |
| 596 | 3300026041 | Ga0207639_10231492 | Ga0207639_102314923 | 213 |
| 597 | 3300026067 | Ga0207678_10000487 | Ga0207678_1000048725 | 213 |
| 598 | 3300026116 | Ga0207674_10002967 | Ga0207674_1000296714 | 213 |
| 599 | 3300026142 | Ga0207698_10417051 | Ga0207698_104170512 | 213 |
| 600 | 3300027907 | Ga0207428_10380124 | Ga0207428_103801242 | 213 |
| 601 | 3300028380 | Ga0268265_10393094 | Ga0268265_103930942 | 213 |
| 602 | 3300031548 | Ga0307408_100014219 | Ga0307408_1000142194 | 213 |
| 603 | 3300031901 | Ga0307406_10049021 | Ga0307406_100490213 | 213 |
| 604 | 3300031995 | Ga0307409_100227934 | Ga0307409_1002279343 | 213 |
| 605 | 3300032002 | Ga0307416_100960420 | Ga0307416_1009604202 | 213 |
| 606 | 3300032126 | Ga0307415_100095893 | Ga0307415_1000958933 | 213 |
| 607 | 3300037312 | Ga0395899_0205000 | Ga0395899_0205000_221_862 | 213 |
| 608 | 3300037312 | Ga0395899_0218316 | Ga0395899_0218316_274_915 | 213 |
| 609 | 3300037312 | Ga0395899_0375388 | Ga0395899_0375388_220_864 | 213 |
| 610 | 3300037418 | Ga0395900_0957267 | Ga0395900_0957267_78_722 | 213 |
| 611 | 3300037471 | Ga0395905_0097211 | Ga0395905_0097211_1989_2630 | 213 |
| 612 | 3300037471 | Ga0395905_0226337 | Ga0395905_0226337_385_1029 | 213 |
| 613 | 3300037471 | Ga0395905_0236268 | Ga0395905_0236268_361_1002 | 213 |
| 614 | 3300037471 | Ga0395905_0256023 | Ga0395905_0256023_192_833 | 213 |
| 615 | 3300038443 | Ga0395901_0197552 | Ga0395901_0197552_364_1005 | 213 |
| 616 | 3300038443 | Ga0395901_0468390 | Ga0395901_0468390_96_740 | 213 |
| 617 | 3300039437 | Ga0436365_0694182 | Ga0436365_0694182_1124_1852 | 213 |
| 618 | 3300046525 | Ga0495663_0009781 | Ga0495663_0009781_12_656 | 213 |
| 619 | 3300046528 | Ga0495642_0092360 | Ga0495642_0092360_528_1172 | 213 |
| 620 | 3300046684 | Ga0495669_0000559 | Ga0495669_0000559_10472_11116 | 213 |
| 621 | 3300046684 | Ga0495669_0145714 | Ga0495669_0145714_401_1045 | 213 |
| 622 | 3300047445 | Ga0495677_0002453 | Ga0495677_0002453_2241_2885 | 213 |
| 623 | 3300050511 | nmdc:mga08y16_187160_c1 | nmdc:mga08y16_187160_c1_1244_1888 | 213 |
| 624 | 3300005328 | Ga0070676_10005451 | Ga0070676_100054515 | 215 |
| 625 | 3300005331 | Ga0070670_100084749 | Ga0070670_1000847493 | 215 |
| 626 | 3300005334 | Ga0068869_100144129 | Ga0068869_1001441293 | 215 |
| 627 | 3300005338 | Ga0068868_100203493 | Ga0068868_1002034931 | 215 |
| 628 | 3300005347 | Ga0070668_100002391 | Ga0070668_10000239113 | 215 |
| 629 | 3300005347 | Ga0070668_100086043 | Ga0070668_1000860433 | 215 |
| 630 | 3300005353 | Ga0070669_100018859 | Ga0070669_1000188593 | 215 |
| 631 | 3300005356 | Ga0070674_100023631 | Ga0070674_1000236313 | 215 |
| 632 | 3300005364 | Ga0070673_100447586 | Ga0070673_1004475861 | 215 |
| 633 | 3300005367 | Ga0070667_100053412 | Ga0070667_1000534124 | 215 |
| 634 | 3300005367 | Ga0070667_100077148 | Ga0070667_1000771482 | 215 |
| 635 | 3300005459 | Ga0068867_100013276 | Ga0068867_1000132763 | 215 |
| 636 | 3300005543 | Ga0070672_100022570 | Ga0070672_1000225704 | 215 |
| 637 | 3300005548 | Ga0070665_100061478 | Ga0070665_1000614784 | 215 |
| 638 | 3300005843 | Ga0068860_100001699 | Ga0068860_1000016996 | 215 |
| 639 | 3300005844 | Ga0068862_100018982 | Ga0068862_1000189824 | 215 |
| 640 | 3300006237 | Ga0097621_100006688 | Ga0097621_1000066885 | 215 |
| 641 | 3300006358 | Ga0068871_100001230 | Ga0068871_1000012305 | 215 |
| 642 | 3300006881 | Ga0068865_100034970 | Ga0068865_1000349704 | 215 |
| 643 | 3300009177 | Ga0105248_10132717 | Ga0105248_101327173 | 215 |
| 644 | 3300013308 | Ga0157375_10174162 | Ga0157375_101741622 | 215 |
| 645 | 3300025315 | Ga0207697_10016025 | Ga0207697_100160252 | 215 |
| 646 | 3300025907 | Ga0207645_10009118 | Ga0207645_100091185 | 215 |
| 647 | 3300025908 | Ga0207643_10041090 | Ga0207643_100410904 | 215 |
| 648 | 3300025923 | Ga0207681_10016480 | Ga0207681_100164804 | 215 |
| 649 | 3300025925 | Ga0207650_10051546 | Ga0207650_100515463 | 215 |
| 650 | 3300025938 | Ga0207704_10011088 | Ga0207704_100110884 | 215 |
| 651 | 3300025938 | Ga0207704_10025224 | Ga0207704_100252244 | 215 |
| 652 | 3300025940 | Ga0207691_10005722 | Ga0207691_100057225 | 215 |
| 653 | 3300025941 | Ga0207711_10106021 | Ga0207711_101060212 | 215 |
| 654 | 3300025960 | Ga0207651_10106858 | Ga0207651_101068583 | 215 |
| 655 | 3300025972 | Ga0207668_10001489 | Ga0207668_100014895 | 215 |
| 656 | 3300025986 | Ga0207658_10024756 | Ga0207658_100247564 | 215 |
| 657 | 3300025986 | Ga0207658_10049566 | Ga0207658_100495662 | 215 |
| 658 | 3300026023 | Ga0207677_10236952 | Ga0207677_102369523 | 215 |
| 659 | 3300026089 | Ga0207648_10029444 | Ga0207648_100294444 | 215 |
| 660 | 3300028379 | Ga0268266_10038807 | Ga0268266_100388072 | 215 |
| 661 | 3300028380 | Ga0268265_10001829 | Ga0268265_1000182918 | 215 |
| 662 | 3300028381 | Ga0268264_10002411 | Ga0268264_100024117 | 215 |
| 663 | 3300001904 | JGI24736J21556_1002432 | JGI24736J21556_10024324 | 216 |
| 664 | 3300001990 | JGI24737J22298_10024139 | JGI24737J22298_100241393 | 216 |
| 665 | 3300005293 | Ga0065715_10036833 | Ga0065715_100368332 | 216 |
| 666 | 3300005334 | Ga0068869_100212021 | Ga0068869_1002120212 | 216 |
| 667 | 3300005338 | Ga0068868_100360898 | Ga0068868_1003608982 | 216 |
| 668 | 3300005339 | Ga0070660_100003259 | Ga0070660_1000032596 | 216 |
| 669 | 3300005353 | Ga0070669_100028059 | Ga0070669_1000280593 | 216 |
| 670 | 3300005366 | Ga0070659_100002449 | Ga0070659_1000024492 | 216 |
| 671 | 3300005457 | Ga0070662_100002519 | Ga0070662_10000251911 | 216 |
| 672 | 3300005539 | Ga0068853_100152672 | Ga0068853_1001526722 | 216 |
| 673 | 3300005577 | Ga0068857_100237643 | Ga0068857_1002376432 | 216 |
| 674 | 3300005617 | Ga0068859_100117719 | Ga0068859_1001177193 | 216 |
| 675 | 3300005718 | Ga0068866_10078161 | Ga0068866_100781613 | 216 |
| 676 | 3300005841 | Ga0068863_100176774 | Ga0068863_1001767743 | 216 |
| 677 | 3300005842 | Ga0068858_100001826 | Ga0068858_1000018264 | 216 |
| 678 | 3300005844 | Ga0068862_100110063 | Ga0068862_1001100633 | 216 |
| 679 | 3300005844 | Ga0068862_100122744 | Ga0068862_1001227443 | 216 |
| 680 | 3300006871 | Ga0075434_100450853 | Ga0075434_1004508532 | 216 |
| 681 | 3300006871 | Ga0075434_100550281 | Ga0075434_1005502812 | 216 |
| 682 | 3300006931 | Ga0097620_100117721 | Ga0097620_1001177213 | 216 |
| 683 | 3300009093 | Ga0105240_10682812 | Ga0105240_106828122 | 216 |
| 684 | 3300009098 | Ga0105245_10269152 | Ga0105245_102691523 | 216 |
| 685 | 3300009148 | Ga0105243_10144357 | Ga0105243_101443573 | 216 |
| 686 | 3300009148 | Ga0105243_10213196 | Ga0105243_102131962 | 216 |
| 687 | 3300009176 | Ga0105242_10595371 | Ga0105242_105953712 | 216 |
| 688 | 3300009177 | Ga0105248_11277878 | Ga0105248_112778782 | 216 |
| 689 | 3300009553 | Ga0105249_10007728 | Ga0105249_100077283 | 216 |
| 690 | 3300010375 | Ga0105239_10329108 | Ga0105239_103291083 | 216 |
| 691 | 3300011119 | Ga0105246_10273048 | Ga0105246_102730482 | 216 |
| 692 | 3300013102 | Ga0157371_10389594 | Ga0157371_103895942 | 216 |
| 693 | 3300013306 | Ga0163162_10798385 | Ga0163162_107983852 | 216 |
| 694 | 3300013307 | Ga0157372_11008636 | Ga0157372_110086362 | 216 |
| 695 | 3300013308 | Ga0157375_10840495 | Ga0157375_108404952 | 216 |
| 696 | 3300014745 | Ga0157377_10018629 | Ga0157377_100186294 | 216 |
| 697 | 3300025315 | Ga0207697_10141693 | Ga0207697_101416932 | 216 |
| 698 | 3300025899 | Ga0207642_10150799 | Ga0207642_101507993 | 216 |
| 699 | 3300025927 | Ga0207687_10073443 | Ga0207687_100734433 | 216 |
| 700 | 3300025935 | Ga0207709_10057335 | Ga0207709_100573353 | 216 |
| 701 | 3300025938 | Ga0207704_10464209 | Ga0207704_104642092 | 216 |
| 702 | 3300025942 | Ga0207689_10470168 | Ga0207689_104701681 | 216 |
| 703 | 3300026023 | Ga0207677_10335334 | Ga0207677_103353342 | 216 |
| 704 | 3300026035 | Ga0207703_10000974 | Ga0207703_1000097419 | 216 |
| 705 | 3300026088 | Ga0207641_10228784 | Ga0207641_102287842 | 216 |
| 706 | 3300028380 | Ga0268265_10120734 | Ga0268265_101207343 | 216 |
| 707 | 3300028380 | Ga0268265_10152024 | Ga0268265_101520243 | 216 |
| 708 | 3300037418 | Ga0395900_0734985 | Ga0395900_0734985_65_715 | 216 |
| 709 | 3300037471 | Ga0395905_0335021 | Ga0395905_0335021_324_974 | 216 |
| 710 | 3300038443 | Ga0395901_0098696 | Ga0395901_0098696_951_1601 | 216 |
| 711 | 3300050513 | nmdc:mga0rr50_488788_c1 | nmdc:mga0rr50_488788_c1_124_780 | 216 |
| 712 | 3300050515 | nmdc:mga0a205_63805_c1 | nmdc:mga0a205_63805_c1_2489_3145 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wli-assembly1.cif.gz_B | potassium channel from magnetospirillum magnetotacticum | 0.8018 | 114 | 207 |
| 6o9u-assembly1.cif.gz_A | kirbac3.1 at a resolution of 2 angstroms | 0.7804 | 114 | 207 |
| 2wlj-assembly1.cif.gz_A-2 | potassium channel from magnetospirillum magnetotacticum | 0.7514 | 115 | 207 |
| 2wlj-assembly1.cif.gz_B-2 | potassium channel from magnetospirillum magnetotacticum | 0.751 | 114 | 207 |
| 2wli-assembly1.cif.gz_A | potassium channel from magnetospirillum magnetotacticum | 0.7386 | 114 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JJJ2_64_158_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7861 | 115 | 213 | 1.10.287.70 |
| af_Q8LIN5_63_157_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7764 | 118 | 213 | 1.10.287.70 |
| af_Q850M0_51_165_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7606 | 117 | 213 | 1.10.287.70 |
| 3e89A00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7519 | 118 | 207 | 1.10.287.70 |
| af_O53346_37_141_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.7431 | 115 | 214 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W5Z2G3-F1-model_v4 | Putative membrane protein | 0.9424 | 5 | 211 |
GO:0016020
|
| AF-A0A3F3ATX5-F1-model_v4 | deleted | 0.9416 | 109 | 212 |
|
| AF-A0A370KDB9-F1-model_v4 | DUF1345 domain-containing protein | 0.9389 | 19 | 215 |
GO:0016020
|
| AF-A0A066UJ97-F1-model_v4 | Uncharacterized protein | 0.9376 | 109 | 204 |
GO:0016020
|
| AF-A0A537MK23-F1-model_v4 | DUF1345 domain-containing protein | 0.9356 | 15 | 211 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar