F476846

General Info

Members Datasets Scaffolds Average Seq Length
712 294 698 211

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0694182|Ga0436365_0694182_1124_1852
Length 242
Sequence MRRSQAIEKALACRLAPRYREAMAGQRKTTIGNRLAPPRFILFVVVEVAVTAGLLLSGLVDTRQATMIGFDAAALIFLVACLPLFAGSDAASMRTHAERNDANRVLLLAITGAVMVAILVAVASEVVGGSPEPFQKILVLATLVLAWLFSNTVYALHYADLCYHPEETKRRGGGLGLEFPTTPAPDYADFAYFAFTLGMTFQTSDVSITSRRIRAVVTVHCFAAFVFNLGVLAFTINVLGSG

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
5 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
6 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
11 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
12 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
13 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
14 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
15 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
16 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
17 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
207 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
212 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
218 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
272 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
273 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
277 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
278 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
283 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
284 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
287 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
288 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
289 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
294 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0.28
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.57
Nodule 0
Rhizoplane 0.98
Rhizosphere 83.57
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002432 3300001904 Bacteria 3291
2 JGI24741J21665_1000810 3300001915 Bacteria 9394
3 JGI24752J21851_1006200 3300001976 Bacteria 1561
4 JGI24740J21852_10008231 3300001979 Bacteria 4173
5 JGI24740J21852_10059086 3300001979 Bacteria 1064
6 JGI24739J22299_10031369 3300001989 Bacteria 1836
7 JGI24737J22298_10024139 3300001990 Bacteria 1926
8 JGI24735J21928_10000764 3300002067 Bacteria 11442
9 JGI24738J21930_10002662 3300002075 Bacteria 4604
10 JGI25151J46595_10019050 3300003187 Bacteria 2928
11 rootH1_10025996 3300003316 Bacteria 1382
12 rootH2_10206796 3300003320 Bacteria 1395
13 rootL2_10096988 3300003322 Bacteria 2318
14 rootL2_10112214 3300003322 Bacteria 4236
15 Ga0055536_1000943 3300003781 Bacteria 18711
16 Ga0055536_1001481 3300003781 Bacteria 14130
17 Ga0055536_1005438 3300003781 Bacteria 6226
18 Ga0055530_10000092 3300003791 Bacteria 77982
19 Ga0055531_10002266 3300003794 Bacteria 13019
20 Ga0055531_10003124 3300003794 Bacteria 10691
21 Ga0055531_10006170 3300003794 Bacteria 6853
22 Ga0065704_10005861 3300005289 Bacteria 4388
23 Ga0065715_10036833 3300005293 Bacteria 1810
24 Ga0065707_10081805 3300005295 Bacteria 38502
25 Ga0070658_10000003 3300005327 Bacteria 465963
26 Ga0070658_10037754 3300005327 Bacteria 3894
27 Ga0070658_10079426 3300005327 Bacteria 2694
28 Ga0070658_10204152 3300005327 Bacteria 1668
29 Ga0070658_10401929 3300005327 Bacteria 1177
30 Ga0070676_10005451 3300005328 Bacteria 6778
31 Ga0070676_10043173 3300005328 Bacteria 2619
32 Ga0070683_100006299 3300005329 Bacteria 9957
33 Ga0070683_100251284 3300005329 Bacteria 1682
34 Ga0070683_100605363 3300005329 Bacteria 1049
35 Ga0070670_100000586 3300005331 Bacteria 28767
36 Ga0070670_100001053 3300005331 Bacteria 21912
37 Ga0070670_100036985 3300005331 Bacteria 4200
38 Ga0070670_100062557 3300005331 Bacteria 3195
39 Ga0070670_100084749 3300005331 Bacteria 2723
40 Ga0068869_100144129 3300005334 Bacteria 1842
41 Ga0068869_100212021 3300005334 Bacteria 1531
42 Ga0070666_10000908 3300005335 Bacteria 17985
43 Ga0070666_10004770 3300005335 Bacteria 8285
44 Ga0070666_10023039 3300005335 Bacteria 4049
45 Ga0070666_10077145 3300005335 Bacteria 2274
46 Ga0070680_100004587 3300005336 Bacteria 10387
47 Ga0070680_100269244 3300005336 Bacteria 1442
48 Ga0070682_100023894 3300005337 Bacteria 3633
49 Ga0068868_100000090 3300005338 Bacteria 55967
50 Ga0068868_100203493 3300005338 Bacteria 1652
51 Ga0068868_100360898 3300005338 Bacteria 1246
52 Ga0070660_100001199 3300005339 Bacteria 17568
53 Ga0070660_100002551 3300005339 Bacteria 12486
54 Ga0070660_100003259 3300005339 Bacteria 11135
55 Ga0070660_100007800 3300005339 Bacteria 7465
56 Ga0070660_100011384 3300005339 Bacteria 6317
57 Ga0070660_100029820 3300005339 Bacteria 4090
58 Ga0070660_100134541 3300005339 Bacteria 1980
59 Ga0070660_100432910 3300005339 Bacteria 1090
60 Ga0070661_100000113 3300005344 Bacteria 67566
61 Ga0070661_100025440 3300005344 Bacteria 4254
62 Ga0070661_100043382 3300005344 Bacteria 3285
63 Ga0070661_100096755 3300005344 Bacteria 2191
64 Ga0070661_100474888 3300005344 Bacteria 998
65 Ga0070668_100000056 3300005347 Bacteria 70052
66 Ga0070668_100000112 3300005347 Bacteria 50544
67 Ga0070668_100002391 3300005347 Bacteria 13795
68 Ga0070668_100086043 3300005347 Bacteria 2471
69 Ga0070668_100088515 3300005347 Bacteria 2438
70 Ga0070668_100093379 3300005347 Bacteria 2374
71 Ga0070669_100000113 3300005353 Bacteria 77341
72 Ga0070669_100018859 3300005353 Bacteria 4931
73 Ga0070669_100022511 3300005353 Bacteria 4505
74 Ga0070669_100028059 3300005353 Bacteria 4052
75 Ga0070669_100044837 3300005353 Bacteria 3222
76 Ga0070669_100049600 3300005353 Bacteria 3065
77 Ga0070669_100412491 3300005353 Bacteria 1107
78 Ga0070669_100583389 3300005353 Unclassified 935
79 Ga0070675_100052628 3300005354 Bacteria 3348
80 Ga0070675_100210104 3300005354 Bacteria 1691
81 Ga0070671_100000038 3300005355 Bacteria 94972
82 Ga0070671_100000601 3300005355 Bacteria 25698
83 Ga0070671_100797283 3300005355 Bacteria 822
84 Ga0070674_100023631 3300005356 Bacteria 3981
85 Ga0070674_100142313 3300005356 Bacteria 1801
86 Ga0070673_100447586 3300005364 Bacteria 1161
87 Ga0070659_100000017 3300005366 Bacteria 163966
88 Ga0070659_100002449 3300005366 Bacteria 13190
89 Ga0070659_100029300 3300005366 Bacteria 4254
90 Ga0070659_100050509 3300005366 Bacteria 3269
91 Ga0070659_100107204 3300005366 Bacteria 2253
92 Ga0070659_100423701 3300005366 Bacteria 1126
93 Ga0070667_100000058 3300005367 Bacteria 148071
94 Ga0070667_100000215 3300005367 Bacteria 67317
95 Ga0070667_100000710 3300005367 Bacteria 32106
96 Ga0070667_100005459 3300005367 Bacteria 10620
97 Ga0070667_100013316 3300005367 Bacteria 6794
98 Ga0070667_100049062 3300005367 Bacteria 3555
99 Ga0070667_100053412 3300005367 Bacteria 3410
100 Ga0070667_100077148 3300005367 Bacteria 2845
101 Ga0070667_100630742 3300005367 Bacteria 989
102 Ga0070701_10126630 3300005438 Bacteria 1446
103 Ga0070705_100039054 3300005440 Bacteria 2691
104 Ga0070663_100003727 3300005455 Bacteria 8837
105 Ga0070663_100006853 3300005455 Bacteria 6893
106 Ga0070663_100110401 3300005455 Bacteria 2065
107 Ga0070663_100128922 3300005455 Bacteria 1919
108 Ga0070663_100826306 3300005455 Bacteria 796
109 Ga0070662_100002519 3300005457 Bacteria 11285
110 Ga0070662_100009237 3300005457 Bacteria 6440
111 Ga0070662_100077150 3300005457 Bacteria 2472
112 Ga0070662_100093853 3300005457 Bacteria 2258
113 Ga0070662_100195741 3300005457 Bacteria 1601
114 Ga0070662_100462248 3300005457 Bacteria 1055
115 Ga0070681_10092271 3300005458 Bacteria 2977
116 Ga0068867_100013276 3300005459 Bacteria 5835
117 Ga0070679_100002379 3300005530 Bacteria 17052
118 Ga0070679_100009942 3300005530 Bacteria 9006
119 Ga0070679_100041996 3300005530 Bacteria 4554
120 Ga0070679_100079830 3300005530 Bacteria 3261
121 Ga0070679_100279968 3300005530 Bacteria 1621
122 Ga0070684_100332375 3300005535 Bacteria 1396
123 Ga0068853_100152672 3300005539 Bacteria 2079
124 Ga0068853_100172730 3300005539 Bacteria 1956
125 Ga0068853_100178109 3300005539 Bacteria 1927
126 Ga0068853_100208611 3300005539 Bacteria 1780
127 Ga0070672_100020073 3300005543 Bacteria 4867
128 Ga0070672_100022570 3300005543 Bacteria 4625
129 Ga0070686_100000179 3300005544 Bacteria 44874
130 Ga0070695_100416424 3300005545 Bacteria 1022
131 Ga0070696_100005859 3300005546 Bacteria 8203
132 Ga0070696_100006865 3300005546 Bacteria 7597
133 Ga0070665_100000207 3300005548 Bacteria 102416
134 Ga0070665_100061478 3300005548 Bacteria 3765
135 Ga0070665_100094918 3300005548 Bacteria 2987
136 Ga0070665_100162807 3300005548 Bacteria 2233
137 Ga0068855_100011310 3300005563 Bacteria 10777
138 Ga0068855_100023513 3300005563 Bacteria 7378
139 Ga0068855_100170191 3300005563 Bacteria 2468
140 Ga0068855_100198967 3300005563 Bacteria 2257
141 Ga0070664_100035435 3300005564 Bacteria 4189
142 Ga0070664_100066308 3300005564 Bacteria 3082
143 Ga0070664_100117579 3300005564 Bacteria 2325
144 Ga0068857_100007442 3300005577 Bacteria 9424
145 Ga0068857_100013825 3300005577 Bacteria 7028
146 Ga0068857_100064807 3300005577 Bacteria 3249
147 Ga0068857_100089005 3300005577 Bacteria 2762
148 Ga0068857_100126576 3300005577 Bacteria 2302
149 Ga0068857_100237643 3300005577 Bacteria 1667
150 Ga0068854_100002842 3300005578 Bacteria 10755
151 Ga0068854_100086016 3300005578 Bacteria 2330
152 Ga0068854_100298201 3300005578 Bacteria 1303
153 Ga0068856_100005769 3300005614 Bacteria 12203
154 Ga0068852_100019423 3300005616 Bacteria 5378
155 Ga0068852_100045264 3300005616 Bacteria 3742
156 Ga0068852_100120158 3300005616 Bacteria 2404
157 Ga0068859_100000085 3300005617 Bacteria 85748
158 Ga0068859_100018076 3300005617 Bacteria 7085
159 Ga0068859_100022219 3300005617 Bacteria 6361
160 Ga0068859_100037442 3300005617 Bacteria 4868
161 Ga0068859_100117719 3300005617 Bacteria 2722
162 Ga0068859_100866421 3300005617 Bacteria 989
163 Ga0068864_100000041 3300005618 Bacteria 165878
164 Ga0068864_100000352 3300005618 Bacteria 40434
165 Ga0068864_100002862 3300005618 Bacteria 14259
166 Ga0068866_10078161 3300005718 Bacteria 1769
167 Ga0068861_100000282 3300005719 Bacteria 28556
168 Ga0068861_100076201 3300005719 Bacteria 2613
169 Ga0068861_100211253 3300005719 Bacteria 1635
170 Ga0068861_100836461 3300005719 Bacteria 867
171 Ga0068851_10161858 3300005834 Bacteria 1230
172 Ga0068863_100000031 3300005841 Bacteria 175602
173 Ga0068863_100000035 3300005841 Bacteria 165877
174 Ga0068863_100007196 3300005841 Bacteria 10916
175 Ga0068863_100010763 3300005841 Bacteria 8876
176 Ga0068863_100016737 3300005841 Bacteria 7034
177 Ga0068863_100098058 3300005841 Bacteria 2783
178 Ga0068863_100176774 3300005841 Bacteria 2049
179 Ga0068858_100000444 3300005842 Bacteria 43311
180 Ga0068858_100001395 3300005842 Bacteria 24879
181 Ga0068858_100001826 3300005842 Bacteria 21672
182 Ga0068858_100054018 3300005842 Bacteria 3715
183 Ga0068858_100082600 3300005842 Bacteria 2987
184 Ga0068860_100000049 3300005843 Bacteria 208782
185 Ga0068860_100001699 3300005843 Bacteria 23523
186 Ga0068860_100004766 3300005843 Bacteria 13819
187 Ga0068860_100005214 3300005843 Bacteria 13197
188 Ga0068860_100007900 3300005843 Bacteria 10619
189 Ga0068860_100031421 3300005843 Bacteria 5104
190 Ga0068862_100000042 3300005844 Bacteria 165084
191 Ga0068862_100001040 3300005844 Bacteria 26611
192 Ga0068862_100003039 3300005844 Bacteria 14609
193 Ga0068862_100018982 3300005844 Bacteria 5732
194 Ga0068862_100071963 3300005844 Bacteria 2986
195 Ga0068862_100091969 3300005844 Bacteria 2643
196 Ga0068862_100110063 3300005844 Bacteria 2417
197 Ga0068862_100122744 3300005844 Bacteria 2291
198 Ga0068862_100139529 3300005844 Bacteria 2150
199 Ga0075368_10001383 3300006042 Bacteria 7729
200 Ga0075364_10025101 3300006051 Bacteria 3792
201 Ga0075432_10000674 3300006058 Bacteria 10501
202 Ga0075367_10002205 3300006178 Bacteria 8788
203 Ga0075366_10004156 3300006195 Bacteria 7755
204 Ga0097621_100006688 3300006237 Bacteria 8193
205 Ga0075370_10026878 3300006353 Bacteria 3190
206 Ga0075370_10058548 3300006353 Bacteria 2192
207 Ga0068871_100001230 3300006358 Bacteria 17096
208 Ga0068871_100060613 3300006358 Bacteria 3087
209 Ga0075434_100220874 3300006871 Bacteria 1914
210 Ga0075434_100450853 3300006871 Bacteria 1308
211 Ga0075434_100550281 3300006871 Unclassified 1174
212 Ga0068865_100034970 3300006881 Bacteria 3375
213 Ga0068865_100047012 3300006881 Bacteria 2963
214 Ga0097620_100000085 3300006931 Bacteria 85748
215 Ga0097620_100018077 3300006931 Bacteria 7085
216 Ga0097620_100022219 3300006931 Bacteria 6361
217 Ga0097620_100037440 3300006931 Bacteria 4868
218 Ga0097620_100117721 3300006931 Bacteria 2722
219 Ga0097620_100866482 3300006931 Bacteria 989
220 Ga0075435_100141620 3300007076 Bacteria 2018
221 Ga0105251_10000180 3300009011 Bacteria 63702
222 Ga0105251_10012298 3300009011 Bacteria 4849
223 Ga0105240_10072933 3300009093 Bacteria 4241
224 Ga0105240_10074677 3300009093 Bacteria 4184
225 Ga0105240_10682812 3300009093 Bacteria 1123
226 Ga0105240_10738808 3300009093 Bacteria 1071
227 Ga0111539_10116009 3300009094 Bacteria 3140
228 Ga0111539_10165127 3300009094 Bacteria 2589
229 Ga0111539_10479863 3300009094 Bacteria 1448
230 Ga0105245_10269152 3300009098 Bacteria 1661
231 Ga0105245_10547729 3300009098 Bacteria 1178
232 Ga0105247_10005830 3300009101 Bacteria 7700
233 Ga0105247_10010754 3300009101 Bacteria 5527
234 Ga0105243_10144357 3300009148 Bacteria 2035
235 Ga0105243_10213196 3300009148 Bacteria 1702
236 Ga0105241_10002299 3300009174 Bacteria 14362
237 Ga0105242_10595371 3300009176 Bacteria 1067
238 Ga0105248_10000045 3300009177 Bacteria 165909
239 Ga0105248_10000296 3300009177 Bacteria 59123
240 Ga0105248_10004622 3300009177 Bacteria 15222
241 Ga0105248_10010024 3300009177 Bacteria 10432
242 Ga0105248_10027704 3300009177 Bacteria 6310
243 Ga0105248_10080237 3300009177 Bacteria 3667
244 Ga0105248_10086290 3300009177 Bacteria 3532
245 Ga0105248_10132717 3300009177 Bacteria 2810
246 Ga0105248_10230124 3300009177 Bacteria 2087
247 Ga0105248_11277878 3300009177 Bacteria 830
248 Ga0105237_10004065 3300009545 Bacteria 17062
249 Ga0105237_10488760 3300009545 Bacteria 1237
250 Ga0105238_10226677 3300009551 Bacteria 1845
251 Ga0105249_10000055 3300009553 Bacteria 161674
252 Ga0105249_10007728 3300009553 Bacteria 9371
253 Ga0105249_10022022 3300009553 Bacteria 5707
254 Ga0105249_10059373 3300009553 Bacteria 3508
255 Ga0105249_10196155 3300009553 Bacteria 1973
256 Ga0105249_10749480 3300009553 Bacteria 1039
257 Ga0105249_11160037 3300009553 Bacteria 843
258 Ga0105239_10002689 3300010375 Bacteria 22375
259 Ga0105239_10329108 3300010375 Bacteria 1723
260 Ga0105246_10002637 3300011119 Bacteria 10862
261 Ga0105246_10055468 3300011119 Bacteria 2735
262 Ga0105246_10273048 3300011119 Bacteria 1352
263 Ga0157373_10051195 3300013100 Bacteria 2942
264 Ga0157373_10070595 3300013100 Bacteria 2468
265 Ga0157373_10122487 3300013100 Bacteria 1828
266 Ga0157371_10389594 3300013102 Bacteria 1018
267 Ga0157370_10070441 3300013104 Bacteria 3300
268 Ga0157370_10555801 3300013104 Bacteria 1052
269 Ga0157370_10598150 3300013104 Bacteria 1010
270 Ga0163162_10003520 3300013306 Bacteria 14982
271 Ga0163162_10058628 3300013306 Bacteria 3880
272 Ga0163162_10099028 3300013306 Bacteria 3005
273 Ga0163162_10798385 3300013306 Bacteria 1061
274 Ga0157372_10130324 3300013307 Bacteria 2893
275 Ga0157372_10361414 3300013307 Bacteria 1692
276 Ga0157372_10975682 3300013307 Bacteria 982
277 Ga0157372_11008636 3300013307 Bacteria 964
278 Ga0157375_10174162 3300013308 Bacteria 2301
279 Ga0157375_10308550 3300013308 Bacteria 1746
280 Ga0157375_10460611 3300013308 Bacteria 1437
281 Ga0157375_10617352 3300013308 Bacteria 1242
282 Ga0157375_10840495 3300013308 Bacteria 1065
283 Ga0163163_10169888 3300014325 Bacteria 2227
284 Ga0157380_10001987 3300014326 Bacteria 13613
285 Ga0157380_10415209 3300014326 Bacteria 1282
286 Ga0157380_10463201 3300014326 Bacteria 1221
287 Ga0157377_10018629 3300014745 Bacteria 3611
288 Ga0157379_10004695 3300014968 Bacteria 11728
289 Ga0157379_10014954 3300014968 Bacteria 6806
290 Ga0163161_10022483 3300017792 Bacteria 4441
291 Ga0163161_10292968 3300017792 Bacteria 1280
292 Ga0206354_10118545 3300020081 Bacteria 1515
293 Ga0206353_11409418 3300020082 Bacteria 3019
294 Ga0213876_10012578 3300021384 Bacteria 4503
295 Ga0213875_10002279 3300021388 Bacteria 11630
296 Ga0209675_1000366 3300025291 Bacteria 38418
297 Ga0209676_1000081 3300025292 Bacteria 285297
298 Ga0209676_1000133 3300025292 Bacteria 184430
299 Ga0209676_1000187 3300025292 Bacteria 141338
300 Ga0209025_1000669 3300025294 Bacteria 59314
301 Ga0209025_1007910 3300025294 Bacteria 7787
302 Ga0209050_1000067 3300025298 Bacteria 304206
303 Ga0209050_1002482 3300025298 Bacteria 15635
304 Ga0209050_1011468 3300025298 Bacteria 4195
305 Ga0209051_1014308 3300025303 Bacteria 3710
306 Ga0209257_1000132 3300025304 Bacteria 210870
307 Ga0209257_1000359 3300025304 Bacteria 93026
308 Ga0209257_1043464 3300025304 Bacteria 1318
309 Ga0207697_10002053 3300025315 Bacteria 10604
310 Ga0207697_10006670 3300025315 Bacteria 5199
311 Ga0207697_10016025 3300025315 Bacteria 3092
312 Ga0207697_10141693 3300025315 Bacteria 1043
313 Ga0207656_10057054 3300025321 Bacteria 1703
314 Ga0207656_10098746 3300025321 Bacteria 1336
315 Ga0207713_1000939 3300025735 Bacteria 26164
316 Ga0207713_1014924 3300025735 Bacteria 4008
317 Ga0207682_10024490 3300025893 Bacteria 2390
318 Ga0207642_10150799 3300025899 Bacteria 1237
319 Ga0207710_10002951 3300025900 Bacteria 7704
320 Ga0207710_10004160 3300025900 Bacteria 6351
321 Ga0207680_10000082 3300025903 Bacteria 42968
322 Ga0207680_10003667 3300025903 Bacteria 7217
323 Ga0207680_10011910 3300025903 Bacteria 4414
324 Ga0207680_10039981 3300025903 Bacteria 2725
325 Ga0207680_10043943 3300025903 Bacteria 2624
326 Ga0207680_10488542 3300025903 Bacteria 876
327 Ga0207647_10000297 3300025904 Bacteria 40885
328 Ga0207647_10022931 3300025904 Bacteria 4139
329 Ga0207647_10030168 3300025904 Bacteria 3501
330 Ga0207645_10009118 3300025907 Bacteria 6882
331 Ga0207645_10025449 3300025907 Bacteria 3829
332 Ga0207643_10041090 3300025908 Bacteria 2605
333 Ga0207705_10000005 3300025909 Bacteria 673478
334 Ga0207705_10001221 3300025909 Bacteria 20793
335 Ga0207705_10001485 3300025909 Bacteria 18661
336 Ga0207705_10297955 3300025909 Bacteria 1236
337 Ga0207707_10073708 3300025912 Bacteria 2977
338 Ga0207695_10015828 3300025913 Bacteria 8859
339 Ga0207695_10023626 3300025913 Bacteria 6937
340 Ga0207695_10060858 3300025913 Bacteria 3905
341 Ga0207671_10001440 3300025914 Bacteria 27565
342 Ga0207671_10186288 3300025914 Bacteria 1617
343 Ga0207660_10003861 3300025917 Bacteria 9764
344 Ga0207660_10100600 3300025917 Bacteria 2159
345 Ga0207662_10226556 3300025918 Bacteria 1219
346 Ga0207657_10000530 3300025919 Bacteria 40507
347 Ga0207657_10002188 3300025919 Bacteria 21178
348 Ga0207657_10003138 3300025919 Bacteria 17677
349 Ga0207657_10004555 3300025919 Bacteria 14650
350 Ga0207657_10008611 3300025919 Bacteria 10327
351 Ga0207657_10009149 3300025919 Bacteria 9995
352 Ga0207657_10014090 3300025919 Bacteria 7824
353 Ga0207649_10000089 3300025920 Bacteria 76923
354 Ga0207649_10003198 3300025920 Bacteria 8977
355 Ga0207649_10305131 3300025920 Bacteria 1165
356 Ga0207652_10000008 3300025921 Bacteria 286698
357 Ga0207652_10001310 3300025921 Bacteria 22105
358 Ga0207652_10229839 3300025921 Bacteria 1672
359 Ga0207681_10000042 3300025923 Bacteria 137167
360 Ga0207681_10016480 3300025923 Bacteria 4624
361 Ga0207681_10020048 3300025923 Bacteria 4234
362 Ga0207681_10031170 3300025923 Bacteria 3480
363 Ga0207681_10583643 3300025923 Unclassified 922
364 Ga0207694_10015661 3300025924 Bacteria 5719
365 Ga0207650_10000238 3300025925 Bacteria 61061
366 Ga0207650_10020631 3300025925 Bacteria 4648
367 Ga0207650_10031130 3300025925 Bacteria 3850
368 Ga0207650_10037426 3300025925 Bacteria 3535
369 Ga0207650_10051546 3300025925 Bacteria 3046
370 Ga0207650_10273210 3300025925 Bacteria 1374
371 Ga0207659_10074272 3300025926 Bacteria 2492
372 Ga0207687_10073443 3300025927 Bacteria 2449
373 Ga0207644_10000071 3300025931 Bacteria 74753
374 Ga0207644_10000316 3300025931 Bacteria 31524
375 Ga0207644_10227767 3300025931 Bacteria 1480
376 Ga0207644_10382401 3300025931 Bacteria 1148
377 Ga0207690_10000035 3300025932 Bacteria 149201
378 Ga0207690_10006633 3300025932 Bacteria 6858
379 Ga0207690_10120910 3300025932 Bacteria 1902
380 Ga0207690_10181700 3300025932 Bacteria 1584
381 Ga0207706_10001755 3300025933 Bacteria 21276
382 Ga0207706_10004081 3300025933 Bacteria 13792
383 Ga0207706_10086680 3300025933 Bacteria 2753
384 Ga0207706_10103828 3300025933 Bacteria 2500
385 Ga0207706_10163511 3300025933 Bacteria 1956
386 Ga0207706_10169249 3300025933 Bacteria 1920
387 Ga0207706_10291421 3300025933 Bacteria 1423
388 Ga0207709_10057335 3300025935 Bacteria 2415
389 Ga0207709_10410467 3300025935 Bacteria 1038
390 Ga0207709_10511494 3300025935 Bacteria 939
391 Ga0207670_10086186 3300025936 Bacteria 2209
392 Ga0207704_10011088 3300025938 Bacteria 4423
393 Ga0207704_10025224 3300025938 Bacteria 3241
394 Ga0207704_10464209 3300025938 Bacteria 1013
395 Ga0207691_10005722 3300025940 Bacteria 12020
396 Ga0207691_10485005 3300025940 Bacteria 1050
397 Ga0207711_10000027 3300025941 Bacteria 236548
398 Ga0207711_10000251 3300025941 Bacteria 57860
399 Ga0207711_10003263 3300025941 Bacteria 14119
400 Ga0207711_10005768 3300025941 Bacteria 10458
401 Ga0207711_10090815 3300025941 Bacteria 2685
402 Ga0207711_10106021 3300025941 Bacteria 2493
403 Ga0207689_10468943 3300025942 Bacteria 1053
404 Ga0207689_10470168 3300025942 Bacteria 1052
405 Ga0207661_10334706 3300025944 Bacteria 1363
406 Ga0207661_10449628 3300025944 Bacteria 1173
407 Ga0207679_10010952 3300025945 Bacteria 5851
408 Ga0207679_10429798 3300025945 Bacteria 1167
409 Ga0207667_10019183 3300025949 Bacteria 7648
410 Ga0207667_10023225 3300025949 Bacteria 6830
411 Ga0207667_10027762 3300025949 Bacteria 6156
412 Ga0207667_10117138 3300025949 Bacteria 2745
413 Ga0207651_10106858 3300025960 Bacteria 2090
414 Ga0207651_10118780 3300025960 Bacteria 2001
415 Ga0207712_10000262 3300025961 Bacteria 51101
416 Ga0207712_10000373 3300025961 Bacteria 39590
417 Ga0207712_10009082 3300025961 Bacteria 6288
418 Ga0207712_10109591 3300025961 Bacteria 2068
419 Ga0207668_10000011 3300025972 Bacteria 184484
420 Ga0207668_10000038 3300025972 Bacteria 112486
421 Ga0207668_10000194 3300025972 Bacteria 41743
422 Ga0207668_10001489 3300025972 Bacteria 13707
423 Ga0207668_10013873 3300025972 Bacteria 4975
424 Ga0207668_10573712 3300025972 Bacteria 980
425 Ga0207668_10625506 3300025972 Bacteria 940
426 Ga0207640_10073602 3300025981 Bacteria 2309
427 Ga0207640_10111752 3300025981 Bacteria 1938
428 Ga0207640_10161070 3300025981 Bacteria 1660
429 Ga0207640_10433416 3300025981 Bacteria 1079
430 Ga0207640_10765466 3300025981 Bacteria 834
431 Ga0207658_10000014 3300025986 Bacteria 218248
432 Ga0207658_10000037 3300025986 Bacteria 148087
433 Ga0207658_10000362 3300025986 Bacteria 44869
434 Ga0207658_10001094 3300025986 Bacteria 21877
435 Ga0207658_10008451 3300025986 Bacteria 7006
436 Ga0207658_10024756 3300025986 Bacteria 4200
437 Ga0207658_10049566 3300025986 Bacteria 3086
438 Ga0207658_10107262 3300025986 Bacteria 2201
439 Ga0207658_10122634 3300025986 Bacteria 2075
440 Ga0207677_10000317 3300026023 Bacteria 35378
441 Ga0207677_10236952 3300026023 Bacteria 1474
442 Ga0207677_10335334 3300026023 Bacteria 1262
443 Ga0207703_10000974 3300026035 Bacteria 27552
444 Ga0207703_10006783 3300026035 Bacteria 9127
445 Ga0207703_10009090 3300026035 Bacteria 7822
446 Ga0207703_10057481 3300026035 Bacteria 3172
447 Ga0207639_10001542 3300026041 Bacteria 15463
448 Ga0207639_10231492 3300026041 Bacteria 1602
449 Ga0207639_10262778 3300026041 Bacteria 1510
450 Ga0207678_10000079 3300026067 Bacteria 78764
451 Ga0207678_10000487 3300026067 Bacteria 35968
452 Ga0207678_10010495 3300026067 Bacteria 8136
453 Ga0207678_10050109 3300026067 Bacteria 3608
454 Ga0207678_10769227 3300026067 Bacteria 849
455 Ga0207702_10001332 3300026078 Bacteria 24705
456 Ga0207702_10337007 3300026078 Bacteria 1440
457 Ga0207641_10000041 3300026088 Bacteria 191595
458 Ga0207641_10000050 3300026088 Bacteria 175954
459 Ga0207641_10000545 3300026088 Bacteria 42249
460 Ga0207641_10007111 3300026088 Bacteria 9349
461 Ga0207641_10033746 3300026088 Bacteria 4252
462 Ga0207641_10100056 3300026088 Bacteria 2552
463 Ga0207641_10228784 3300026088 Bacteria 1727
464 Ga0207641_10245420 3300026088 Bacteria 1670
465 Ga0207648_10029444 3300026089 Bacteria 4869
466 Ga0207648_10247331 3300026089 Bacteria 1589
467 Ga0207676_10000039 3300026095 Bacteria 171142
468 Ga0207676_10001160 3300026095 Bacteria 19812
469 Ga0207676_10001198 3300026095 Bacteria 19470
470 Ga0207676_10001939 3300026095 Bacteria 15104
471 Ga0207676_10012289 3300026095 Bacteria 6129
472 Ga0207674_10002967 3300026116 Bacteria 21070
473 Ga0207674_10014537 3300026116 Bacteria 8691
474 Ga0207674_10019266 3300026116 Bacteria 7396
475 Ga0207674_10031369 3300026116 Bacteria 5584
476 Ga0207674_10042124 3300026116 Bacteria 4719
477 Ga0207674_10329837 3300026116 Bacteria 1476
478 Ga0207675_100000041 3300026118 Bacteria 90476
479 Ga0207675_100001141 3300026118 Bacteria 26317
480 Ga0207675_100022883 3300026118 Bacteria 5813
481 Ga0207675_100104868 3300026118 Bacteria 2664
482 Ga0207698_10020773 3300026142 Bacteria 4526
483 Ga0207698_10417051 3300026142 Bacteria 1287
484 Ga0209371_1016952 3300027312 Bacteria 1903
485 Ga0209984_1017895 3300027424 Bacteria 954
486 Ga0209813_10000033 3300027866 Bacteria 61945
487 Ga0209974_10017606 3300027876 Bacteria 2369
488 Ga0207428_10041256 3300027907 Bacteria 3737
489 Ga0207428_10380124 3300027907 Bacteria 1036
490 Ga0268266_10000171 3300028379 Bacteria 118317
491 Ga0268266_10038807 3300028379 Bacteria 4054
492 Ga0268266_10116312 3300028379 Bacteria 2375
493 Ga0268265_10000043 3300028380 Bacteria 186081
494 Ga0268265_10000061 3300028380 Bacteria 148625
495 Ga0268265_10000162 3300028380 Bacteria 81713
496 Ga0268265_10001829 3300028380 Bacteria 16980
497 Ga0268265_10031292 3300028380 Bacteria 3842
498 Ga0268265_10051589 3300028380 Bacteria 3105
499 Ga0268265_10120734 3300028380 Bacteria 2158
500 Ga0268265_10152024 3300028380 Bacteria 1953
501 Ga0268265_10393094 3300028380 Bacteria 1279
502 Ga0268264_10000121 3300028381 Bacteria 190368
503 Ga0268264_10000154 3300028381 Bacteria 156992
504 Ga0268264_10001121 3300028381 Bacteria 26366
505 Ga0268264_10002411 3300028381 Bacteria 16456
506 Ga0268264_10005031 3300028381 Bacteria 11184
507 Ga0268264_10203364 3300028381 Bacteria 1813
508 Ga0268264_10331890 3300028381 Bacteria 1441
509 Ga0307517_10299091 3300028786 Bacteria 904
510 Ga0307513_10064765 3300031456 Bacteria 3849
511 Ga0307513_10489333 3300031456 Bacteria 949
512 Ga0307408_100014219 3300031548 Bacteria 5287
513 Ga0307408_100016941 3300031548 Bacteria 4871
514 Ga0307410_10009509 3300031852 Bacteria 5454
515 Ga0307410_10081926 3300031852 Bacteria 2268
516 Ga0307410_10165176 3300031852 Bacteria 1663
517 Ga0307406_10029153 3300031901 Bacteria 3341
518 Ga0307406_10049021 3300031901 Bacteria 2671
519 Ga0307406_10200758 3300031901 Bacteria 1467
520 Ga0307407_10731479 3300031903 Bacteria 748
521 Ga0307412_10138085 3300031911 Bacteria 1781
522 Ga0307412_10149265 3300031911 Bacteria 1722
523 Ga0307412_10198588 3300031911 Bacteria 1521
524 Ga0307412_10221242 3300031911 Bacteria 1451
525 Ga0307412_10481380 3300031911 Bacteria 1029
526 Ga0307409_100010756 3300031995 Bacteria 5715
527 Ga0307409_100150664 3300031995 Bacteria 2018
528 Ga0307409_100227934 3300031995 Bacteria 1687
529 Ga0307416_100031382 3300032002 Bacteria 3999
530 Ga0307416_100960420 3300032002 Bacteria 957
531 Ga0307414_10000526 3300032004 Bacteria 19940
532 Ga0307414_10008741 3300032004 Bacteria 5772
533 Ga0307414_10009185 3300032004 Bacteria 5664
534 Ga0307414_10368995 3300032004 Bacteria 1237
535 Ga0307414_10423179 3300032004 Bacteria 1162
536 Ga0307411_10432969 3300032005 Bacteria 1096
537 Ga0307415_100095893 3300032126 Bacteria 2161
538 Ga0307415_100237248 3300032126 Bacteria 1473
539 Ga0307510_10007749 3300033180 Bacteria 12806
540 Ga0395899_0205000 3300037312 Bacteria 1373
541 Ga0395899_0218316 3300037312 Bacteria 1322
542 Ga0395899_0375388 3300037312 Bacteria 946
543 Ga0395900_0431843 3300037418 Bacteria 1276
544 Ga0395900_0734985 3300037418 Bacteria 918
545 Ga0395900_0957267 3300037418 Bacteria 777
546 Ga0395905_0097211 3300037471 Bacteria 2764
547 Ga0395905_0169267 3300037471 Bacteria 2052
548 Ga0395905_0226337 3300037471 Bacteria 1749
549 Ga0395905_0236268 3300037471 Bacteria 1708
550 Ga0395905_0256023 3300037471 Bacteria 1635
551 Ga0395905_0335021 3300037471 Bacteria 1404
552 Ga0436364_1246610 3300037853 Bacteria 2209
553 Ga0436364_1327079 3300037853 Bacteria 11250
554 Ga0395901_0098696 3300038443 Bacteria 3062
555 Ga0395901_0197552 3300038443 Bacteria 2109
556 Ga0395901_0288582 3300038443 Bacteria 1703
557 Ga0395901_0379827 3300038443 Bacteria 1454
558 Ga0395901_0468390 3300038443 Bacteria 1286
559 Ga0237819_01234 3300038705 Bacteria 7076
560 Ga0237816_00146 3300039145 Bacteria 5561
561 Ga0436365_0448892 3300039437 Bacteria 728
562 Ga0436365_0694182 3300039437 Bacteria 1885
563 Ga0436365_1006646 3300039437 Bacteria 1466
564 Ga0436365_1526847 3300039437 Bacteria 2484
565 Ga0495638_0073074 3300046460 Bacteria 2094
566 Ga0495584_0135094 3300046491 Bacteria 1252
567 Ga0495596_0122534 3300046500 Bacteria 1009
568 Ga0495583_0022192 3300046506 Bacteria 3246
569 Ga0495632_0000149 3300046519 Bacteria 72208
570 Ga0495637_0000292 3300046520 Bacteria 38995
571 Ga0495637_0081728 3300046520 Bacteria 1287
572 Ga0495643_0000046 3300046522 Bacteria 220912
573 Ga0495643_0087679 3300046522 Bacteria 1610
574 Ga0495643_0221962 3300046522 Bacteria 896
575 Ga0495648_0004854 3300046524 Bacteria 11350
576 Ga0495648_0069933 3300046524 Bacteria 2041
577 Ga0495663_0000027 3300046525 Bacteria 89947
578 Ga0495663_0009781 3300046525 Bacteria 2661
579 Ga0495642_0092360 3300046528 Bacteria 1282
580 Ga0495621_0013465 3300046539 Bacteria 2571
581 Ga0495621_0018098 3300046539 Bacteria 2284
582 Ga0495621_0045123 3300046539 Bacteria 1560
583 Ga0495597_0023154 3300046542 Bacteria 2875
584 Ga0495633_0000054 3300046558 Bacteria 151646
585 Ga0495633_0001284 3300046558 Bacteria 19912
586 Ga0495633_0185960 3300046558 Bacteria 956
587 Ga0495633_0228021 3300046558 Bacteria 852
588 Ga0495668_0000002 3300046616 Bacteria 763179
589 Ga0495668_0011306 3300046616 Bacteria 5354
590 Ga0495668_0013395 3300046616 Bacteria 4838
591 Ga0495668_0039091 3300046616 Bacteria 2649
592 Ga0495625_0000430 3300046660 Bacteria 63143
593 Ga0495625_0028039 3300046660 Bacteria 4227
594 Ga0495625_0028243 3300046660 Bacteria 4209
595 Ga0495625_0042676 3300046660 Bacteria 3294
596 Ga0495588_0001577 3300046674 Bacteria 9748
597 Ga0495669_0000559 3300046684 Bacteria 16484
598 Ga0495669_0020240 3300046684 Bacteria 2878
599 Ga0495669_0145714 3300046684 Bacteria 1119
600 Ga0495671_0000029 3300046692 Bacteria 220912
601 Ga0495671_0038954 3300046692 Bacteria 2401
602 Ga0495687_000109 3300047443 Bacteria 125648
603 Ga0495677_0002453 3300047445 Bacteria 7286
604 Ga0495677_0002522 3300047445 Bacteria 7164
605 Ga0495673_0018930 3300047469 Bacteria 3461
606 Ga0495681_0001599 3300047470 Bacteria 16838
607 Ga0495681_0001980 3300047470 Bacteria 14965
608 Ga0495686_0000834 3300047472 Bacteria 39641
609 Ga0495686_0009162 3300047472 Bacteria 7166
610 Ga0495686_0134115 3300047472 Bacteria 1466
611 Ga0495615_0003147 3300048090 Bacteria 2737
612 Ga0496101_0534452 3300048904 Bacteria 927
613 Ga0496103_0221582 3300048906 Bacteria 1217
614 Ga0496108_0425600 3300048911 Bacteria 1160
615 Ga0496109_0279750 3300048912 Bacteria 1573
616 Ga0496110_0040358 3300048913 Bacteria 4068
617 Ga0496111_0038087 3300048914 Bacteria 3444
618 Ga0496111_0165946 3300048914 Bacteria 1640
619 Ga0496116_0030132 3300048919 Bacteria 3903
620 Ga0496117_0007511 3300048920 Bacteria 10630
621 Ga0496117_0020388 3300048920 Bacteria 5405
622 Ga0496118_0006582 3300048921 Bacteria 12689
623 Ga0496118_0011622 3300048921 Bacteria 8563
624 Ga0496118_0034473 3300048921 Bacteria 4129
625 Ga0496119_0164085 3300048922 Bacteria 1178
626 Ga0496121_0001042 3300048924 Bacteria 49414
627 Ga0496121_0001342 3300048924 Bacteria 42142
628 Ga0496121_0009334 3300048924 Bacteria 11310
629 Ga0496121_0018140 3300048924 Bacteria 7119
630 Ga0496121_0018792 3300048924 Bacteria 6944
631 Ga0496122_0044380 3300048925 Bacteria 3470
632 Ga0496123_0066831 3300048926 Bacteria 2275
633 Ga0496124_0020554 3300048927 Bacteria 6096
634 Ga0496124_0022868 3300048927 Bacteria 5723
635 Ga0496125_0006572 3300048928 Bacteria 12529
636 Ga0496125_0011958 3300048928 Bacteria 8644
637 Ga0496126_0001140 3300048929 Bacteria 44190
638 Ga0496126_0010396 3300048929 Bacteria 9760
639 Ga0496126_0151434 3300048929 Bacteria 1988
640 Ga0496126_0292369 3300048929 Bacteria 1347
641 Ga0496126_0307426 3300048929 Bacteria 1306
642 Ga0501033_0272032 3300049570 Bacteria 1197
643 Ga0501033_0288556 3300049570 Bacteria 1157
644 Ga0501034_0242461 3300049571 Bacteria 1748
645 Ga0501038_0073474 3300049574 Bacteria 2896
646 Ga0501043_0333457 3300049579 Bacteria 1155
647 Ga0501047_0000976 3300049581 Bacteria 28788
648 Ga0501047_0136029 3300049581 Bacteria 2338
649 Ga0501047_0289415 3300049581 Bacteria 1482
650 Ga0501047_0482037 3300049581 Bacteria 1068
651 Ga0501048_0033006 3300049582 Bacteria 3741
652 Ga0501069_0011202 3300049585 Bacteria 4757
653 Ga0501070_0046748 3300049586 Bacteria 3599
654 Ga0501070_0132796 3300049586 Bacteria 2056
655 Ga0501073_0288481 3300049589 Bacteria 1132
656 Ga0501249_001316 3300049679 Bacteria 5169
657 Ga0501080_0724356 3300049742 Bacteria 876
658 Ga0501035_0085938 3300049822 Bacteria 2772
659 Ga0501044_0182393 3300049823 Bacteria 2065
660 Ga0501044_0939811 3300049823 Bacteria 738
661 Ga0501204_003357 3300049850 Bacteria 1677
662 nmdc:mga00v17_8194_c1 3300050491 Bacteria 5616
663 nmdc:mga06z11_67_c1 3300050494 Bacteria 42818
664 nmdc:mga04h51_55_c1 3300050495 Bacteria 36672
665 nmdc:mga07m45_148388_c1 3300050496 Bacteria 1359
666 nmdc:mga07m45_193634_c1 3300050496 Bacteria 1182
667 nmdc:mga07m45_46981_c1 3300050496 Bacteria 2426
668 nmdc:mga08y16_187160_c1 3300050511 Bacteria 2148
669 nmdc:mga0n895_79968_c1 3300050512 Bacteria 3256
670 nmdc:mga0rr50_488788_c1 3300050513 Bacteria 1046
671 nmdc:mga0a205_63805_c1 3300050515 Bacteria 3558
672 nmdc:mga0sz30_19396_c1 3300050516 Bacteria 2734
673 Ga0500643_001652 3300053087 Bacteria 12426
674 Ga0500643_008089 3300053087 Bacteria 4165
675 Ga0500643_011361 3300053087 Bacteria 3252
676 Ga0500647_0140591 3300053091 Bacteria 1133
677 Ga0500583_0260929 3300053092 Bacteria 854
678 Ga0500651_0012624 3300053093 Bacteria 5124
679 Ga0500641_0029203 3300053096 Bacteria 2159
680 Ga0500560_000120 3300053107 Bacteria 8276
681 Ga0500592_011530 3300053116 Bacteria 1414
682 Ga0500594_0057756 3300053118 Bacteria 1110
683 Ga0500608_000764 3300053122 Bacteria 11718
684 Ga0500618_007082 3300053125 Bacteria 3230
685 Ga0500642_0001618 3300053130 Bacteria 6494
686 Ga0500655_000099 3300053133 Bacteria 22591
687 Ga0500658_0041146 3300053134 Bacteria 1853
688 Ga0500559_0009516 3300053136 Bacteria 4199
689 Ga0500559_0022995 3300053136 Bacteria 2645
690 Ga0500568_0002453 3300053139 Bacteria 10903
691 Ga0500577_0034132 3300053142 Bacteria 1804
692 Ga0500590_003333 3300053148 Bacteria 7379
693 Ga0500604_0100783 3300053151 Bacteria 952
694 Ga0500622_0003263 3300053156 Bacteria 11009
695 Ga0500639_072633 3300053163 Bacteria 1750
696 Ga0500636_0052440 3300053177 Bacteria 2396
697 Ga0500552_038175 3300053733 Bacteria 771
698 Ga0500587_002251 3300053739 Bacteria 2750

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050495 nmdc:mga04h51_55_c1 nmdc:mga04h51_55_c1_36122_36643 168
2 3300050496 nmdc:mga07m45_193634_c1 nmdc:mga07m45_193634_c1_424_1143 175
3 3300005356 Ga0070674_100142313 Ga0070674_1001423132 176
4 3300005548 Ga0070665_100162807 Ga0070665_1001628072 176
5 3300028379 Ga0268266_10116312 Ga0268266_101163122 176
6 3300003320 rootH2_10206796 rootH2_102067961 182
7 3300032004 Ga0307414_10368995 Ga0307414_103689952 183
8 3300046522 Ga0495643_0221962 Ga0495643_0221962_289_882 183
9 3300006058 Ga0075432_10000674 Ga0075432_100006747 185
10 3300027907 Ga0207428_10041256 Ga0207428_100412563 185
11 3300048924 Ga0496121_0001042 Ga0496121_0001042_10453_11094 185
12 3300005617 Ga0068859_100022219 Ga0068859_1000222197 186
13 3300005841 Ga0068863_100010763 Ga0068863_1000107637 186
14 3300006931 Ga0097620_100022219 Ga0097620_1000222192 186
15 3300021388 Ga0213875_10002279 Ga0213875_100022793 186
16 3300025903 Ga0207680_10043943 Ga0207680_100439432 186
17 3300025925 Ga0207650_10031130 Ga0207650_100311303 186
18 3300025931 Ga0207644_10000316 Ga0207644_1000031622 186
19 3300025972 Ga0207668_10000011 Ga0207668_10000011161 186
20 3300026088 Ga0207641_10007111 Ga0207641_100071114 186
21 3300028380 Ga0268265_10000162 Ga0268265_1000016212 186
22 3300037853 Ga0436364_1327079 Ga0436364_1327079_1707_2363 186
23 3300039437 Ga0436365_1526847 Ga0436365_1526847_1772_2428 186
24 3300005331 Ga0070670_100036985 Ga0070670_1000369854 187
25 3300005335 Ga0070666_10004770 Ga0070666_100047702 187
26 3300005347 Ga0070668_100000112 Ga0070668_1000001124 187
27 3300005353 Ga0070669_100049600 Ga0070669_1000496002 187
28 3300005367 Ga0070667_100000058 Ga0070667_10000005873 187
29 3300005438 Ga0070701_10126630 Ga0070701_101266301 187
30 3300005841 Ga0068863_100000031 Ga0068863_10000003174 187
31 3300005843 Ga0068860_100005214 Ga0068860_1000052149 187
32 3300005844 Ga0068862_100091969 Ga0068862_1000919691 187
33 3300009094 Ga0111539_10479863 Ga0111539_104798632 187
34 3300014326 Ga0157380_10463201 Ga0157380_104632012 187
35 3300025903 Ga0207680_10003667 Ga0207680_100036675 187
36 3300025923 Ga0207681_10031170 Ga0207681_100311703 187
37 3300025925 Ga0207650_10037426 Ga0207650_100374264 187
38 3300025972 Ga0207668_10000038 Ga0207668_1000003881 187
39 3300025986 Ga0207658_10000037 Ga0207658_1000003773 187
40 3300026088 Ga0207641_10000050 Ga0207641_1000005057 187
41 3300028380 Ga0268265_10031292 Ga0268265_100312923 187
42 3300028381 Ga0268264_10331890 Ga0268264_103318902 187
43 3300046539 Ga0495621_0013465 Ga0495621_0013465_951_1601 188
44 3300053134 Ga0500658_0041146 Ga0500658_0041146_798_1448 188
45 3300053151 Ga0500604_0100783 Ga0500604_0100783_254_907 188
46 3300005295 Ga0065707_10081805 Ga0065707_1008180530 189
47 3300014326 Ga0157380_10001987 Ga0157380_100019875 189
48 3300038705 Ga0237819_01234 Ga0237819_01234_3956_4600 189
49 3300039145 Ga0237816_00146 Ga0237816_00146_3321_3965 189
50 3300049581 Ga0501047_0136029 Ga0501047_0136029_570_1214 189
51 3300046616 Ga0495668_0011306 Ga0495668_0011306_3704_4360 190
52 3300053122 Ga0500608_000764 Ga0500608_000764_5687_6322 190
53 3300031456 Ga0307513_10064765 Ga0307513_100647652 191
54 3300046660 Ga0495625_0042676 Ga0495625_0042676_407_1045 191
55 3300047443 Ga0495687_000109 Ga0495687_000109_33308_33946 191
56 3300005337 Ga0070682_100023894 Ga0070682_1000238942 192
57 3300005577 Ga0068857_100089005 Ga0068857_1000890053 192
58 3300027312 Ga0209371_1016952 Ga0209371_10169521 192
59 3300046660 Ga0495625_0000430 Ga0495625_0000430_23541_24191 192
60 3300046674 Ga0495588_0001577 Ga0495588_0001577_5775_6407 192
61 3300047470 Ga0495681_0001980 Ga0495681_0001980_197_829 192
62 3300048929 Ga0496126_0001140 Ga0496126_0001140_2458_3090 192
63 3300053107 Ga0500560_000120 Ga0500560_000120_1936_2568 192
64 3300005336 Ga0070680_100004587 Ga0070680_10000458711 193
65 3300005458 Ga0070681_10092271 Ga0070681_100922712 193
66 3300005530 Ga0070679_100002379 Ga0070679_1000023791 193
67 3300005577 Ga0068857_100126576 Ga0068857_1001265763 193
68 3300025912 Ga0207707_10073708 Ga0207707_100737083 193
69 3300025917 Ga0207660_10003861 Ga0207660_100038612 193
70 3300025921 Ga0207652_10000008 Ga0207652_1000000878 193
71 3300026116 Ga0207674_10014537 Ga0207674_100145374 193
72 3300031456 Ga0307513_10489333 Ga0307513_104893331 193
73 3300049570 Ga0501033_0272032 Ga0501033_0272032_251_916 193
74 3300049579 Ga0501043_0333457 Ga0501043_0333457_308_973 193
75 3300049581 Ga0501047_0289415 Ga0501047_0289415_159_824 193
76 3300049586 Ga0501070_0132796 Ga0501070_0132796_1194_1859 193
77 3300049589 Ga0501073_0288481 Ga0501073_0288481_251_916 193
78 3300003781 Ga0055536_1005438 Ga0055536_10054383 194
79 3300003791 Ga0055530_10000092 Ga0055530_1000009226 194
80 3300003794 Ga0055531_10002266 Ga0055531_100022661 194
81 3300003794 Ga0055531_10003124 Ga0055531_100031244 194
82 3300005457 Ga0070662_100009237 Ga0070662_1000092375 194
83 3300005563 Ga0068855_100011310 Ga0068855_1000113105 194
84 3300006358 Ga0068871_100060613 Ga0068871_1000606132 194
85 3300011119 Ga0105246_10002637 Ga0105246_100026378 194
86 3300013308 Ga0157375_10617352 Ga0157375_106173522 194
87 3300025292 Ga0209676_1000133 Ga0209676_1000133171 194
88 3300025298 Ga0209050_1000067 Ga0209050_1000067165 194
89 3300025304 Ga0209257_1000132 Ga0209257_100013216 194
90 3300025942 Ga0207689_10468943 Ga0207689_104689432 194
91 3300025949 Ga0207667_10027762 Ga0207667_100277622 194
92 3300032004 Ga0307414_10423179 Ga0307414_104231792 194
93 3300005329 Ga0070683_100251284 Ga0070683_1002512842 195
94 3300005535 Ga0070684_100332375 Ga0070684_1003323752 195
95 3300013104 Ga0157370_10598150 Ga0157370_105981501 195
96 3300025944 Ga0207661_10449628 Ga0207661_104496281 195
97 3300028786 Ga0307517_10299091 Ga0307517_102990911 195
98 3300048911 Ga0496108_0425600 Ga0496108_0425600_437_1117 195
99 3300031911 Ga0307412_10221242 Ga0307412_102212423 196
100 3300032005 Ga0307411_10432969 Ga0307411_104329692 196
101 iso_pu_bacteria 2898795034 2898795840 196
102 3300005367 Ga0070667_100000710 Ga0070667_10000071022 197
103 3300005618 Ga0068864_100000041 Ga0068864_10000004112 197
104 3300005841 Ga0068863_100000035 Ga0068863_10000003512 197
105 3300005844 Ga0068862_100000042 Ga0068862_100000042164 197
106 3300009011 Ga0105251_10000180 Ga0105251_1000018012 197
107 3300009101 Ga0105247_10005830 Ga0105247_100058307 197
108 3300009177 Ga0105248_10000045 Ga0105248_1000004512 197
109 3300009553 Ga0105249_10000055 Ga0105249_10000055160 197
110 3300013306 Ga0163162_10058628 Ga0163162_100586284 197
111 3300013308 Ga0157375_10460611 Ga0157375_104606112 197
112 3300014325 Ga0163163_10169888 Ga0163163_101698882 197
113 3300014968 Ga0157379_10004695 Ga0157379_1000469511 197
114 3300025291 Ga0209675_1000366 Ga0209675_100036621 197
115 3300025294 Ga0209025_1007910 Ga0209025_10079105 197
116 3300025735 Ga0207713_1000939 Ga0207713_100093916 197
117 3300025900 Ga0207710_10002951 Ga0207710_100029514 197
118 3300025925 Ga0207650_10000238 Ga0207650_1000023812 197
119 3300025941 Ga0207711_10000027 Ga0207711_10000027226 197
120 3300025961 Ga0207712_10000262 Ga0207712_1000026211 197
121 3300025986 Ga0207658_10000362 Ga0207658_1000036235 197
122 3300026088 Ga0207641_10000041 Ga0207641_1000004111 197
123 3300026095 Ga0207676_10000039 Ga0207676_10000039166 197
124 3300028380 Ga0268265_10000061 Ga0268265_10000061141 197
125 3300031911 Ga0307412_10481380 Ga0307412_104813801 197
126 3300048920 Ga0496117_0007511 Ga0496117_0007511_4915_5574 197
127 3300048921 Ga0496118_0006582 Ga0496118_0006582_8831_9490 197
128 3300003781 Ga0055536_1001481 Ga0055536_10014819 198
129 3300005719 Ga0068861_100000282 Ga0068861_10000028225 198
130 3300025292 Ga0209676_1000187 Ga0209676_100018713 198
131 3300026118 Ga0207675_100000041 Ga0207675_10000004129 198
132 3300048929 Ga0496126_0151434 Ga0496126_0151434_1055_1708 198
133 3300005339 Ga0070660_100432910 Ga0070660_1004329101 199
134 3300005577 Ga0068857_100064807 Ga0068857_1000648073 199
135 3300009551 Ga0105238_10226677 Ga0105238_102266773 199
136 3300026116 Ga0207674_10031369 Ga0207674_100313695 199
137 3300031911 Ga0307412_10198588 Ga0307412_101985882 199
138 3300046460 Ga0495638_0073074 Ga0495638_0073074_1044_1700 199
139 3300046520 Ga0495637_0081728 Ga0495637_0081728_313_969 199
140 3300046522 Ga0495643_0087679 Ga0495643_0087679_334_990 199
141 3300046539 Ga0495621_0045123 Ga0495621_0045123_591_1247 199
142 3300046542 Ga0495597_0023154 Ga0495597_0023154_1839_2495 199
143 3300046558 Ga0495633_0228021 Ga0495633_0228021_57_713 199
144 3300046616 Ga0495668_0039091 Ga0495668_0039091_1637_2293 199
145 3300053091 Ga0500647_0140591 Ga0500647_0140591_26_682 199
146 3300053092 Ga0500583_0260929 Ga0500583_0260929_32_688 199
147 3300053093 Ga0500651_0012624 Ga0500651_0012624_3422_4078 199
148 3300053096 Ga0500641_0029203 Ga0500641_0029203_740_1396 199
149 3300053125 Ga0500618_007082 Ga0500618_007082_1928_2584 199
150 3300053130 Ga0500642_0001618 Ga0500642_0001618_2414_3070 199
151 3300053133 Ga0500655_000099 Ga0500655_000099_3453_4109 199
152 3300053142 Ga0500577_0034132 Ga0500577_0034132_701_1357 199
153 3300053148 Ga0500590_003333 Ga0500590_003333_1652_2308 199
154 3300053163 Ga0500639_072633 Ga0500639_072633_626_1282 199
155 3300053177 Ga0500636_0052440 Ga0500636_0052440_1098_1754 199
156 3300053733 Ga0500552_038175 Ga0500552_038175_40_696 199
157 iso_pu_bacteria 2775507255 2778125687 199
158 3300005616 Ga0068852_100120158 Ga0068852_1001201582 200
159 3300025303 Ga0209051_1014308 Ga0209051_10143083 200
160 3300026078 Ga0207702_10337007 Ga0207702_103370072 200
161 3300005338 Ga0068868_100000090 Ga0068868_10000009045 201
162 3300005339 Ga0070660_100001199 Ga0070660_1000011992 201
163 3300005366 Ga0070659_100000017 Ga0070659_10000001721 201
164 3300013308 Ga0157375_10308550 Ga0157375_103085504 201
165 3300025919 Ga0207657_10003138 Ga0207657_100031383 201
166 3300025932 Ga0207690_10000035 Ga0207690_1000003521 201
167 3300026023 Ga0207677_10000317 Ga0207677_1000031721 201
168 3300046500 Ga0495596_0122534 Ga0495596_0122534_27_677 201
169 iso_pu_bacteria 2512564014 2512642275 201
170 3300005336 Ga0070680_100269244 Ga0070680_1002692442 202
171 3300005339 Ga0070660_100007800 Ga0070660_1000078006 202
172 3300005344 Ga0070661_100025440 Ga0070661_1000254403 202
173 3300005455 Ga0070663_100110401 Ga0070663_1001104013 202
174 3300005457 Ga0070662_100077150 Ga0070662_1000771501 202
175 3300005457 Ga0070662_100195741 Ga0070662_1001957412 202
176 3300005530 Ga0070679_100041996 Ga0070679_1000419964 202
177 3300005530 Ga0070679_100079830 Ga0070679_1000798303 202
178 3300005530 Ga0070679_100279968 Ga0070679_1002799682 202
179 3300005539 Ga0068853_100172730 Ga0068853_1001727302 202
180 3300005544 Ga0070686_100000179 Ga0070686_10000017919 202
181 3300005548 Ga0070665_100000207 Ga0070665_100000207103 202
182 3300005834 Ga0068851_10161858 Ga0068851_101618582 202
183 3300006871 Ga0075434_100220874 Ga0075434_1002208742 202
184 3300009011 Ga0105251_10012298 Ga0105251_100122983 202
185 3300009098 Ga0105245_10547729 Ga0105245_105477292 202
186 3300009553 Ga0105249_10059373 Ga0105249_100593733 202
187 3300017792 Ga0163161_10022483 Ga0163161_100224834 202
188 3300025321 Ga0207656_10098746 Ga0207656_100987462 202
189 3300025735 Ga0207713_1014924 Ga0207713_10149243 202
190 3300025909 Ga0207705_10001485 Ga0207705_1000148511 202
191 3300025917 Ga0207660_10100600 Ga0207660_101006002 202
192 3300025919 Ga0207657_10009149 Ga0207657_100091494 202
193 3300025920 Ga0207649_10003198 Ga0207649_1000319810 202
194 3300025921 Ga0207652_10229839 Ga0207652_102298392 202
195 3300025932 Ga0207690_10120910 Ga0207690_101209102 202
196 3300025933 Ga0207706_10103828 Ga0207706_101038282 202
197 3300025933 Ga0207706_10291421 Ga0207706_102914212 202
198 3300025961 Ga0207712_10109591 Ga0207712_101095912 202
199 3300026041 Ga0207639_10262778 Ga0207639_102627782 202
200 3300026067 Ga0207678_10050109 Ga0207678_100501094 202
201 3300027424 Ga0209984_1017895 Ga0209984_10178952 202
202 3300027876 Ga0209974_10017606 Ga0209974_100176062 202
203 3300028379 Ga0268266_10000171 Ga0268266_10000171119 202
204 3300048912 Ga0496109_0279750 Ga0496109_0279750_275_901 202
205 3300048913 Ga0496110_0040358 Ga0496110_0040358_2387_3013 202
206 3300048914 Ga0496111_0038087 Ga0496111_0038087_1650_2276 202
207 3300048924 Ga0496121_0018792 Ga0496121_0018792_4663_5289 202
208 3300048925 Ga0496122_0044380 Ga0496122_0044380_1751_2377 202
209 3300048926 Ga0496123_0066831 Ga0496123_0066831_1367_1993 202
210 3300048927 Ga0496124_0020554 Ga0496124_0020554_3352_3978 202
211 3300048928 Ga0496125_0006572 Ga0496125_0006572_8679_9305 202
212 3300048929 Ga0496126_0307426 Ga0496126_0307426_631_1257 202
213 3300049574 Ga0501038_0073474 Ga0501038_0073474_1229_1858 202
214 3300050512 nmdc:mga0n895_79968_c1 nmdc:mga0n895_79968_c1_106_747 202
215 iso_pu_bacteria 2643221563 2643833040 202
216 iso_pu_bacteria 2643221608 2644053165 202
217 3300005328 Ga0070676_10043173 Ga0070676_100431731 203
218 3300005366 Ga0070659_100107204 Ga0070659_1001072042 203
219 3300005457 Ga0070662_100462248 Ga0070662_1004622482 203
220 3300005546 Ga0070696_100006865 Ga0070696_10000686510 203
221 3300005578 Ga0068854_100086016 Ga0068854_1000860163 203
222 3300013100 Ga0157373_10051195 Ga0157373_100511954 203
223 3300025907 Ga0207645_10025449 Ga0207645_100254493 203
224 3300025933 Ga0207706_10169249 Ga0207706_101692492 203
225 3300025972 Ga0207668_10573712 Ga0207668_105737122 203
226 3300025981 Ga0207640_10073602 Ga0207640_100736022 203
227 3300026089 Ga0207648_10247331 Ga0207648_102473312 203
228 3300031852 Ga0307410_10009509 Ga0307410_100095093 203
229 3300031901 Ga0307406_10029153 Ga0307406_100291532 203
230 3300031903 Ga0307407_10731479 Ga0307407_107314791 203
231 3300031911 Ga0307412_10138085 Ga0307412_101380852 203
232 3300031995 Ga0307409_100010756 Ga0307409_1000107565 203
233 3300046684 Ga0495669_0020240 Ga0495669_0020240_1414_2064 203
234 3300053739 Ga0500587_002251 Ga0500587_002251_40_684 203
235 3300001915 JGI24741J21665_1000810 JGI24741J21665_10008105 204
236 3300001979 JGI24740J21852_10059086 JGI24740J21852_100590862 204
237 3300002067 JGI24735J21928_10000764 JGI24735J21928_100007648 204
238 3300005327 Ga0070658_10037754 Ga0070658_100377543 204
239 3300005329 Ga0070683_100605363 Ga0070683_1006053631 204
240 3300005339 Ga0070660_100134541 Ga0070660_1001345412 204
241 3300005366 Ga0070659_100050509 Ga0070659_1000505092 204
242 3300005455 Ga0070663_100006853 Ga0070663_1000068535 204
243 3300005564 Ga0070664_100117579 Ga0070664_1001175792 204
244 3300005614 Ga0068856_100005769 Ga0068856_1000057695 204
245 3300005719 Ga0068861_100211253 Ga0068861_1002112532 204
246 3300006042 Ga0075368_10001383 Ga0075368_100013833 204
247 3300006178 Ga0075367_10002205 Ga0075367_100022057 204
248 3300006353 Ga0075370_10026878 Ga0075370_100268782 204
249 3300009093 Ga0105240_10738808 Ga0105240_107388082 204
250 3300009174 Ga0105241_10002299 Ga0105241_100022996 204
251 3300013100 Ga0157373_10070595 Ga0157373_100705954 204
252 3300013104 Ga0157370_10070441 Ga0157370_100704412 204
253 3300025321 Ga0207656_10057054 Ga0207656_100570542 204
254 3300025904 Ga0207647_10022931 Ga0207647_100229313 204
255 3300025913 Ga0207695_10023626 Ga0207695_100236261 204
256 3300025914 Ga0207671_10186288 Ga0207671_101862882 204
257 3300025919 Ga0207657_10002188 Ga0207657_100021886 204
258 3300025924 Ga0207694_10015661 Ga0207694_100156614 204
259 3300025933 Ga0207706_10086680 Ga0207706_100866804 204
260 3300025940 Ga0207691_10485005 Ga0207691_104850052 204
261 3300025949 Ga0207667_10117138 Ga0207667_101171382 204
262 3300025981 Ga0207640_10161070 Ga0207640_101610702 204
263 3300026041 Ga0207639_10001542 Ga0207639_100015429 204
264 3300026067 Ga0207678_10000079 Ga0207678_1000007967 204
265 3300026078 Ga0207702_10001332 Ga0207702_100013328 204
266 3300026116 Ga0207674_10042124 Ga0207674_100421243 204
267 3300026142 Ga0207698_10020773 Ga0207698_100207732 204
268 3300027866 Ga0209813_10000033 Ga0209813_1000003313 204
269 3300031548 Ga0307408_100016941 Ga0307408_1000169413 204
270 3300031852 Ga0307410_10081926 Ga0307410_100819262 204
271 3300031852 Ga0307410_10165176 Ga0307410_101651761 204
272 3300031901 Ga0307406_10200758 Ga0307406_102007581 204
273 3300031911 Ga0307412_10149265 Ga0307412_101492652 204
274 3300031995 Ga0307409_100150664 Ga0307409_1001506642 204
275 3300032002 Ga0307416_100031382 Ga0307416_1000313823 204
276 3300037418 Ga0395900_0431843 Ga0395900_0431843_23_637 204
277 3300046491 Ga0495584_0135094 Ga0495584_0135094_261_893 204
278 3300046519 Ga0495632_0000149 Ga0495632_0000149_17579_18211 204
279 3300046520 Ga0495637_0000292 Ga0495637_0000292_22965_23597 204
280 3300046522 Ga0495643_0000046 Ga0495643_0000046_22965_23597 204
281 3300046524 Ga0495648_0004854 Ga0495648_0004854_9546_10178 204
282 3300046525 Ga0495663_0000027 Ga0495663_0000027_17579_18211 204
283 3300046558 Ga0495633_0001284 Ga0495633_0001284_17579_18211 204
284 3300046558 Ga0495633_0185960 Ga0495633_0185960_285_920 204
285 3300046692 Ga0495671_0000029 Ga0495671_0000029_197316_197948 204
286 3300046692 Ga0495671_0038954 Ga0495671_0038954_1571_2206 204
287 3300047470 Ga0495681_0001599 Ga0495681_0001599_9824_10456 204
288 3300047472 Ga0495686_0134115 Ga0495686_0134115_244_876 204
289 3300050494 nmdc:mga06z11_67_c1 nmdc:mga06z11_67_c1_6045_6680 204
290 3300050496 nmdc:mga07m45_46981_c1 nmdc:mga07m45_46981_c1_1171_1806 204
291 3300053087 Ga0500643_008089 Ga0500643_008089_880_1536 204
292 3300053116 Ga0500592_011530 Ga0500592_011530_277_927 204
293 3300053118 Ga0500594_0057756 Ga0500594_0057756_12_647 204
294 iso_pu_bacteria 2643221541 2643728431 204
295 iso_pu_bacteria 2643221606 2644042393 204
296 iso_pu_bacteria 2643221671 2644392031 204
297 iso_pu_bacteria 2852653556 2852654209 204
298 3300001976 JGI24752J21851_1006200 JGI24752J21851_10062002 205
299 3300003781 Ga0055536_1000943 Ga0055536_100094320 205
300 3300003794 Ga0055531_10006170 Ga0055531_100061706 205
301 3300005327 Ga0070658_10401929 Ga0070658_104019292 205
302 3300005331 Ga0070670_100000586 Ga0070670_10000058639 205
303 3300005335 Ga0070666_10000908 Ga0070666_1000090813 205
304 3300005347 Ga0070668_100093379 Ga0070668_1000933792 205
305 3300005353 Ga0070669_100000113 Ga0070669_10000011385 205
306 3300005355 Ga0070671_100000038 Ga0070671_1000000387 205
307 3300005440 Ga0070705_100039054 Ga0070705_1000390542 205
308 3300005548 Ga0070665_100094918 Ga0070665_1000949182 205
309 3300005617 Ga0068859_100000085 Ga0068859_10000008522 205
310 3300005841 Ga0068863_100098058 Ga0068863_1000980582 205
311 3300005843 Ga0068860_100031421 Ga0068860_1000314214 205
312 3300005844 Ga0068862_100001040 Ga0068862_10000104023 205
313 3300006931 Ga0097620_100000085 Ga0097620_10000008522 205
314 3300009101 Ga0105247_10010754 Ga0105247_100107542 205
315 3300009177 Ga0105248_10080237 Ga0105248_100802373 205
316 3300009553 Ga0105249_10022022 Ga0105249_100220223 205
317 3300014968 Ga0157379_10014954 Ga0157379_100149542 205
318 3300017792 Ga0163161_10292968 Ga0163161_102929682 205
319 3300025292 Ga0209676_1000081 Ga0209676_1000081241 205
320 3300025298 Ga0209050_1011468 Ga0209050_10114683 205
321 3300025304 Ga0209257_1000359 Ga0209257_100035948 205
322 3300025315 Ga0207697_10002053 Ga0207697_100020537 205
323 3300025900 Ga0207710_10004160 Ga0207710_100041602 205
324 3300025903 Ga0207680_10000082 Ga0207680_100000827 205
325 3300025923 Ga0207681_10000042 Ga0207681_1000004282 205
326 3300025925 Ga0207650_10020631 Ga0207650_100206313 205
327 3300025931 Ga0207644_10000071 Ga0207644_100000717 205
328 3300025961 Ga0207712_10009082 Ga0207712_100090823 205
329 3300025972 Ga0207668_10000194 Ga0207668_1000019429 205
330 3300025986 Ga0207658_10008451 Ga0207658_100084516 205
331 3300026088 Ga0207641_10033746 Ga0207641_100337464 205
332 3300026095 Ga0207676_10001160 Ga0207676_100011602 205
333 3300026118 Ga0207675_100001141 Ga0207675_10000114122 205
334 3300028380 Ga0268265_10000043 Ga0268265_10000043123 205
335 3300028381 Ga0268264_10000154 Ga0268264_1000015481 205
336 3300037853 Ga0436364_1246610 Ga0436364_1246610_438_1088 205
337 3300048906 Ga0496103_0221582 Ga0496103_0221582_205_849 205
338 3300053087 Ga0500643_011361 Ga0500643_011361_1103_1741 205
339 3300053139 Ga0500568_0002453 Ga0500568_0002453_9696_10328 205
340 iso_pu_bacteria 2830075706 2830077251 205
341 3300003316 rootH1_10025996 rootH1_100259962 206
342 3300003322 rootL2_10112214 rootL2_101122144 206
343 3300005344 Ga0070661_100096755 Ga0070661_1000967551 206
344 3300005353 Ga0070669_100022511 Ga0070669_1000225114 206
345 3300005354 Ga0070675_100210104 Ga0070675_1002101042 206
346 3300005455 Ga0070663_100128922 Ga0070663_1001289223 206
347 3300005564 Ga0070664_100066308 Ga0070664_1000663084 206
348 3300005577 Ga0068857_100007442 Ga0068857_1000074424 206
349 3300005617 Ga0068859_100018076 Ga0068859_1000180765 206
350 3300005617 Ga0068859_100037442 Ga0068859_1000374424 206
351 3300005618 Ga0068864_100000352 Ga0068864_10000035238 206
352 3300005841 Ga0068863_100016737 Ga0068863_1000167373 206
353 3300005842 Ga0068858_100000444 Ga0068858_10000044410 206
354 3300005842 Ga0068858_100054018 Ga0068858_1000540183 206
355 3300006931 Ga0097620_100018077 Ga0097620_1000180773 206
356 3300006931 Ga0097620_100037440 Ga0097620_1000374404 206
357 3300009177 Ga0105248_10000296 Ga0105248_1000029659 206
358 3300009177 Ga0105248_10010024 Ga0105248_100100243 206
359 3300009553 Ga0105249_10196155 Ga0105249_101961552 206
360 3300009553 Ga0105249_10749480 Ga0105249_107494801 206
361 3300009553 Ga0105249_11160037 Ga0105249_111600371 206
362 3300011119 Ga0105246_10055468 Ga0105246_100554682 206
363 3300013306 Ga0163162_10003520 Ga0163162_100035207 206
364 3300025315 Ga0207697_10006670 Ga0207697_100066702 206
365 3300025918 Ga0207662_10226556 Ga0207662_102265562 206
366 3300025923 Ga0207681_10020048 Ga0207681_100200483 206
367 3300025935 Ga0207709_10410467 Ga0207709_104104672 206
368 3300025936 Ga0207670_10086186 Ga0207670_100861862 206
369 3300025941 Ga0207711_10000251 Ga0207711_1000025156 206
370 3300025941 Ga0207711_10005768 Ga0207711_1000576814 206
371 3300025945 Ga0207679_10429798 Ga0207679_104297982 206
372 3300025960 Ga0207651_10118780 Ga0207651_101187803 206
373 3300026035 Ga0207703_10057481 Ga0207703_100574814 206
374 3300026067 Ga0207678_10010495 Ga0207678_1001049512 206
375 3300026088 Ga0207641_10245420 Ga0207641_102454202 206
376 3300026095 Ga0207676_10001198 Ga0207676_1000119810 206
377 3300026095 Ga0207676_10012289 Ga0207676_100122895 206
378 3300026116 Ga0207674_10019266 Ga0207674_100192665 206
379 3300026118 Ga0207675_100104868 Ga0207675_1001048684 206
380 3300028380 Ga0268265_10051589 Ga0268265_100515894 206
381 3300028381 Ga0268264_10203364 Ga0268264_102033642 206
382 3300048929 Ga0496126_0292369 Ga0496126_0292369_667_1314 206
383 iso_pu_bacteria 2643221605 2644039446 206
384 3300005543 Ga0070672_100020073 Ga0070672_1000200735 207
385 3300005563 Ga0068855_100023513 Ga0068855_1000235132 207
386 3300005616 Ga0068852_100045264 Ga0068852_1000452644 207
387 3300005617 Ga0068859_100866421 Ga0068859_1008664212 207
388 3300005843 Ga0068860_100004766 Ga0068860_1000047668 207
389 3300006931 Ga0097620_100866482 Ga0097620_1008664821 207
390 3300007076 Ga0075435_100141620 Ga0075435_1001416203 207
391 3300013306 Ga0163162_10099028 Ga0163162_100990282 207
392 3300013307 Ga0157372_10975682 Ga0157372_109756821 207
393 3300025904 Ga0207647_10000297 Ga0207647_1000029736 207
394 3300025919 Ga0207657_10014090 Ga0207657_100140905 207
395 3300025932 Ga0207690_10006633 Ga0207690_100066331 207
396 3300025933 Ga0207706_10001755 Ga0207706_1000175524 207
397 3300025949 Ga0207667_10019183 Ga0207667_100191835 207
398 3300025961 Ga0207712_10000373 Ga0207712_1000037343 207
399 3300028381 Ga0268264_10001121 Ga0268264_100011217 207
400 3300032126 Ga0307415_100237248 Ga0307415_1002372482 207
401 3300038443 Ga0395901_0288582 Ga0395901_0288582_1005_1643 207
402 3300038443 Ga0395901_0379827 Ga0395901_0379827_489_1127 207
403 3300039437 Ga0436365_1006646 Ga0436365_1006646_88_729 207
404 3300046506 Ga0495583_0022192 Ga0495583_0022192_261_899 207
405 3300046524 Ga0495648_0069933 Ga0495648_0069933_270_908 207
406 3300046539 Ga0495621_0018098 Ga0495621_0018098_1166_1828 207
407 3300046558 Ga0495633_0000054 Ga0495633_0000054_44276_44932 207
408 3300046616 Ga0495668_0013395 Ga0495668_0013395_2606_3244 207
409 3300046660 Ga0495625_0028243 Ga0495625_0028243_1040_1678 207
410 3300047445 Ga0495677_0002522 Ga0495677_0002522_4785_5423 207
411 3300047472 Ga0495686_0009162 Ga0495686_0009162_3349_4002 207
412 3300048090 Ga0495615_0003147 Ga0495615_0003147_380_1042 207
413 3300048919 Ga0496116_0030132 Ga0496116_0030132_1654_2298 207
414 3300048921 Ga0496118_0034473 Ga0496118_0034473_2181_2825 207
415 3300048922 Ga0496119_0164085 Ga0496119_0164085_411_1055 207
416 3300048927 Ga0496124_0022868 Ga0496124_0022868_4586_5230 207
417 3300049571 Ga0501034_0242461 Ga0501034_0242461_962_1603 207
418 3300049581 Ga0501047_0482037 Ga0501047_0482037_200_841 207
419 3300049585 Ga0501069_0011202 Ga0501069_0011202_149_790 207
420 3300049586 Ga0501070_0046748 Ga0501070_0046748_615_1256 207
421 3300053136 Ga0500559_0022995 Ga0500559_0022995_28_666 207
422 iso_pu_bacteria 2582581305 2585261341 207
423 iso_pu_bacteria 2643221560 2643822230 207
424 iso_pu_bacteria 2643221588 2643951440 207
425 3300003322 rootL2_10096988 rootL2_100969882 208
426 3300005719 Ga0068861_100836461 Ga0068861_1008364611 208
427 3300026118 Ga0207675_100022883 Ga0207675_1000228837 208
428 3300032004 Ga0307414_10000526 Ga0307414_1000052611 208
429 3300033180 Ga0307510_10007749 Ga0307510_100077494 208
430 3300049581 Ga0501047_0000976 Ga0501047_0000976_9913_10557 208
431 3300049582 Ga0501048_0033006 Ga0501048_0033006_110_754 208
432 3300049822 Ga0501035_0085938 Ga0501035_0085938_59_703 208
433 3300049823 Ga0501044_0939811 Ga0501044_0939811_78_722 208
434 3300053087 Ga0500643_001652 Ga0500643_001652_2474_3115 208
435 3300005331 Ga0070670_100001053 Ga0070670_10000105320 209
436 3300005335 Ga0070666_10077145 Ga0070666_100771451 209
437 3300005347 Ga0070668_100000056 Ga0070668_10000005611 209
438 3300005353 Ga0070669_100583389 Ga0070669_1005833891 209
439 3300005355 Ga0070671_100000601 Ga0070671_10000060123 209
440 3300005367 Ga0070667_100000215 Ga0070667_1000002157 209
441 3300005367 Ga0070667_100005459 Ga0070667_1000054599 209
442 3300005618 Ga0068864_100002862 Ga0068864_1000028629 209
443 3300005841 Ga0068863_100007196 Ga0068863_1000071967 209
444 3300005842 Ga0068858_100082600 Ga0068858_1000826004 209
445 3300005843 Ga0068860_100000049 Ga0068860_10000004958 209
446 3300005843 Ga0068860_100007900 Ga0068860_1000079009 209
447 3300005844 Ga0068862_100003039 Ga0068862_10000303918 209
448 3300006051 Ga0075364_10025101 Ga0075364_100251012 209
449 3300006353 Ga0075370_10058548 Ga0075370_100585482 209
450 3300009177 Ga0105248_10230124 Ga0105248_102301244 209
451 3300014326 Ga0157380_10415209 Ga0157380_104152092 209
452 3300025903 Ga0207680_10011910 Ga0207680_100119104 209
453 3300025923 Ga0207681_10583643 Ga0207681_105836432 209
454 3300025925 Ga0207650_10273210 Ga0207650_102732103 209
455 3300025986 Ga0207658_10000014 Ga0207658_1000001466 209
456 3300025986 Ga0207658_10001094 Ga0207658_1000109424 209
457 3300026035 Ga0207703_10006783 Ga0207703_1000678311 209
458 3300026088 Ga0207641_10000545 Ga0207641_100005458 209
459 3300026088 Ga0207641_10100056 Ga0207641_101000561 209
460 3300026095 Ga0207676_10001939 Ga0207676_1000193910 209
461 3300028381 Ga0268264_10000121 Ga0268264_1000012146 209
462 3300028381 Ga0268264_10005031 Ga0268264_1000503110 209
463 3300039437 Ga0436365_0448892 Ga0436365_0448892_37_693 209
464 3300046660 Ga0495625_0028039 Ga0495625_0028039_3386_4054 209
465 3300048924 Ga0496121_0018140 Ga0496121_0018140_4553_5200 209
466 3300049679 Ga0501249_001316 Ga0501249_001316_2236_2892 209
467 3300049742 Ga0501080_0724356 Ga0501080_0724356_131_778 209
468 3300049850 Ga0501204_003357 Ga0501204_003357_476_1132 209
469 3300050491 nmdc:mga00v17_8194_c1 nmdc:mga00v17_8194_c1_1739_2413 209
470 3300050496 nmdc:mga07m45_148388_c1 nmdc:mga07m45_148388_c1_177_851 209
471 3300050516 nmdc:mga0sz30_19396_c1 nmdc:mga0sz30_19396_c1_1234_1908 209
472 3300053136 Ga0500559_0009516 Ga0500559_0009516_547_1224 209
473 3300053156 Ga0500622_0003263 Ga0500622_0003263_4878_5546 209
474 3300003187 JGI25151J46595_10019050 JGI25151J46595_100190503 210
475 3300005355 Ga0070671_100797283 Ga0070671_1007972831 210
476 3300005455 Ga0070663_100826306 Ga0070663_1008263061 210
477 3300005539 Ga0068853_100208611 Ga0068853_1002086112 210
478 3300005563 Ga0068855_100198967 Ga0068855_1001989673 210
479 3300009093 Ga0105240_10072933 Ga0105240_100729332 210
480 3300009093 Ga0105240_10074677 Ga0105240_100746774 210
481 3300009177 Ga0105248_10027704 Ga0105248_100277049 210
482 3300009545 Ga0105237_10004065 Ga0105237_1000406511 210
483 3300009545 Ga0105237_10488760 Ga0105237_104887602 210
484 3300010375 Ga0105239_10002689 Ga0105239_1000268911 210
485 3300013104 Ga0157370_10555801 Ga0157370_105558012 210
486 3300025294 Ga0209025_1000669 Ga0209025_100066930 210
487 3300025298 Ga0209050_1002482 Ga0209050_10024829 210
488 3300025304 Ga0209257_1043464 Ga0209257_10434642 210
489 3300025913 Ga0207695_10015828 Ga0207695_1001582810 210
490 3300025913 Ga0207695_10060858 Ga0207695_100608585 210
491 3300025914 Ga0207671_10001440 Ga0207671_1000144023 210
492 3300025931 Ga0207644_10382401 Ga0207644_103824011 210
493 3300025935 Ga0207709_10511494 Ga0207709_105114942 210
494 3300026067 Ga0207678_10769227 Ga0207678_107692272 210
495 3300026116 Ga0207674_10329837 Ga0207674_103298372 210
496 3300032004 Ga0307414_10008741 Ga0307414_100087413 210
497 3300032004 Ga0307414_10009185 Ga0307414_100091855 210
498 3300037471 Ga0395905_0169267 Ga0395905_0169267_387_1037 210
499 3300048920 Ga0496117_0020388 Ga0496117_0020388_631_1293 210
500 3300048921 Ga0496118_0011622 Ga0496118_0011622_6893_7555 210
501 3300048924 Ga0496121_0001342 Ga0496121_0001342_10291_10947 210
502 3300048924 Ga0496121_0009334 Ga0496121_0009334_2525_3181 210
503 3300048928 Ga0496125_0011958 Ga0496125_0011958_6896_7552 210
504 3300048929 Ga0496126_0010396 Ga0496126_0010396_4051_4707 210
505 3300005289 Ga0065704_10005861 Ga0065704_100058613 211
506 3300005327 Ga0070658_10000003 Ga0070658_1000000320 211
507 3300005327 Ga0070658_10204152 Ga0070658_102041522 211
508 3300005339 Ga0070660_100002551 Ga0070660_10000255111 211
509 3300005339 Ga0070660_100011384 Ga0070660_1000113845 211
510 3300005339 Ga0070660_100029820 Ga0070660_1000298204 211
511 3300005344 Ga0070661_100000113 Ga0070661_10000011329 211
512 3300005344 Ga0070661_100474888 Ga0070661_1004748881 211
513 3300005366 Ga0070659_100029300 Ga0070659_1000293004 211
514 3300009177 Ga0105248_10004622 Ga0105248_1000462213 211
515 3300013307 Ga0157372_10361414 Ga0157372_103614142 211
516 3300025909 Ga0207705_10000005 Ga0207705_1000000523 211
517 3300025909 Ga0207705_10001221 Ga0207705_1000122115 211
518 3300025919 Ga0207657_10000530 Ga0207657_1000053019 211
519 3300025919 Ga0207657_10004555 Ga0207657_100045559 211
520 3300025919 Ga0207657_10008611 Ga0207657_100086112 211
521 3300025920 Ga0207649_10000089 Ga0207649_1000008959 211
522 3300025941 Ga0207711_10003263 Ga0207711_1000326311 211
523 3300025972 Ga0207668_10013873 Ga0207668_100138733 211
524 3300046616 Ga0495668_0000002 Ga0495668_0000002_613418_614071 211
525 3300048904 Ga0496101_0534452 Ga0496101_0534452_194_847 211
526 3300049570 Ga0501033_0288556 Ga0501033_0288556_470_1135 211
527 3300049823 Ga0501044_0182393 Ga0501044_0182393_1010_1675 211
528 3300005347 Ga0070668_100088515 Ga0070668_1000885152 212
529 3300005353 Ga0070669_100044837 Ga0070669_1000448374 212
530 3300005354 Ga0070675_100052628 Ga0070675_1000526283 212
531 3300005367 Ga0070667_100049062 Ga0070667_1000490622 212
532 3300005530 Ga0070679_100009942 Ga0070679_1000099422 212
533 3300005719 Ga0068861_100076201 Ga0068861_1000762013 212
534 3300005842 Ga0068858_100001395 Ga0068858_1000013953 212
535 3300006195 Ga0075366_10004156 Ga0075366_100041563 212
536 3300006881 Ga0068865_100047012 Ga0068865_1000470124 212
537 3300009094 Ga0111539_10165127 Ga0111539_101651275 212
538 3300009177 Ga0105248_10086290 Ga0105248_100862901 212
539 3300025921 Ga0207652_10001310 Ga0207652_1000131011 212
540 3300025926 Ga0207659_10074272 Ga0207659_100742722 212
541 3300025941 Ga0207711_10090815 Ga0207711_100908152 212
542 3300025949 Ga0207667_10023225 Ga0207667_100232255 212
543 3300025972 Ga0207668_10625506 Ga0207668_106255061 212
544 3300025986 Ga0207658_10107262 Ga0207658_101072622 212
545 3300026035 Ga0207703_10009090 Ga0207703_100090907 212
546 3300047469 Ga0495673_0018930 Ga0495673_0018930_968_1636 212
547 3300047472 Ga0495686_0000834 Ga0495686_0000834_10133_10801 212
548 3300048914 Ga0496111_0165946 Ga0496111_0165946_921_1610 212
549 3300001979 JGI24740J21852_10008231 JGI24740J21852_100082315 213
550 3300001989 JGI24739J22299_10031369 JGI24739J22299_100313692 213
551 3300002075 JGI24738J21930_10002662 JGI24738J21930_100026623 213
552 3300005327 Ga0070658_10079426 Ga0070658_100794264 213
553 3300005329 Ga0070683_100006299 Ga0070683_1000062992 213
554 3300005331 Ga0070670_100062557 Ga0070670_1000625572 213
555 3300005335 Ga0070666_10023039 Ga0070666_100230391 213
556 3300005344 Ga0070661_100043382 Ga0070661_1000433824 213
557 3300005353 Ga0070669_100412491 Ga0070669_1004124912 213
558 3300005366 Ga0070659_100423701 Ga0070659_1004237012 213
559 3300005367 Ga0070667_100013316 Ga0070667_1000133165 213
560 3300005367 Ga0070667_100630742 Ga0070667_1006307421 213
561 3300005455 Ga0070663_100003727 Ga0070663_1000037278 213
562 3300005457 Ga0070662_100093853 Ga0070662_1000938534 213
563 3300005539 Ga0068853_100178109 Ga0068853_1001781092 213
564 3300005545 Ga0070695_100416424 Ga0070695_1004164242 213
565 3300005546 Ga0070696_100005859 Ga0070696_1000058598 213
566 3300005563 Ga0068855_100170191 Ga0068855_1001701913 213
567 3300005564 Ga0070664_100035435 Ga0070664_1000354355 213
568 3300005577 Ga0068857_100013825 Ga0068857_1000138255 213
569 3300005578 Ga0068854_100002842 Ga0068854_1000028424 213
570 3300005578 Ga0068854_100298201 Ga0068854_1002982012 213
571 3300005616 Ga0068852_100019423 Ga0068852_1000194235 213
572 3300005844 Ga0068862_100071963 Ga0068862_1000719632 213
573 3300005844 Ga0068862_100139529 Ga0068862_1001395292 213
574 3300009094 Ga0111539_10116009 Ga0111539_101160094 213
575 3300013100 Ga0157373_10122487 Ga0157373_101224872 213
576 3300013307 Ga0157372_10130324 Ga0157372_101303242 213
577 3300020081 Ga0206354_10118545 Ga0206354_101185452 213
578 3300020082 Ga0206353_11409418 Ga0206353_114094182 213
579 3300021384 Ga0213876_10012578 Ga0213876_100125782 213
580 3300025893 Ga0207682_10024490 Ga0207682_100244903 213
581 3300025903 Ga0207680_10039981 Ga0207680_100399812 213
582 3300025903 Ga0207680_10488542 Ga0207680_104885422 213
583 3300025904 Ga0207647_10030168 Ga0207647_100301683 213
584 3300025909 Ga0207705_10297955 Ga0207705_102979552 213
585 3300025920 Ga0207649_10305131 Ga0207649_103051311 213
586 3300025931 Ga0207644_10227767 Ga0207644_102277672 213
587 3300025932 Ga0207690_10181700 Ga0207690_101817001 213
588 3300025933 Ga0207706_10004081 Ga0207706_1000408115 213
589 3300025933 Ga0207706_10163511 Ga0207706_101635113 213
590 3300025944 Ga0207661_10334706 Ga0207661_103347062 213
591 3300025945 Ga0207679_10010952 Ga0207679_100109525 213
592 3300025981 Ga0207640_10111752 Ga0207640_101117522 213
593 3300025981 Ga0207640_10433416 Ga0207640_104334162 213
594 3300025981 Ga0207640_10765466 Ga0207640_107654662 213
595 3300025986 Ga0207658_10122634 Ga0207658_101226343 213
596 3300026041 Ga0207639_10231492 Ga0207639_102314923 213
597 3300026067 Ga0207678_10000487 Ga0207678_1000048725 213
598 3300026116 Ga0207674_10002967 Ga0207674_1000296714 213
599 3300026142 Ga0207698_10417051 Ga0207698_104170512 213
600 3300027907 Ga0207428_10380124 Ga0207428_103801242 213
601 3300028380 Ga0268265_10393094 Ga0268265_103930942 213
602 3300031548 Ga0307408_100014219 Ga0307408_1000142194 213
603 3300031901 Ga0307406_10049021 Ga0307406_100490213 213
604 3300031995 Ga0307409_100227934 Ga0307409_1002279343 213
605 3300032002 Ga0307416_100960420 Ga0307416_1009604202 213
606 3300032126 Ga0307415_100095893 Ga0307415_1000958933 213
607 3300037312 Ga0395899_0205000 Ga0395899_0205000_221_862 213
608 3300037312 Ga0395899_0218316 Ga0395899_0218316_274_915 213
609 3300037312 Ga0395899_0375388 Ga0395899_0375388_220_864 213
610 3300037418 Ga0395900_0957267 Ga0395900_0957267_78_722 213
611 3300037471 Ga0395905_0097211 Ga0395905_0097211_1989_2630 213
612 3300037471 Ga0395905_0226337 Ga0395905_0226337_385_1029 213
613 3300037471 Ga0395905_0236268 Ga0395905_0236268_361_1002 213
614 3300037471 Ga0395905_0256023 Ga0395905_0256023_192_833 213
615 3300038443 Ga0395901_0197552 Ga0395901_0197552_364_1005 213
616 3300038443 Ga0395901_0468390 Ga0395901_0468390_96_740 213
617 3300039437 Ga0436365_0694182 Ga0436365_0694182_1124_1852 213
618 3300046525 Ga0495663_0009781 Ga0495663_0009781_12_656 213
619 3300046528 Ga0495642_0092360 Ga0495642_0092360_528_1172 213
620 3300046684 Ga0495669_0000559 Ga0495669_0000559_10472_11116 213
621 3300046684 Ga0495669_0145714 Ga0495669_0145714_401_1045 213
622 3300047445 Ga0495677_0002453 Ga0495677_0002453_2241_2885 213
623 3300050511 nmdc:mga08y16_187160_c1 nmdc:mga08y16_187160_c1_1244_1888 213
624 3300005328 Ga0070676_10005451 Ga0070676_100054515 215
625 3300005331 Ga0070670_100084749 Ga0070670_1000847493 215
626 3300005334 Ga0068869_100144129 Ga0068869_1001441293 215
627 3300005338 Ga0068868_100203493 Ga0068868_1002034931 215
628 3300005347 Ga0070668_100002391 Ga0070668_10000239113 215
629 3300005347 Ga0070668_100086043 Ga0070668_1000860433 215
630 3300005353 Ga0070669_100018859 Ga0070669_1000188593 215
631 3300005356 Ga0070674_100023631 Ga0070674_1000236313 215
632 3300005364 Ga0070673_100447586 Ga0070673_1004475861 215
633 3300005367 Ga0070667_100053412 Ga0070667_1000534124 215
634 3300005367 Ga0070667_100077148 Ga0070667_1000771482 215
635 3300005459 Ga0068867_100013276 Ga0068867_1000132763 215
636 3300005543 Ga0070672_100022570 Ga0070672_1000225704 215
637 3300005548 Ga0070665_100061478 Ga0070665_1000614784 215
638 3300005843 Ga0068860_100001699 Ga0068860_1000016996 215
639 3300005844 Ga0068862_100018982 Ga0068862_1000189824 215
640 3300006237 Ga0097621_100006688 Ga0097621_1000066885 215
641 3300006358 Ga0068871_100001230 Ga0068871_1000012305 215
642 3300006881 Ga0068865_100034970 Ga0068865_1000349704 215
643 3300009177 Ga0105248_10132717 Ga0105248_101327173 215
644 3300013308 Ga0157375_10174162 Ga0157375_101741622 215
645 3300025315 Ga0207697_10016025 Ga0207697_100160252 215
646 3300025907 Ga0207645_10009118 Ga0207645_100091185 215
647 3300025908 Ga0207643_10041090 Ga0207643_100410904 215
648 3300025923 Ga0207681_10016480 Ga0207681_100164804 215
649 3300025925 Ga0207650_10051546 Ga0207650_100515463 215
650 3300025938 Ga0207704_10011088 Ga0207704_100110884 215
651 3300025938 Ga0207704_10025224 Ga0207704_100252244 215
652 3300025940 Ga0207691_10005722 Ga0207691_100057225 215
653 3300025941 Ga0207711_10106021 Ga0207711_101060212 215
654 3300025960 Ga0207651_10106858 Ga0207651_101068583 215
655 3300025972 Ga0207668_10001489 Ga0207668_100014895 215
656 3300025986 Ga0207658_10024756 Ga0207658_100247564 215
657 3300025986 Ga0207658_10049566 Ga0207658_100495662 215
658 3300026023 Ga0207677_10236952 Ga0207677_102369523 215
659 3300026089 Ga0207648_10029444 Ga0207648_100294444 215
660 3300028379 Ga0268266_10038807 Ga0268266_100388072 215
661 3300028380 Ga0268265_10001829 Ga0268265_1000182918 215
662 3300028381 Ga0268264_10002411 Ga0268264_100024117 215
663 3300001904 JGI24736J21556_1002432 JGI24736J21556_10024324 216
664 3300001990 JGI24737J22298_10024139 JGI24737J22298_100241393 216
665 3300005293 Ga0065715_10036833 Ga0065715_100368332 216
666 3300005334 Ga0068869_100212021 Ga0068869_1002120212 216
667 3300005338 Ga0068868_100360898 Ga0068868_1003608982 216
668 3300005339 Ga0070660_100003259 Ga0070660_1000032596 216
669 3300005353 Ga0070669_100028059 Ga0070669_1000280593 216
670 3300005366 Ga0070659_100002449 Ga0070659_1000024492 216
671 3300005457 Ga0070662_100002519 Ga0070662_10000251911 216
672 3300005539 Ga0068853_100152672 Ga0068853_1001526722 216
673 3300005577 Ga0068857_100237643 Ga0068857_1002376432 216
674 3300005617 Ga0068859_100117719 Ga0068859_1001177193 216
675 3300005718 Ga0068866_10078161 Ga0068866_100781613 216
676 3300005841 Ga0068863_100176774 Ga0068863_1001767743 216
677 3300005842 Ga0068858_100001826 Ga0068858_1000018264 216
678 3300005844 Ga0068862_100110063 Ga0068862_1001100633 216
679 3300005844 Ga0068862_100122744 Ga0068862_1001227443 216
680 3300006871 Ga0075434_100450853 Ga0075434_1004508532 216
681 3300006871 Ga0075434_100550281 Ga0075434_1005502812 216
682 3300006931 Ga0097620_100117721 Ga0097620_1001177213 216
683 3300009093 Ga0105240_10682812 Ga0105240_106828122 216
684 3300009098 Ga0105245_10269152 Ga0105245_102691523 216
685 3300009148 Ga0105243_10144357 Ga0105243_101443573 216
686 3300009148 Ga0105243_10213196 Ga0105243_102131962 216
687 3300009176 Ga0105242_10595371 Ga0105242_105953712 216
688 3300009177 Ga0105248_11277878 Ga0105248_112778782 216
689 3300009553 Ga0105249_10007728 Ga0105249_100077283 216
690 3300010375 Ga0105239_10329108 Ga0105239_103291083 216
691 3300011119 Ga0105246_10273048 Ga0105246_102730482 216
692 3300013102 Ga0157371_10389594 Ga0157371_103895942 216
693 3300013306 Ga0163162_10798385 Ga0163162_107983852 216
694 3300013307 Ga0157372_11008636 Ga0157372_110086362 216
695 3300013308 Ga0157375_10840495 Ga0157375_108404952 216
696 3300014745 Ga0157377_10018629 Ga0157377_100186294 216
697 3300025315 Ga0207697_10141693 Ga0207697_101416932 216
698 3300025899 Ga0207642_10150799 Ga0207642_101507993 216
699 3300025927 Ga0207687_10073443 Ga0207687_100734433 216
700 3300025935 Ga0207709_10057335 Ga0207709_100573353 216
701 3300025938 Ga0207704_10464209 Ga0207704_104642092 216
702 3300025942 Ga0207689_10470168 Ga0207689_104701681 216
703 3300026023 Ga0207677_10335334 Ga0207677_103353342 216
704 3300026035 Ga0207703_10000974 Ga0207703_1000097419 216
705 3300026088 Ga0207641_10228784 Ga0207641_102287842 216
706 3300028380 Ga0268265_10120734 Ga0268265_101207343 216
707 3300028380 Ga0268265_10152024 Ga0268265_101520243 216
708 3300037418 Ga0395900_0734985 Ga0395900_0734985_65_715 216
709 3300037471 Ga0395905_0335021 Ga0395905_0335021_324_974 216
710 3300038443 Ga0395901_0098696 Ga0395901_0098696_951_1601 216
711 3300050513 nmdc:mga0rr50_488788_c1 nmdc:mga0rr50_488788_c1_124_780 216
712 3300050515 nmdc:mga0a205_63805_c1 nmdc:mga0a205_63805_c1_2489_3145 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07077

DUF1345

Protein of unknown function (DUF1345)

62

234

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wli-assembly1.cif.gz_B potassium channel from magnetospirillum magnetotacticum 0.8018 114 207
6o9u-assembly1.cif.gz_A kirbac3.1 at a resolution of 2 angstroms 0.7804 114 207
2wlj-assembly1.cif.gz_A-2 potassium channel from magnetospirillum magnetotacticum 0.7514 115 207
2wlj-assembly1.cif.gz_B-2 potassium channel from magnetospirillum magnetotacticum 0.751 114 207
2wli-assembly1.cif.gz_A potassium channel from magnetospirillum magnetotacticum 0.7386 114 216
ID Description Score Start End Superfamily
af_I1JJJ2_64_158_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7861 115 213 1.10.287.70
af_Q8LIN5_63_157_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7764 118 213 1.10.287.70
af_Q850M0_51_165_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7606 117 213 1.10.287.70
3e89A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7519 118 207 1.10.287.70
af_O53346_37_141_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7431 115 214 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A7W5Z2G3-F1-model_v4 Putative membrane protein 0.9424 5 211 GO:0016020
AF-A0A3F3ATX5-F1-model_v4 deleted 0.9416 109 212
AF-A0A370KDB9-F1-model_v4 DUF1345 domain-containing protein 0.9389 19 215 GO:0016020
AF-A0A066UJ97-F1-model_v4 Uncharacterized protein 0.9376 109 204 GO:0016020
AF-A0A537MK23-F1-model_v4 DUF1345 domain-containing protein 0.9356 15 211 GO:0016020

Feature Viewer

pLDDT pTM Quality
79.27 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map