F476698

General Info

Members Datasets Scaffolds Average Seq Length
710 262 1420 458

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10002347|Ga0081539_100023479
Length 523
Sequence MRVPRNICRGRACPCPQSSEIKSRASQDGQGQALPLQTGRDKPCPYSKCIFDQFTEDNLAVQRFSAPLLVIQGEAVAAQTPPAPLPPPRVKIEEYRERAARIIGAALTSDTAYRRLAWLTDRIGNRLGGSESLERAIAWAASEMKRDGLDNVHTEKVMVPHWVRGEESLELVSPVRKSLTMLGLGNSVGTPAEGLTAEAVVVRNFDELEALGERVRGKIVVYNAPFTTYGATVVYRGSGPSRAAKYGAVAAIVRSVTPASLQSPHTGSLRYDADHPEIPKIPAAAVTIEGAELLQRMQERGEHPRLHLKMGAHFLPDAESANVIAEIKGREKPEEVVVIGGHIDSWDVGQGAHDDGSGCLITWETVRLLKALGLRPRRTIRVVLFTNEENGARGGAGYAAAHKSELKDHILAIESDSGVFRPTGFGLSEKATPQARADFMEIAKLLAGIRADRIDPDGEGTDIGPIVREGVTGASFNVDAPRYFEIHHTDADTFDKINPQDLAACVATMAVMAYVVADMPDRL

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
192 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
225 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
235 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
236 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
237 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
256 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
257 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
258 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 2.11
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 14.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10002347 3300005985 Bacteria 27196
2 CNAas_1000600 3300000532 Bacteria 3487
3 JGI24751J29686_10000008 3300002459 Bacteria 128004
4 JGI24751J29686_10000029 3300002459 Bacteria 93445
5 JGI24751J29686_10006592 3300002459 Archaea 2366
6 JGI25406J46586_10002977 3300003203 Bacteria 7996
7 rootL2_10108056 3300003322 Unclassified 2171
8 rootL2_10224574 3300003322 Unclassified 2157
9 Ga0065714_10002184 3300005288 Bacteria 284511
10 Ga0065704_10003267 3300005289 Bacteria 10900
11 Ga0065712_10000112 3300005290 Bacteria 340011
12 Ga0065712_10005270 3300005290 Bacteria 6628
13 Ga0065712_10068461 3300005290 Bacteria 10472
14 Ga0065712_10068886 3300005290 Bacteria 8659
15 Ga0065712_10071888 3300005290 Bacteria 5009
16 Ga0065715_10000699 3300005293 Bacteria 19407
17 Ga0065715_10003134 3300005293 Unclassified 4591
18 Ga0065715_10003792 3300005293 Bacteria 5371
19 Ga0065715_10007644 3300005293 Unclassified 4306
20 Ga0065715_10031997 3300005293 Bacteria 1656
21 Ga0065715_10090585 3300005293 Bacteria 6780
22 Ga0065715_10100296 3300005293 Bacteria 3318
23 Ga0065715_10116072 3300005293 Bacteria 2393
24 Ga0065707_10002123 3300005295 Bacteria 6456
25 Ga0065707_10012232 3300005295 Bacteria 2401
26 Ga0065707_10084252 3300005295 Bacteria 7450
27 Ga0070658_10029152 3300005327 Bacteria 4433
28 Ga0070683_100231168 3300005329 Bacteria 1758
29 Ga0070683_100299374 3300005329 Bacteria 1530
30 Ga0070690_100006987 3300005330 Bacteria 6432
31 Ga0070690_100007654 3300005330 Bacteria 6191
32 Ga0070690_100102017 3300005330 Bacteria 1903
33 Ga0070670_100000441 3300005331 Bacteria 33901
34 Ga0070670_100011350 3300005331 Bacteria 7613
35 Ga0070670_100013662 3300005331 Bacteria 6959
36 Ga0068869_100039146 3300005334 Bacteria 3384
37 Ga0068869_100040945 3300005334 Bacteria 3315
38 Ga0068869_100049755 3300005334 Bacteria 3035
39 Ga0068869_100147569 3300005334 Bacteria 1821
40 Ga0068869_100149897 3300005334 Unclassified 1808
41 Ga0068869_100194065 3300005334 Unclassified 1598
42 Ga0070666_10026870 3300005335 Unclassified 3765
43 Ga0070666_10075664 3300005335 Bacteria 2296
44 Ga0070680_100014304 3300005336 Bacteria 6198
45 Ga0070680_100125665 3300005336 Bacteria 2143
46 Ga0070680_100164775 3300005336 Bacteria 1863
47 Ga0070682_100000221 3300005337 Bacteria 41449
48 Ga0070682_100015335 3300005337 Bacteria 4438
49 Ga0070682_100015530 3300005337 Bacteria 4414
50 Ga0070682_100038781 3300005337 Bacteria 2924
51 Ga0070660_100091792 3300005339 Bacteria 2396
52 Ga0070689_100006235 3300005340 Bacteria 8231
53 Ga0070689_100024610 3300005340 Bacteria 4518
54 Ga0070689_100028878 3300005340 Bacteria 4194
55 Ga0070687_100046334 3300005343 Bacteria 2225
56 Ga0070661_100057198 3300005344 Bacteria 2858
57 Ga0070692_10017291 3300005345 Bacteria 3444
58 Ga0070692_10022768 3300005345 Bacteria 3064
59 Ga0070669_100000596 3300005353 Bacteria 26785
60 Ga0070669_100003668 3300005353 Bacteria 11079
61 Ga0070669_100005683 3300005353 Bacteria 8993
62 Ga0070669_100007429 3300005353 Bacteria 7852
63 Ga0070669_100015783 3300005353 Bacteria 5386
64 Ga0070669_100030905 3300005353 Bacteria 3866
65 Ga0070669_100050286 3300005353 Unclassified 3044
66 Ga0070669_100091636 3300005353 Bacteria 2280
67 Ga0070669_100114545 3300005353 Bacteria 2050
68 Ga0070675_100004870 3300005354 Bacteria 10247
69 Ga0070675_100045224 3300005354 Bacteria 3602
70 Ga0070675_100067683 3300005354 Bacteria 2955
71 Ga0070675_100077782 3300005354 Bacteria 2762
72 Ga0070671_100003274 3300005355 Bacteria 12633
73 Ga0070674_100020994 3300005356 Bacteria 4185
74 Ga0070674_100160049 3300005356 Unclassified 1708
75 Ga0070673_100071385 3300005364 Unclassified 2790
76 Ga0070673_100080332 3300005364 Bacteria 2642
77 Ga0070673_100085960 3300005364 Unclassified 2562
78 Ga0070673_100097801 3300005364 Bacteria 2411
79 Ga0070688_100006787 3300005365 Bacteria 6138
80 Ga0070688_100056104 3300005365 Bacteria 2473
81 Ga0070688_100060957 3300005365 Bacteria 2384
82 Ga0070659_100005389 3300005366 Bacteria 9181
83 Ga0070659_100037695 3300005366 Unclassified 3769
84 Ga0070659_100065796 3300005366 Bacteria 2871
85 Ga0070659_100085086 3300005366 Bacteria 2529
86 Ga0070667_100086693 3300005367 Bacteria 2687
87 Ga0070667_100104047 3300005367 Bacteria 2455
88 Ga0070713_100128031 3300005436 Bacteria 2236
89 Ga0070701_10003933 3300005438 Bacteria 5941
90 Ga0070701_10017673 3300005438 Bacteria 3338
91 Ga0070701_10023358 3300005438 Bacteria 2977
92 Ga0070701_10024757 3300005438 Bacteria 2907
93 Ga0070701_10042749 3300005438 Bacteria 2314
94 Ga0070705_100000069 3300005440 Bacteria 54854
95 Ga0070705_100003580 3300005440 Bacteria 7608
96 Ga0070705_100102685 3300005440 Bacteria 1809
97 Ga0070705_100110743 3300005440 Unclassified 1754
98 Ga0070705_100116384 3300005440 Bacteria 1718
99 Ga0070700_100000142 3300005441 Bacteria 42548
100 Ga0070700_100008280 3300005441 Bacteria 5659
101 Ga0070700_100018203 3300005441 Bacteria 4035
102 Ga0070700_100032146 3300005441 Unclassified 3151
103 Ga0070700_100085438 3300005441 Bacteria 2047
104 Ga0070700_100089732 3300005441 Bacteria 2003
105 Ga0070694_100002234 3300005444 Bacteria 11439
106 Ga0070694_100005165 3300005444 Bacteria 7875
107 Ga0070694_100007103 3300005444 Bacteria 6819
108 Ga0070694_100008217 3300005444 Bacteria 6380
109 Ga0070694_100019730 3300005444 Bacteria 4289
110 Ga0070694_100019953 3300005444 Bacteria 4269
111 Ga0070694_100022309 3300005444 Bacteria 4055
112 Ga0070694_100039283 3300005444 Bacteria 3150
113 Ga0070663_100092206 3300005455 Bacteria 2246
114 Ga0070663_100106192 3300005455 Bacteria 2103
115 Ga0070681_10000648 3300005458 Bacteria 28721
116 Ga0070681_10003492 3300005458 Bacteria 14717
117 Ga0070681_10027560 3300005458 Bacteria 5712
118 Ga0068867_100006730 3300005459 Bacteria 8125
119 Ga0068867_100026504 3300005459 Bacteria 4163
120 Ga0070685_10092736 3300005466 Unclassified 1831
121 Ga0070706_100000358 3300005467 Bacteria 55073
122 Ga0070706_100055972 3300005467 Bacteria 3640
123 Ga0070707_100194784 3300005468 Bacteria 1976
124 Ga0070698_100000157 3300005471 Bacteria 61949
125 Ga0070698_100004660 3300005471 Bacteria 15077
126 Ga0070698_100016323 3300005471 Bacteria 7840
127 Ga0070698_100023349 3300005471 Bacteria 6465
128 Ga0070698_100035716 3300005471 Bacteria 5137
129 Ga0070698_100056983 3300005471 Bacteria 3955
130 Ga0070698_100121425 3300005471 Bacteria 2573
131 Ga0070699_100000233 3300005518 Bacteria 54222
132 Ga0070699_100002881 3300005518 Bacteria 15333
133 Ga0070699_100056302 3300005518 Bacteria 3405
134 Ga0070699_100073475 3300005518 Unclassified 2975
135 Ga0070679_100000701 3300005530 Bacteria 28741
136 Ga0070684_100000624 3300005535 Bacteria 24433
137 Ga0070684_100208267 3300005535 Bacteria 1782
138 Ga0070697_100000465 3300005536 Bacteria 30980
139 Ga0070697_100078031 3300005536 Bacteria 2725
140 Ga0070697_100109015 3300005536 Bacteria 2305
141 Ga0070697_100195184 3300005536 Bacteria 1719
142 Ga0068853_100219288 3300005539 Bacteria 1737
143 Ga0070672_100013688 3300005543 Bacteria 5735
144 Ga0070672_100039862 3300005543 Bacteria 3601
145 Ga0070672_100102196 3300005543 Unclassified 2326
146 Ga0070672_100123460 3300005543 Bacteria 2122
147 Ga0070672_100186138 3300005543 Bacteria 1732
148 Ga0070686_100001528 3300005544 Bacteria 13001
149 Ga0070686_100026625 3300005544 Bacteria 3492
150 Ga0070695_100000133 3300005545 Bacteria 34008
151 Ga0070695_100031055 3300005545 Bacteria 3328
152 Ga0070695_100157981 3300005545 Bacteria 1589
153 Ga0070696_100000157 3300005546 Bacteria 37991
154 Ga0070696_100008913 3300005546 Bacteria 6715
155 Ga0070696_100047055 3300005546 Bacteria 2992
156 Ga0070696_100108231 3300005546 Bacteria 2000
157 Ga0070693_100078516 3300005547 Unclassified 1962
158 Ga0070665_100002415 3300005548 Bacteria 20604
159 Ga0070665_100111132 3300005548 Bacteria 2743
160 Ga0070665_100114745 3300005548 Bacteria 2696
161 Ga0070704_100002688 3300005549 Bacteria 10048
162 Ga0070704_100066469 3300005549 Bacteria 2600
163 Ga0070704_100109379 3300005549 Bacteria 2100
164 Ga0070664_100011724 3300005564 Bacteria 7116
165 Ga0070664_100027028 3300005564 Bacteria 4766
166 Ga0070664_100027142 3300005564 Bacteria 4757
167 Ga0070664_100034565 3300005564 Unclassified 4240
168 Ga0068857_100006331 3300005577 Bacteria 10138
169 Ga0068857_100027572 3300005577 Bacteria 5011
170 Ga0068857_100066569 3300005577 Bacteria 3206
171 Ga0068857_100124472 3300005577 Bacteria 2323
172 Ga0068854_100022336 3300005578 Bacteria 4308
173 Ga0070702_100004164 3300005615 Bacteria 6577
174 Ga0068852_100098983 3300005616 Bacteria 2627
175 Ga0068852_100153214 3300005616 Bacteria 2145
176 Ga0068859_100001112 3300005617 Bacteria 27444
177 Ga0068859_100009962 3300005617 Bacteria 9588
178 Ga0068859_100026515 3300005617 Bacteria 5812
179 Ga0068859_100029645 3300005617 Bacteria 5491
180 Ga0068859_100030600 3300005617 Bacteria 5402
181 Ga0068859_100047901 3300005617 Bacteria 4294
182 Ga0068859_100071983 3300005617 Unclassified 3492
183 Ga0068859_100268431 3300005617 Unclassified 1798
184 Ga0068859_100345847 3300005617 Bacteria 1582
185 Ga0068864_100008126 3300005618 Bacteria 8653
186 Ga0068864_100008920 3300005618 Bacteria 8265
187 Ga0068864_100032588 3300005618 Bacteria 4428
188 Ga0068864_100096966 3300005618 Bacteria 2610
189 Ga0068861_100001096 3300005719 Bacteria 16767
190 Ga0068861_100001993 3300005719 Bacteria 13199
191 Ga0068861_100002135 3300005719 Bacteria 12793
192 Ga0068861_100014945 3300005719 Bacteria 5458
193 Ga0068861_100078441 3300005719 Bacteria 2579
194 Ga0068861_100124913 3300005719 Unclassified 2081
195 Ga0068870_10007427 3300005840 Bacteria 4884
196 Ga0068870_10036003 3300005840 Bacteria 2544
197 Ga0068870_10055967 3300005840 Bacteria 2103
198 Ga0068870_10084377 3300005840 Unclassified 1763
199 Ga0068863_100031139 3300005841 Bacteria 5094
200 Ga0068863_100036117 3300005841 Bacteria 4706
201 Ga0068858_100023336 3300005842 Bacteria 5764
202 Ga0068858_100042522 3300005842 Unclassified 4213
203 Ga0068860_100009290 3300005843 Bacteria 9769
204 Ga0068860_100014502 3300005843 Bacteria 7713
205 Ga0068860_100032631 3300005843 Bacteria 5002
206 Ga0068860_100046853 3300005843 Bacteria 4121
207 Ga0068860_100078166 3300005843 Bacteria 3147
208 Ga0068860_100084145 3300005843 Bacteria 3026
209 Ga0068860_100154559 3300005843 Bacteria 2211
210 Ga0068862_100001415 3300005844 Bacteria 22222
211 Ga0068862_100003399 3300005844 Bacteria 13724
212 Ga0068862_100013011 3300005844 Bacteria 6881
213 Ga0068862_100024998 3300005844 Bacteria 5014
214 Ga0068862_100029182 3300005844 Bacteria 4647
215 Ga0068862_100053414 3300005844 Bacteria 3459
216 Ga0068862_100073334 3300005844 Unclassified 2958
217 Ga0068862_100077555 3300005844 Bacteria 2878
218 Ga0068862_100161712 3300005844 Bacteria 1999
219 Ga0081455_10031169 3300005937 Bacteria 4829
220 Ga0081540_1040996 3300005983 Bacteria 2405
221 Ga0081539_10000697 3300005985 Bacteria 67380
222 Ga0081539_10001077 3300005985 Bacteria 49686
223 Ga0081539_10052045 3300005985 Unclassified 2303
224 Ga0097621_100001606 3300006237 Bacteria 15484
225 Ga0097621_100045640 3300006237 Unclassified 3540
226 Ga0097621_100063923 3300006237 Bacteria 3025
227 Ga0068871_100011512 3300006358 Bacteria 6488
228 Ga0068871_100071285 3300006358 Bacteria 2858
229 Ga0075428_100001500 3300006844 Bacteria 24971
230 Ga0075428_100059621 3300006844 Bacteria 4179
231 Ga0075428_100105421 3300006844 Bacteria 3074
232 Ga0075428_100171287 3300006844 Unclassified 2353
233 Ga0075428_100246071 3300006844 Bacteria 1928
234 Ga0075430_100023039 3300006846 Bacteria 5297
235 Ga0075430_100026280 3300006846 Bacteria 4954
236 Ga0075430_100033880 3300006846 Bacteria 4334
237 Ga0075430_100180056 3300006846 Bacteria 1758
238 Ga0075431_100046102 3300006847 Bacteria 4494
239 Ga0075431_100054037 3300006847 Bacteria 4141
240 Ga0075431_100100429 3300006847 Bacteria 2985
241 Ga0075431_100136039 3300006847 Bacteria 2534
242 Ga0075431_100137160 3300006847 Bacteria 2522
243 Ga0075431_100200470 3300006847 Bacteria 2042
244 Ga0075433_10002846 3300006852 Bacteria 13249
245 Ga0075433_10007914 3300006852 Bacteria 8455
246 Ga0075433_10013477 3300006852 Bacteria 6647
247 Ga0075433_10038809 3300006852 Bacteria 4115
248 Ga0075433_10105547 3300006852 Bacteria 2496
249 Ga0075433_10155092 3300006852 Bacteria 2037
250 Ga0075434_100017806 3300006871 Bacteria 6852
251 Ga0075434_100037528 3300006871 Bacteria 4797
252 Ga0075434_100039633 3300006871 Unclassified 4668
253 Ga0075434_100052614 3300006871 Unclassified 4046
254 Ga0075434_100058656 3300006871 Bacteria 3825
255 Ga0075434_100067351 3300006871 Bacteria 3567
256 Ga0075434_100097708 3300006871 Unclassified 2941
257 Ga0075429_100003654 3300006880 Bacteria 13103
258 Ga0075429_100024585 3300006880 Bacteria 5227
259 Ga0075429_100056874 3300006880 Bacteria 3405
260 Ga0075429_100135568 3300006880 Unclassified 2154
261 Ga0075429_100148325 3300006880 Bacteria 2053
262 Ga0068865_100046591 3300006881 Bacteria 2975
263 Ga0068865_100113692 3300006881 Unclassified 2001
264 Ga0075436_100014492 3300006914 Bacteria 5402
265 Ga0097620_100001112 3300006931 Bacteria 27444
266 Ga0097620_100009961 3300006931 Bacteria 9588
267 Ga0097620_100026517 3300006931 Bacteria 5812
268 Ga0097620_100029645 3300006931 Bacteria 5491
269 Ga0097620_100030599 3300006931 Bacteria 5402
270 Ga0097620_100047899 3300006931 Bacteria 4294
271 Ga0097620_100071985 3300006931 Unclassified 3492
272 Ga0097620_100268425 3300006931 Unclassified 1798
273 Ga0097620_100345852 3300006931 Bacteria 1582
274 Ga0075435_100016200 3300007076 Bacteria 5618
275 Ga0075435_100033046 3300007076 Bacteria 4089
276 Ga0075435_100069081 3300007076 Bacteria 2879
277 Ga0075435_100078069 3300007076 Unclassified 2715
278 Ga0075435_100104264 3300007076 Bacteria 2353
279 Ga0099794_10000002 3300007265 Bacteria 155314
280 Ga0111539_10000111 3300009094 Bacteria 89076
281 Ga0111539_10000210 3300009094 Bacteria 69456
282 Ga0111539_10000439 3300009094 Bacteria 52493
283 Ga0111539_10000971 3300009094 Bacteria 37659
284 Ga0111539_10001366 3300009094 Bacteria 32497
285 Ga0111539_10006179 3300009094 Bacteria 15459
286 Ga0111539_10012778 3300009094 Bacteria 10505
287 Ga0111539_10017109 3300009094 Bacteria 8975
288 Ga0111539_10027015 3300009094 Bacteria 7011
289 Ga0111539_10029914 3300009094 Bacteria 6625
290 Ga0111539_10045777 3300009094 Bacteria 5236
291 Ga0111539_10058180 3300009094 Bacteria 4587
292 Ga0111539_10090820 3300009094 Unclassified 3589
293 Ga0111539_10099408 3300009094 Bacteria 3417
294 Ga0111539_10108101 3300009094 Bacteria 3264
295 Ga0111539_10110723 3300009094 Bacteria 3222
296 Ga0111539_10121713 3300009094 Bacteria 3057
297 Ga0111539_10148876 3300009094 Bacteria 2740
298 Ga0111539_10209230 3300009094 Bacteria 2273
299 Ga0111539_10363610 3300009094 Unclassified 1684
300 Ga0105247_10013987 3300009101 Bacteria 4813
301 Ga0114129_10002087 3300009147 Bacteria 27478
302 Ga0114129_10002485 3300009147 Bacteria 25603
303 Ga0114129_10003094 3300009147 Bacteria 23335
304 Ga0114129_10010636 3300009147 Bacteria 13124
305 Ga0114129_10015717 3300009147 Bacteria 10761
306 Ga0114129_10044963 3300009147 Bacteria 6210
307 Ga0114129_10046587 3300009147 Bacteria 6092
308 Ga0114129_10072222 3300009147 Bacteria 4811
309 Ga0114129_10075632 3300009147 Bacteria 4689
310 Ga0114129_10092326 3300009147 Bacteria 4194
311 Ga0114129_10164051 3300009147 Bacteria 3033
312 Ga0114129_10343031 3300009147 Bacteria 1980
313 Ga0105243_10006485 3300009148 Bacteria 9048
314 Ga0105243_10026136 3300009148 Bacteria 4467
315 Ga0105241_10092594 3300009174 Bacteria 2387
316 Ga0105242_10012040 3300009176 Bacteria 6657
317 Ga0105242_10080604 3300009176 Bacteria 2721
318 Ga0105248_10009157 3300009177 Bacteria 10891
319 Ga0105248_10012932 3300009177 Bacteria 9200
320 Ga0105248_10087253 3300009177 Bacteria 3511
321 Ga0105248_10095123 3300009177 Unclassified 3354
322 Ga0105248_10110809 3300009177 Bacteria 3095
323 Ga0105248_10261604 3300009177 Bacteria 1948
324 Ga0105237_10006392 3300009545 Bacteria 13077
325 Ga0105237_10249925 3300009545 Bacteria 1775
326 Ga0105238_10027231 3300009551 Bacteria 5824
327 Ga0105238_10083989 3300009551 Bacteria 3173
328 Ga0105249_10001872 3300009553 Bacteria 18236
329 Ga0105249_10010932 3300009553 Bacteria 7978
330 Ga0105249_10025005 3300009553 Bacteria 5373
331 Ga0105249_10060071 3300009553 Bacteria 3487
332 Ga0105246_10054105 3300011119 Unclassified 2764
333 Ga0105246_10185664 3300011119 Unclassified 1605
334 Ga0157373_10001131 3300013100 Bacteria 20507
335 Ga0157373_10070304 3300013100 Bacteria 2473
336 Ga0157373_10116112 3300013100 Bacteria 1881
337 Ga0157374_10004256 3300013296 Bacteria 12033
338 Ga0157374_10091168 3300013296 Bacteria 2906
339 Ga0157374_10183552 3300013296 Bacteria 2045
340 Ga0157378_10001387 3300013297 Bacteria 21775
341 Ga0157378_10008309 3300013297 Bacteria 9045
342 Ga0157378_10098477 3300013297 Unclassified 2666
343 Ga0163162_10000831 3300013306 Bacteria 28720
344 Ga0163162_10011502 3300013306 Bacteria 8631
345 Ga0157372_10103028 3300013307 Unclassified 3261
346 Ga0157372_10389068 3300013307 Unclassified 1625
347 Ga0157375_10005745 3300013308 Bacteria 10792
348 Ga0157375_10040496 3300013308 Unclassified 4491
349 Ga0157375_10051941 3300013308 Bacteria 4028
350 Ga0157375_10255222 3300013308 Bacteria 1915
351 Ga0163163_10001143 3300014325 Bacteria 22584
352 Ga0163163_10004205 3300014325 Bacteria 12269
353 Ga0163163_10008266 3300014325 Bacteria 9237
354 Ga0163163_10009645 3300014325 Bacteria 8635
355 Ga0163163_10015400 3300014325 Bacteria 7069
356 Ga0163163_10018485 3300014325 Bacteria 6527
357 Ga0163163_10054460 3300014325 Unclassified 3952
358 Ga0163163_10128163 3300014325 Bacteria 2577
359 Ga0163163_10134466 3300014325 Bacteria 2513
360 Ga0163163_10257315 3300014325 Bacteria 1796
361 Ga0157380_10000909 3300014326 Bacteria 18637
362 Ga0157380_10002457 3300014326 Bacteria 12481
363 Ga0157380_10020641 3300014326 Bacteria 4926
364 Ga0157380_10037741 3300014326 Bacteria 3745
365 Ga0157380_10045401 3300014326 Bacteria 3448
366 Ga0157380_10090476 3300014326 Unclassified 2524
367 Ga0157380_10117573 3300014326 Bacteria 2246
368 Ga0157380_10221431 3300014326 Bacteria 1693
369 Ga0157376_10050916 3300014969 Bacteria 3438
370 Ga0163161_10066175 3300017792 Unclassified 2638
371 Ga0213876_10000011 3300021384 Bacteria 414473
372 Ga0213876_10000343 3300021384 Bacteria 40521
373 Ga0207653_10032978 3300025885 Unclassified 1678
374 Ga0207682_10001843 3300025893 Bacteria 9660
375 Ga0207710_10000434 3300025900 Bacteria 27407
376 Ga0207688_10002099 3300025901 Bacteria 10715
377 Ga0207680_10012734 3300025903 Unclassified 4295
378 Ga0207680_10049689 3300025903 Bacteria 2498
379 Ga0207647_10004280 3300025904 Bacteria 10588
380 Ga0207647_10038816 3300025904 Unclassified 3009
381 Ga0207645_10045943 3300025907 Bacteria 2790
382 Ga0207645_10057358 3300025907 Bacteria 2486
383 Ga0207645_10091977 3300025907 Bacteria 1951
384 Ga0207643_10012974 3300025908 Bacteria 4505
385 Ga0207643_10018004 3300025908 Bacteria 3869
386 Ga0207643_10019237 3300025908 Bacteria 3742
387 Ga0207643_10035213 3300025908 Bacteria 2806
388 Ga0207643_10061848 3300025908 Unclassified 2139
389 Ga0207643_10069726 3300025908 Bacteria 2021
390 Ga0207705_10029201 3300025909 Bacteria 3931
391 Ga0207684_10000168 3300025910 Bacteria 110284
392 Ga0207684_10130456 3300025910 Unclassified 2157
393 Ga0207654_10109721 3300025911 Bacteria 1715
394 Ga0207707_10000118 3300025912 Bacteria 80806
395 Ga0207707_10031984 3300025912 Bacteria 4606
396 Ga0207660_10017584 3300025917 Bacteria 4754
397 Ga0207660_10132212 3300025917 Bacteria 1900
398 Ga0207660_10165276 3300025917 Unclassified 1710
399 Ga0207662_10048246 3300025918 Bacteria 2522
400 Ga0207657_10047269 3300025919 Bacteria 3764
401 Ga0207657_10087306 3300025919 Bacteria 2609
402 Ga0207649_10068826 3300025920 Bacteria 2252
403 Ga0207652_10000634 3300025921 Bacteria 34768
404 Ga0207681_10003145 3300025923 Bacteria 10375
405 Ga0207681_10005803 3300025923 Bacteria 7574
406 Ga0207681_10025763 3300025923 Bacteria 3786
407 Ga0207681_10054565 3300025923 Bacteria 2718
408 Ga0207681_10105987 3300025923 Bacteria 2036
409 Ga0207694_10012283 3300025924 Bacteria 6455
410 Ga0207650_10000087 3300025925 Bacteria 123505
411 Ga0207650_10003638 3300025925 Bacteria 10560
412 Ga0207659_10000237 3300025926 Bacteria 33603
413 Ga0207659_10026525 3300025926 Bacteria 3910
414 Ga0207659_10063938 3300025926 Bacteria 2661
415 Ga0207659_10085525 3300025926 Bacteria 2343
416 Ga0207659_10104181 3300025926 Unclassified 2145
417 Ga0207687_10076650 3300025927 Bacteria 2402
418 Ga0207700_10101283 3300025928 Bacteria 2298
419 Ga0207644_10019008 3300025931 Bacteria 4658
420 Ga0207644_10076943 3300025931 Unclassified 2456
421 Ga0207690_10012371 3300025932 Bacteria 5106
422 Ga0207706_10017194 3300025933 Bacteria 6518
423 Ga0207686_10062800 3300025934 Unclassified 2360
424 Ga0207686_10124872 3300025934 Bacteria 1757
425 Ga0207709_10003343 3300025935 Bacteria 9600
426 Ga0207709_10038304 3300025935 Bacteria 2854
427 Ga0207670_10003941 3300025936 Bacteria 7923
428 Ga0207670_10061206 3300025936 Bacteria 2568
429 Ga0207670_10077946 3300025936 Unclassified 2310
430 Ga0207670_10131201 3300025936 Bacteria 1836
431 Ga0207669_10030503 3300025937 Bacteria 2996
432 Ga0207669_10118672 3300025937 Unclassified 1790
433 Ga0207704_10055024 3300025938 Bacteria 2429
434 Ga0207704_10067527 3300025938 Unclassified 2250
435 Ga0207704_10080237 3300025938 Bacteria 2106
436 Ga0207691_10005905 3300025940 Bacteria 11827
437 Ga0207691_10017261 3300025940 Bacteria 6846
438 Ga0207691_10017886 3300025940 Bacteria 6717
439 Ga0207691_10029232 3300025940 Bacteria 5155
440 Ga0207691_10047697 3300025940 Bacteria 3930
441 Ga0207691_10053828 3300025940 Unclassified 3673
442 Ga0207711_10013401 3300025941 Bacteria 6811
443 Ga0207711_10029365 3300025941 Bacteria 4638
444 Ga0207711_10030219 3300025941 Bacteria 4569
445 Ga0207711_10058530 3300025941 Bacteria 3316
446 Ga0207711_10194143 3300025941 Bacteria 1851
447 Ga0207689_10003691 3300025942 Bacteria 13955
448 Ga0207689_10005495 3300025942 Bacteria 11335
449 Ga0207689_10053346 3300025942 Bacteria 3331
450 Ga0207689_10063362 3300025942 Bacteria 3041
451 Ga0207689_10073628 3300025942 Bacteria 2806
452 Ga0207689_10103859 3300025942 Bacteria 2335
453 Ga0207689_10118933 3300025942 Bacteria 2173
454 Ga0207679_10002502 3300025945 Bacteria 11310
455 Ga0207679_10098465 3300025945 Bacteria 2280
456 Ga0207679_10129992 3300025945 Bacteria 2019
457 Ga0207679_10199076 3300025945 Unclassified 1672
458 Ga0207651_10039344 3300025960 Bacteria 3118
459 Ga0207651_10042166 3300025960 Unclassified 3035
460 Ga0207651_10093854 3300025960 Bacteria 2205
461 Ga0207651_10148864 3300025960 Bacteria 1819
462 Ga0207712_10040288 3300025961 Bacteria 3205
463 Ga0207712_10071444 3300025961 Bacteria 2496
464 Ga0207658_10108959 3300025986 Unclassified 2186
465 Ga0207677_10095952 3300026023 Unclassified 2168
466 Ga0207703_10108976 3300026035 Bacteria 2359
467 Ga0207678_10119835 3300026067 Bacteria 2246
468 Ga0207708_10000407 3300026075 Bacteria 33931
469 Ga0207708_10007502 3300026075 Bacteria 8062
470 Ga0207708_10011519 3300026075 Bacteria 6588
471 Ga0207708_10011561 3300026075 Bacteria 6577
472 Ga0207708_10012596 3300026075 Bacteria 6307
473 Ga0207708_10093510 3300026075 Bacteria 2320
474 Ga0207708_10108857 3300026075 Unclassified 2150
475 Ga0207708_10116245 3300026075 Bacteria 2081
476 Ga0207708_10167880 3300026075 Unclassified 1736
477 Ga0207641_10065462 3300026088 Bacteria 3109
478 Ga0207641_10122166 3300026088 Unclassified 2326
479 Ga0207648_10010064 3300026089 Bacteria 8997
480 Ga0207648_10010332 3300026089 Bacteria 8853
481 Ga0207648_10023258 3300026089 Bacteria 5557
482 Ga0207648_10093071 3300026089 Unclassified 2636
483 Ga0207648_10151125 3300026089 Bacteria 2049
484 Ga0207676_10002745 3300026095 Bacteria 12536
485 Ga0207676_10024145 3300026095 Bacteria 4496
486 Ga0207676_10036298 3300026095 Unclassified 3748
487 Ga0207676_10041079 3300026095 Bacteria 3548
488 Ga0207674_10000212 3300026116 Bacteria 71941
489 Ga0207674_10023262 3300026116 Bacteria 6639
490 Ga0207674_10029270 3300026116 Bacteria 5799
491 Ga0207674_10034806 3300026116 Bacteria 5261
492 Ga0207674_10066371 3300026116 Bacteria 3635
493 Ga0207674_10125975 3300026116 Unclassified 2527
494 Ga0207675_100000123 3300026118 Bacteria 63809
495 Ga0207675_100001385 3300026118 Bacteria 24306
496 Ga0207675_100005217 3300026118 Bacteria 12504
497 Ga0207675_100024411 3300026118 Bacteria 5621
498 Ga0207675_100027207 3300026118 Bacteria 5326
499 Ga0207675_100035147 3300026118 Bacteria 4674
500 Ga0207675_100036602 3300026118 Bacteria 4577
501 Ga0207675_100043463 3300026118 Bacteria 4196
502 Ga0207675_100104686 3300026118 Bacteria 2667
503 Ga0207675_100247920 3300026118 Bacteria 1723
504 Ga0207683_10046303 3300026121 Unclassified 3806
505 Ga0207683_10083979 3300026121 Bacteria 2830
506 Ga0207683_10090352 3300026121 Unclassified 2727
507 Ga0207683_10100886 3300026121 Bacteria 2577
508 Ga0207683_10123255 3300026121 Unclassified 2328
509 Ga0207698_10082474 3300026142 Bacteria 2599
510 Ga0209588_1000002 3300027671 Bacteria 311181
511 Ga0207428_10001325 3300027907 Bacteria 26367
512 Ga0207428_10001771 3300027907 Bacteria 22132
513 Ga0207428_10001975 3300027907 Bacteria 20789
514 Ga0207428_10003636 3300027907 Bacteria 14864
515 Ga0207428_10029963 3300027907 Bacteria 4501
516 Ga0207428_10064499 3300027907 Unclassified 2891
517 Ga0268266_10043712 3300028379 Bacteria 3829
518 Ga0268266_10135405 3300028379 Bacteria 2206
519 Ga0268265_10000496 3300028380 Bacteria 40862
520 Ga0268265_10005282 3300028380 Bacteria 8844
521 Ga0268265_10028177 3300028380 Bacteria 4019
522 Ga0268265_10036080 3300028380 Bacteria 3619
523 Ga0268265_10109810 3300028380 Bacteria 2249
524 Ga0268264_10003836 3300028381 Bacteria 12891
525 Ga0268264_10067697 3300028381 Bacteria 3015
526 Ga0268264_10099671 3300028381 Bacteria 2522
527 Ga0268264_10132065 3300028381 Bacteria 2215
528 Ga0268264_10177885 3300028381 Unclassified 1930
529 Ga0265318_10001894 3300028577 Bacteria 11730
530 Ga0316181_1231862 3300030744 Bacteria 1809
531 Ga0265320_10003954 3300031240 Bacteria 9777
532 Ga0265329_10001843 3300031242 Bacteria 10038
533 Ga0265331_10002739 3300031250 Bacteria 11732
534 Ga0307513_10012393 3300031456 Bacteria 10530
535 Ga0307513_10167668 3300031456 Unclassified 2078
536 Ga0307513_10209893 3300031456 Bacteria 1780
537 Ga0307509_10070405 3300031507 Bacteria 3652
538 Ga0307408_100026071 3300031548 Bacteria 4009
539 Ga0307408_100035478 3300031548 Bacteria 3500
540 Ga0265314_10007412 3300031711 Bacteria 9513
541 Ga0265342_10008464 3300031712 Bacteria 7369
542 Ga0307516_10023256 3300031730 Bacteria 6356
543 Ga0307405_10026276 3300031731 Bacteria 3357
544 Ga0307410_10027247 3300031852 Bacteria 3610
545 Ga0307406_10007256 3300031901 Bacteria 6139
546 Ga0307406_10083136 3300031901 Bacteria 2134
547 Ga0307412_10013223 3300031911 Bacteria 4832
548 Ga0307409_100053230 3300031995 Unclassified 3109
549 Ga0307409_100137776 3300031995 Bacteria 2098
550 Ga0307416_100044419 3300032002 Bacteria 3489
551 Ga0307416_100318441 3300032002 Unclassified 1556
552 Ga0307411_10007176 3300032005 Bacteria 5648
553 Ga0307411_10052141 3300032005 Bacteria 2673
554 Ga0307415_100021926 3300032126 Bacteria 3934
555 Ga0307415_100076982 3300032126 Bacteria 2367
556 Ga0373935_0149437 3300035692 Bacteria 1584
557 Ga0373937_0035827 3300036401 Bacteria 4518
558 Ga0373937_0046013 3300036401 Bacteria 3989
559 Ga0373925_0085222 3300037068 Bacteria 2409
560 Ga0395899_0008685 3300037312 Bacteria 7822
561 Ga0395899_0029619 3300037312 Bacteria 4118
562 Ga0395899_0082664 3300037312 Bacteria 2335
563 Ga0395900_0006815 3300037418 Bacteria 11850
564 Ga0395900_0046715 3300037418 Bacteria 4458
565 Ga0395900_0052257 3300037418 Bacteria 4207
566 Ga0395900_0272975 3300037418 Unclassified 1685
567 Ga0395898_0034454 3300037466 Bacteria 5046
568 Ga0395898_0036908 3300037466 Bacteria 4850
569 Ga0395905_0020762 3300037471 Bacteria 6220
570 Ga0395905_0051363 3300037471 Bacteria 3862
571 Ga0395901_0007589 3300038443 Bacteria 10955
572 Ga0395901_0054418 3300038443 Bacteria 4159
573 Ga0395901_0259248 3300038443 Unclassified 1810
574 Ga0242420_008643 3300038996 Bacteria 1657
575 Ga0436365_0970387 3300039437 Bacteria 322356
576 Ga0436365_1425589 3300039437 Bacteria 204653
577 Ga0439453_0011808 3300041408 Bacteria 1462
578 Ga0451807_1088470 3300041486 Bacteria 3034
579 Ga0451837_0820317 3300041494 Bacteria 3194
580 Ga0439433_0016551 3300041999 Unclassified 1634
581 Ga0439448_0005793 3300042005 Unclassified 3530
582 Ga0439458_0010325 3300042157 Bacteria 2081
583 Ga0439434_0016504 3300042435 Bacteria 2207
584 Ga0451577_0000318 3300042876 Bacteria 90882
585 Ga0451577_0010028 3300042876 Bacteria 9074
586 Ga0466969_0004536 3300044656 Bacteria 7391
587 Ga0453683_0001007 3300044673 Bacteria 26457
588 Ga0466966_0015114 3300044684 Bacteria 5106
589 Ga0453684_0003262 3300044712 Bacteria 37059
590 Ga0466959_0028280 3300045049 Bacteria 4157
591 Ga0451576_0006803 3300045051 Bacteria 13896
592 Ga0451576_0022483 3300045051 Bacteria 6837
593 Ga0451576_0029530 3300045051 Bacteria 5865
594 Ga0451576_0081126 3300045051 Bacteria 3374
595 Ga0451576_0087026 3300045051 Unclassified 3250
596 Ga0495638_0026357 3300046460 Bacteria 3767
597 Ga0495610_0037426 3300046512 Bacteria 2470
598 Ga0495616_0003648 3300046513 Bacteria 9832
599 Ga0495663_0016961 3300046525 Bacteria 2062
600 Ga0495598_0002614 3300046537 Bacteria 3728
601 Ga0495621_0000521 3300046539 Bacteria 9511
602 Ga0495621_0001904 3300046539 Bacteria 5485
603 Ga0495621_0046587 3300046539 Bacteria 1539
604 Ga0495625_0046643 3300046660 Bacteria 3126
605 Ga0495625_0049433 3300046660 Bacteria 3023
606 Ga0495625_0089109 3300046660 Bacteria 2136
607 Ga0495625_0132996 3300046660 Bacteria 1684
608 Ga0495659_0001380 3300046664 Bacteria 8299
609 Ga0495659_0007904 3300046664 Unclassified 3374
610 Ga0495588_0005637 3300046674 Bacteria 5581
611 Ga0495588_0052834 3300046674 Bacteria 2095
612 Ga0495588_0066760 3300046674 Bacteria 1867
613 Ga0495599_0137757 3300046678 Bacteria 1515
614 Ga0495669_0021466 3300046684 Unclassified 2803
615 Ga0495669_0024329 3300046684 Bacteria 2638
616 Ga0495649_0005190 3300046694 Bacteria 8344
617 Ga0495636_0010194 3300047318 Bacteria 3707
618 Ga0495672_0000242 3300047320 Bacteria 76766
619 Ga0496102_0056747 3300048905 Unclassified 3573
620 Ga0496104_0035875 3300048907 Bacteria 4632
621 Ga0496104_0035944 3300048907 Bacteria 4628
622 Ga0496104_0196198 3300048907 Bacteria 1931
623 Ga0496104_0238794 3300048907 Bacteria 1729
624 Ga0496108_0029062 3300048911 Bacteria 4576
625 Ga0496108_0058046 3300048911 Bacteria 3252
626 Ga0496109_0106310 3300048912 Bacteria 2607
627 Ga0496110_0005764 3300048913 Bacteria 9731
628 Ga0496110_0016402 3300048913 Bacteria 6184
629 Ga0496110_0237119 3300048913 Bacteria 1660
630 Ga0496113_0216472 3300048916 Unclassified 1526
631 Ga0496114_0001537 3300048917 Bacteria 17479
632 Ga0496114_0023676 3300048917 Bacteria 5011
633 Ga0501291_011635 3300049514 Bacteria 1272
634 Ga0501296_000649 3300049519 Unclassified 3425
635 Ga0501298_000711 3300049521 Bacteria 4664
636 Ga0501299_000981 3300049522 Bacteria 3551
637 Ga0501034_0045839 3300049571 Bacteria 4417
638 Ga0501034_0060408 3300049571 Bacteria 3807
639 Ga0501038_0000313 3300049574 Bacteria 41503
640 Ga0501067_0055703 3300049583 Bacteria 2191
641 Ga0501069_0022009 3300049585 Bacteria 3464
642 Ga0501072_0079144 3300049588 Bacteria 2603
643 Ga0501074_0041342 3300049590 Bacteria 3338
644 Ga0501074_0125933 3300049590 Bacteria 1832
645 Ga0501216_009933 3300049660 Unclassified 1524
646 Ga0501253_000324 3300049683 Unclassified 3892
647 Ga0501225_0002474 3300049705 Bacteria 5710
648 Ga0501225_0024067 3300049705 Unclassified 1677
649 Ga0501234_000651 3300049707 Bacteria 5367
650 Ga0501079_0101206 3300049741 Bacteria 2234
651 Ga0501283_000915 3300049779 Bacteria 3918
652 Ga0501035_0000069 3300049822 Bacteria 128118
653 Ga0501045_0051931 3300049824 Bacteria 2992
654 Ga0501212_002966 3300049851 Bacteria 2090
655 nmdc:mga05p37_10432_c1 3300050507 Bacteria 11026
656 nmdc:mga05p37_120086_c1 3300050507 Unclassified 3229
657 nmdc:mga05p37_150371_c1 3300050507 Bacteria 2848
658 nmdc:mga05p37_233269_c1 3300050507 Unclassified 2216
659 nmdc:mga05p37_250436_c1 3300050507 Bacteria 2125
660 nmdc:mga05p37_4952_c1 3300050507 Bacteria 15605
661 nmdc:mga05p37_73120_c1 3300050507 Bacteria 4219
662 nmdc:mga05p37_75446_c1 3300050507 Bacteria 4150
663 nmdc:mga09592_15284_c1 3300050508 Bacteria 6269
664 nmdc:mga09592_66874_c1 3300050508 Bacteria 1743
665 nmdc:mga09592_94633_c1 3300050508 Unclassified 2200
666 nmdc:mga0qj67_35367_c1 3300050509 Bacteria 3905
667 nmdc:mga06r32_28654_c1 3300050510 Bacteria 5214
668 nmdc:mga08y16_124047_c1 3300050511 Unclassified 2687
669 nmdc:mga08y16_139475_c1 3300050511 Bacteria 2521
670 nmdc:mga08y16_144803_c1 3300050511 Unclassified 2470
671 nmdc:mga08y16_1574_c1 3300050511 Bacteria 23031
672 nmdc:mga08y16_32063_c1 3300050511 Bacteria 5525
673 nmdc:mga08y16_3239_c1 3300050511 Bacteria 16861
674 nmdc:mga08y16_4182_c1 3300050511 Bacteria 15078
675 nmdc:mga08y16_459_c1 3300050511 Bacteria 37980
676 nmdc:mga08y16_75154_c1 3300050511 Bacteria 3522
677 nmdc:mga08y16_7931_c1 3300050511 Bacteria 11114
678 nmdc:mga08y16_81203_c1 3300050511 Bacteria 3380
679 nmdc:mga08y16_81736_c1 3300050511 Unclassified 3368
680 nmdc:mga0n895_13706_c1 3300050512 Bacteria 7328
681 nmdc:mga0n895_149948_c1 3300050512 Bacteria 2362
682 nmdc:mga0n895_16357_c1 3300050512 Bacteria 6802
683 nmdc:mga0n895_32723_c1 3300050512 Bacteria 4992
684 nmdc:mga0n895_415657_c1 3300050512 Unclassified 1360
685 nmdc:mga0n895_77657_c1 3300050512 Bacteria 3303
686 nmdc:mga0rr50_104561_c1 3300050513 Unclassified 2231
687 nmdc:mga0rr50_114105_c1 3300050513 Unclassified 2142
688 nmdc:mga0rr50_14656_c1 3300050513 Bacteria 5149
689 nmdc:mga0rr50_74178_c1 3300050513 Unclassified 2603
690 nmdc:mga08x19_11139_c1 3300050514 Bacteria 5412
691 nmdc:mga0a205_134125_c1 3300050515 Bacteria 2377
692 nmdc:mga0a205_30511_c1 3300050515 Bacteria 4713
693 nmdc:mga0a205_4657_c1 3300050515 Bacteria 12303
694 nmdc:mga0a205_5083_c2 3300050515 Bacteria 10666
695 nmdc:mga0a205_57235_c1 3300050515 Bacteria 3765
696 nmdc:mga0a205_70271_c1 3300050515 Unclassified 3380
697 nmdc:mga0a205_8953_c1 3300050515 Bacteria 9124
698 Ga0495601_0020128 3300053077 Bacteria 4074
699 Ga0495619_0016447 3300053085 Bacteria 4683
700 Ga0495619_0021864 3300053085 Bacteria 4087
701 Ga0495619_0023124 3300053085 Bacteria 3982
702 Ga0500566_0002868 3300053094 Bacteria 10279
703 Ga0500640_004869 3300053095 Bacteria 4932
704 Ga0500554_000113 3300053102 Bacteria 15871
705 Ga0500572_002142 3300053111 Bacteria 4864
706 Ga0500595_000048 3300053119 Bacteria 88786
707 Ga0500614_000160 3300053123 Bacteria 17038
708 Ga0500637_0047060 3300053178 Bacteria 2450
709 Ga0501082_0036863 3300060353 Bacteria 4213
710 8036737102 8036736890 Bacteria 2944828
711 Ga0081539_10002347
712 CNAas_1000600
713 JGI24751J29686_10000008
714 JGI24751J29686_10000029
715 JGI24751J29686_10006592
716 JGI25406J46586_10002977
717 rootL2_10108056
718 rootL2_10224574
719 Ga0065714_10002184
720 Ga0065704_10003267
721 Ga0065712_10000112
722 Ga0065712_10005270
723 Ga0065712_10068461
724 Ga0065712_10068886
725 Ga0065712_10071888
726 Ga0065715_10000699
727 Ga0065715_10003134
728 Ga0065715_10003792
729 Ga0065715_10007644
730 Ga0065715_10031997
731 Ga0065715_10090585
732 Ga0065715_10100296
733 Ga0065715_10116072
734 Ga0065707_10002123
735 Ga0065707_10012232
736 Ga0065707_10084252
737 Ga0070658_10029152
738 Ga0070683_100231168
739 Ga0070683_100299374
740 Ga0070690_100006987
741 Ga0070690_100007654
742 Ga0070690_100102017
743 Ga0070670_100000441
744 Ga0070670_100011350
745 Ga0070670_100013662
746 Ga0068869_100039146
747 Ga0068869_100040945
748 Ga0068869_100049755
749 Ga0068869_100147569
750 Ga0068869_100149897
751 Ga0068869_100194065
752 Ga0070666_10026870
753 Ga0070666_10075664
754 Ga0070680_100014304
755 Ga0070680_100125665
756 Ga0070680_100164775
757 Ga0070682_100000221
758 Ga0070682_100015335
759 Ga0070682_100015530
760 Ga0070682_100038781
761 Ga0070660_100091792
762 Ga0070689_100006235
763 Ga0070689_100024610
764 Ga0070689_100028878
765 Ga0070687_100046334
766 Ga0070661_100057198
767 Ga0070692_10017291
768 Ga0070692_10022768
769 Ga0070669_100000596
770 Ga0070669_100003668
771 Ga0070669_100005683
772 Ga0070669_100007429
773 Ga0070669_100015783
774 Ga0070669_100030905
775 Ga0070669_100050286
776 Ga0070669_100091636
777 Ga0070669_100114545
778 Ga0070675_100004870
779 Ga0070675_100045224
780 Ga0070675_100067683
781 Ga0070675_100077782
782 Ga0070671_100003274
783 Ga0070674_100020994
784 Ga0070674_100160049
785 Ga0070673_100071385
786 Ga0070673_100080332
787 Ga0070673_100085960
788 Ga0070673_100097801
789 Ga0070688_100006787
790 Ga0070688_100056104
791 Ga0070688_100060957
792 Ga0070659_100005389
793 Ga0070659_100037695
794 Ga0070659_100065796
795 Ga0070659_100085086
796 Ga0070667_100086693
797 Ga0070667_100104047
798 Ga0070713_100128031
799 Ga0070701_10003933
800 Ga0070701_10017673
801 Ga0070701_10023358
802 Ga0070701_10024757
803 Ga0070701_10042749
804 Ga0070705_100000069
805 Ga0070705_100003580
806 Ga0070705_100102685
807 Ga0070705_100110743
808 Ga0070705_100116384
809 Ga0070700_100000142
810 Ga0070700_100008280
811 Ga0070700_100018203
812 Ga0070700_100032146
813 Ga0070700_100085438
814 Ga0070700_100089732
815 Ga0070694_100002234
816 Ga0070694_100005165
817 Ga0070694_100007103
818 Ga0070694_100008217
819 Ga0070694_100019730
820 Ga0070694_100019953
821 Ga0070694_100022309
822 Ga0070694_100039283
823 Ga0070663_100092206
824 Ga0070663_100106192
825 Ga0070681_10000648
826 Ga0070681_10003492
827 Ga0070681_10027560
828 Ga0068867_100006730
829 Ga0068867_100026504
830 Ga0070685_10092736
831 Ga0070706_100000358
832 Ga0070706_100055972
833 Ga0070707_100194784
834 Ga0070698_100000157
835 Ga0070698_100004660
836 Ga0070698_100016323
837 Ga0070698_100023349
838 Ga0070698_100035716
839 Ga0070698_100056983
840 Ga0070698_100121425
841 Ga0070699_100000233
842 Ga0070699_100002881
843 Ga0070699_100056302
844 Ga0070699_100073475
845 Ga0070679_100000701
846 Ga0070684_100000624
847 Ga0070684_100208267
848 Ga0070697_100000465
849 Ga0070697_100078031
850 Ga0070697_100109015
851 Ga0070697_100195184
852 Ga0068853_100219288
853 Ga0070672_100013688
854 Ga0070672_100039862
855 Ga0070672_100102196
856 Ga0070672_100123460
857 Ga0070672_100186138
858 Ga0070686_100001528
859 Ga0070686_100026625
860 Ga0070695_100000133
861 Ga0070695_100031055
862 Ga0070695_100157981
863 Ga0070696_100000157
864 Ga0070696_100008913
865 Ga0070696_100047055
866 Ga0070696_100108231
867 Ga0070693_100078516
868 Ga0070665_100002415
869 Ga0070665_100111132
870 Ga0070665_100114745
871 Ga0070704_100002688
872 Ga0070704_100066469
873 Ga0070704_100109379
874 Ga0070664_100011724
875 Ga0070664_100027028
876 Ga0070664_100027142
877 Ga0070664_100034565
878 Ga0068857_100006331
879 Ga0068857_100027572
880 Ga0068857_100066569
881 Ga0068857_100124472
882 Ga0068854_100022336
883 Ga0070702_100004164
884 Ga0068852_100098983
885 Ga0068852_100153214
886 Ga0068859_100001112
887 Ga0068859_100009962
888 Ga0068859_100026515
889 Ga0068859_100029645
890 Ga0068859_100030600
891 Ga0068859_100047901
892 Ga0068859_100071983
893 Ga0068859_100268431
894 Ga0068859_100345847
895 Ga0068864_100008126
896 Ga0068864_100008920
897 Ga0068864_100032588
898 Ga0068864_100096966
899 Ga0068861_100001096
900 Ga0068861_100001993
901 Ga0068861_100002135
902 Ga0068861_100014945
903 Ga0068861_100078441
904 Ga0068861_100124913
905 Ga0068870_10007427
906 Ga0068870_10036003
907 Ga0068870_10055967
908 Ga0068870_10084377
909 Ga0068863_100031139
910 Ga0068863_100036117
911 Ga0068858_100023336
912 Ga0068858_100042522
913 Ga0068860_100009290
914 Ga0068860_100014502
915 Ga0068860_100032631
916 Ga0068860_100046853
917 Ga0068860_100078166
918 Ga0068860_100084145
919 Ga0068860_100154559
920 Ga0068862_100001415
921 Ga0068862_100003399
922 Ga0068862_100013011
923 Ga0068862_100024998
924 Ga0068862_100029182
925 Ga0068862_100053414
926 Ga0068862_100073334
927 Ga0068862_100077555
928 Ga0068862_100161712
929 Ga0081455_10031169
930 Ga0081540_1040996
931 Ga0081539_10000697
932 Ga0081539_10001077
933 Ga0081539_10052045
934 Ga0097621_100001606
935 Ga0097621_100045640
936 Ga0097621_100063923
937 Ga0068871_100011512
938 Ga0068871_100071285
939 Ga0075428_100001500
940 Ga0075428_100059621
941 Ga0075428_100105421
942 Ga0075428_100171287
943 Ga0075428_100246071
944 Ga0075430_100023039
945 Ga0075430_100026280
946 Ga0075430_100033880
947 Ga0075430_100180056
948 Ga0075431_100046102
949 Ga0075431_100054037
950 Ga0075431_100100429
951 Ga0075431_100136039
952 Ga0075431_100137160
953 Ga0075431_100200470
954 Ga0075433_10002846
955 Ga0075433_10007914
956 Ga0075433_10013477
957 Ga0075433_10038809
958 Ga0075433_10105547
959 Ga0075433_10155092
960 Ga0075434_100017806
961 Ga0075434_100037528
962 Ga0075434_100039633
963 Ga0075434_100052614
964 Ga0075434_100058656
965 Ga0075434_100067351
966 Ga0075434_100097708
967 Ga0075429_100003654
968 Ga0075429_100024585
969 Ga0075429_100056874
970 Ga0075429_100135568
971 Ga0075429_100148325
972 Ga0068865_100046591
973 Ga0068865_100113692
974 Ga0075436_100014492
975 Ga0097620_100001112
976 Ga0097620_100009961
977 Ga0097620_100026517
978 Ga0097620_100029645
979 Ga0097620_100030599
980 Ga0097620_100047899
981 Ga0097620_100071985
982 Ga0097620_100268425
983 Ga0097620_100345852
984 Ga0075435_100016200
985 Ga0075435_100033046
986 Ga0075435_100069081
987 Ga0075435_100078069
988 Ga0075435_100104264
989 Ga0099794_10000002
990 Ga0111539_10000111
991 Ga0111539_10000210
992 Ga0111539_10000439
993 Ga0111539_10000971
994 Ga0111539_10001366
995 Ga0111539_10006179
996 Ga0111539_10012778
997 Ga0111539_10017109
998 Ga0111539_10027015
999 Ga0111539_10029914
1000 Ga0111539_10045777
1001 Ga0111539_10058180
1002 Ga0111539_10090820
1003 Ga0111539_10099408
1004 Ga0111539_10108101
1005 Ga0111539_10110723
1006 Ga0111539_10121713
1007 Ga0111539_10148876
1008 Ga0111539_10209230
1009 Ga0111539_10363610
1010 Ga0105247_10013987
1011 Ga0114129_10002087
1012 Ga0114129_10002485
1013 Ga0114129_10003094
1014 Ga0114129_10010636
1015 Ga0114129_10015717
1016 Ga0114129_10044963
1017 Ga0114129_10046587
1018 Ga0114129_10072222
1019 Ga0114129_10075632
1020 Ga0114129_10092326
1021 Ga0114129_10164051
1022 Ga0114129_10343031
1023 Ga0105243_10006485
1024 Ga0105243_10026136
1025 Ga0105241_10092594
1026 Ga0105242_10012040
1027 Ga0105242_10080604
1028 Ga0105248_10009157
1029 Ga0105248_10012932
1030 Ga0105248_10087253
1031 Ga0105248_10095123
1032 Ga0105248_10110809
1033 Ga0105248_10261604
1034 Ga0105237_10006392
1035 Ga0105237_10249925
1036 Ga0105238_10027231
1037 Ga0105238_10083989
1038 Ga0105249_10001872
1039 Ga0105249_10010932
1040 Ga0105249_10025005
1041 Ga0105249_10060071
1042 Ga0105246_10054105
1043 Ga0105246_10185664
1044 Ga0157373_10001131
1045 Ga0157373_10070304
1046 Ga0157373_10116112
1047 Ga0157374_10004256
1048 Ga0157374_10091168
1049 Ga0157374_10183552
1050 Ga0157378_10001387
1051 Ga0157378_10008309
1052 Ga0157378_10098477
1053 Ga0163162_10000831
1054 Ga0163162_10011502
1055 Ga0157372_10103028
1056 Ga0157372_10389068
1057 Ga0157375_10005745
1058 Ga0157375_10040496
1059 Ga0157375_10051941
1060 Ga0157375_10255222
1061 Ga0163163_10001143
1062 Ga0163163_10004205
1063 Ga0163163_10008266
1064 Ga0163163_10009645
1065 Ga0163163_10015400
1066 Ga0163163_10018485
1067 Ga0163163_10054460
1068 Ga0163163_10128163
1069 Ga0163163_10134466
1070 Ga0163163_10257315
1071 Ga0157380_10000909
1072 Ga0157380_10002457
1073 Ga0157380_10020641
1074 Ga0157380_10037741
1075 Ga0157380_10045401
1076 Ga0157380_10090476
1077 Ga0157380_10117573
1078 Ga0157380_10221431
1079 Ga0157376_10050916
1080 Ga0163161_10066175
1081 Ga0213876_10000011
1082 Ga0213876_10000343
1083 Ga0207653_10032978
1084 Ga0207682_10001843
1085 Ga0207710_10000434
1086 Ga0207688_10002099
1087 Ga0207680_10012734
1088 Ga0207680_10049689
1089 Ga0207647_10004280
1090 Ga0207647_10038816
1091 Ga0207645_10045943
1092 Ga0207645_10057358
1093 Ga0207645_10091977
1094 Ga0207643_10012974
1095 Ga0207643_10018004
1096 Ga0207643_10019237
1097 Ga0207643_10035213
1098 Ga0207643_10061848
1099 Ga0207643_10069726
1100 Ga0207705_10029201
1101 Ga0207684_10000168
1102 Ga0207684_10130456
1103 Ga0207654_10109721
1104 Ga0207707_10000118
1105 Ga0207707_10031984
1106 Ga0207660_10017584
1107 Ga0207660_10132212
1108 Ga0207660_10165276
1109 Ga0207662_10048246
1110 Ga0207657_10047269
1111 Ga0207657_10087306
1112 Ga0207649_10068826
1113 Ga0207652_10000634
1114 Ga0207681_10003145
1115 Ga0207681_10005803
1116 Ga0207681_10025763
1117 Ga0207681_10054565
1118 Ga0207681_10105987
1119 Ga0207694_10012283
1120 Ga0207650_10000087
1121 Ga0207650_10003638
1122 Ga0207659_10000237
1123 Ga0207659_10026525
1124 Ga0207659_10063938
1125 Ga0207659_10085525
1126 Ga0207659_10104181
1127 Ga0207687_10076650
1128 Ga0207700_10101283
1129 Ga0207644_10019008
1130 Ga0207644_10076943
1131 Ga0207690_10012371
1132 Ga0207706_10017194
1133 Ga0207686_10062800
1134 Ga0207686_10124872
1135 Ga0207709_10003343
1136 Ga0207709_10038304
1137 Ga0207670_10003941
1138 Ga0207670_10061206
1139 Ga0207670_10077946
1140 Ga0207670_10131201
1141 Ga0207669_10030503
1142 Ga0207669_10118672
1143 Ga0207704_10055024
1144 Ga0207704_10067527
1145 Ga0207704_10080237
1146 Ga0207691_10005905
1147 Ga0207691_10017261
1148 Ga0207691_10017886
1149 Ga0207691_10029232
1150 Ga0207691_10047697
1151 Ga0207691_10053828
1152 Ga0207711_10013401
1153 Ga0207711_10029365
1154 Ga0207711_10030219
1155 Ga0207711_10058530
1156 Ga0207711_10194143
1157 Ga0207689_10003691
1158 Ga0207689_10005495
1159 Ga0207689_10053346
1160 Ga0207689_10063362
1161 Ga0207689_10073628
1162 Ga0207689_10103859
1163 Ga0207689_10118933
1164 Ga0207679_10002502
1165 Ga0207679_10098465
1166 Ga0207679_10129992
1167 Ga0207679_10199076
1168 Ga0207651_10039344
1169 Ga0207651_10042166
1170 Ga0207651_10093854
1171 Ga0207651_10148864
1172 Ga0207712_10040288
1173 Ga0207712_10071444
1174 Ga0207658_10108959
1175 Ga0207677_10095952
1176 Ga0207703_10108976
1177 Ga0207678_10119835
1178 Ga0207708_10000407
1179 Ga0207708_10007502
1180 Ga0207708_10011519
1181 Ga0207708_10011561
1182 Ga0207708_10012596
1183 Ga0207708_10093510
1184 Ga0207708_10108857
1185 Ga0207708_10116245
1186 Ga0207708_10167880
1187 Ga0207641_10065462
1188 Ga0207641_10122166
1189 Ga0207648_10010064
1190 Ga0207648_10010332
1191 Ga0207648_10023258
1192 Ga0207648_10093071
1193 Ga0207648_10151125
1194 Ga0207676_10002745
1195 Ga0207676_10024145
1196 Ga0207676_10036298
1197 Ga0207676_10041079
1198 Ga0207674_10000212
1199 Ga0207674_10023262
1200 Ga0207674_10029270
1201 Ga0207674_10034806
1202 Ga0207674_10066371
1203 Ga0207674_10125975
1204 Ga0207675_100000123
1205 Ga0207675_100001385
1206 Ga0207675_100005217
1207 Ga0207675_100024411
1208 Ga0207675_100027207
1209 Ga0207675_100035147
1210 Ga0207675_100036602
1211 Ga0207675_100043463
1212 Ga0207675_100104686
1213 Ga0207675_100247920
1214 Ga0207683_10046303
1215 Ga0207683_10083979
1216 Ga0207683_10090352
1217 Ga0207683_10100886
1218 Ga0207683_10123255
1219 Ga0207698_10082474
1220 Ga0209588_1000002
1221 Ga0207428_10001325
1222 Ga0207428_10001771
1223 Ga0207428_10001975
1224 Ga0207428_10003636
1225 Ga0207428_10029963
1226 Ga0207428_10064499
1227 Ga0268266_10043712
1228 Ga0268266_10135405
1229 Ga0268265_10000496
1230 Ga0268265_10005282
1231 Ga0268265_10028177
1232 Ga0268265_10036080
1233 Ga0268265_10109810
1234 Ga0268264_10003836
1235 Ga0268264_10067697
1236 Ga0268264_10099671
1237 Ga0268264_10132065
1238 Ga0268264_10177885
1239 Ga0265318_10001894
1240 Ga0316181_1231862
1241 Ga0265320_10003954
1242 Ga0265329_10001843
1243 Ga0265331_10002739
1244 Ga0307513_10012393
1245 Ga0307513_10167668
1246 Ga0307513_10209893
1247 Ga0307509_10070405
1248 Ga0307408_100026071
1249 Ga0307408_100035478
1250 Ga0265314_10007412
1251 Ga0265342_10008464
1252 Ga0307516_10023256
1253 Ga0307405_10026276
1254 Ga0307410_10027247
1255 Ga0307406_10007256
1256 Ga0307406_10083136
1257 Ga0307412_10013223
1258 Ga0307409_100053230
1259 Ga0307409_100137776
1260 Ga0307416_100044419
1261 Ga0307416_100318441
1262 Ga0307411_10007176
1263 Ga0307411_10052141
1264 Ga0307415_100021926
1265 Ga0307415_100076982
1266 Ga0373935_0149437
1267 Ga0373937_0035827
1268 Ga0373937_0046013
1269 Ga0373925_0085222
1270 Ga0395899_0008685
1271 Ga0395899_0029619
1272 Ga0395899_0082664
1273 Ga0395900_0006815
1274 Ga0395900_0046715
1275 Ga0395900_0052257
1276 Ga0395900_0272975
1277 Ga0395898_0034454
1278 Ga0395898_0036908
1279 Ga0395905_0020762
1280 Ga0395905_0051363
1281 Ga0395901_0007589
1282 Ga0395901_0054418
1283 Ga0395901_0259248
1284 Ga0242420_008643
1285 Ga0436365_0970387
1286 Ga0436365_1425589
1287 Ga0439453_0011808
1288 Ga0451807_1088470
1289 Ga0451837_0820317
1290 Ga0439433_0016551
1291 Ga0439448_0005793
1292 Ga0439458_0010325
1293 Ga0439434_0016504
1294 Ga0451577_0000318
1295 Ga0451577_0010028
1296 Ga0466969_0004536
1297 Ga0453683_0001007
1298 Ga0466966_0015114
1299 Ga0453684_0003262
1300 Ga0466959_0028280
1301 Ga0451576_0006803
1302 Ga0451576_0022483
1303 Ga0451576_0029530
1304 Ga0451576_0081126
1305 Ga0451576_0087026
1306 Ga0495638_0026357
1307 Ga0495610_0037426
1308 Ga0495616_0003648
1309 Ga0495663_0016961
1310 Ga0495598_0002614
1311 Ga0495621_0000521
1312 Ga0495621_0001904
1313 Ga0495621_0046587
1314 Ga0495625_0046643
1315 Ga0495625_0049433
1316 Ga0495625_0089109
1317 Ga0495625_0132996
1318 Ga0495659_0001380
1319 Ga0495659_0007904
1320 Ga0495588_0005637
1321 Ga0495588_0052834
1322 Ga0495588_0066760
1323 Ga0495599_0137757
1324 Ga0495669_0021466
1325 Ga0495669_0024329
1326 Ga0495649_0005190
1327 Ga0495636_0010194
1328 Ga0495672_0000242
1329 Ga0496102_0056747
1330 Ga0496104_0035875
1331 Ga0496104_0035944
1332 Ga0496104_0196198
1333 Ga0496104_0238794
1334 Ga0496108_0029062
1335 Ga0496108_0058046
1336 Ga0496109_0106310
1337 Ga0496110_0005764
1338 Ga0496110_0016402
1339 Ga0496110_0237119
1340 Ga0496113_0216472
1341 Ga0496114_0001537
1342 Ga0496114_0023676
1343 Ga0501291_011635
1344 Ga0501296_000649
1345 Ga0501298_000711
1346 Ga0501299_000981
1347 Ga0501034_0045839
1348 Ga0501034_0060408
1349 Ga0501038_0000313
1350 Ga0501067_0055703
1351 Ga0501069_0022009
1352 Ga0501072_0079144
1353 Ga0501074_0041342
1354 Ga0501074_0125933
1355 Ga0501216_009933
1356 Ga0501253_000324
1357 Ga0501225_0002474
1358 Ga0501225_0024067
1359 Ga0501234_000651
1360 Ga0501079_0101206
1361 Ga0501283_000915
1362 Ga0501035_0000069
1363 Ga0501045_0051931
1364 Ga0501212_002966
1365 nmdc:mga05p37_10432_c1
1366 nmdc:mga05p37_120086_c1
1367 nmdc:mga05p37_150371_c1
1368 nmdc:mga05p37_233269_c1
1369 nmdc:mga05p37_250436_c1
1370 nmdc:mga05p37_4952_c1
1371 nmdc:mga05p37_73120_c1
1372 nmdc:mga05p37_75446_c1
1373 nmdc:mga09592_15284_c1
1374 nmdc:mga09592_66874_c1
1375 nmdc:mga09592_94633_c1
1376 nmdc:mga0qj67_35367_c1
1377 nmdc:mga06r32_28654_c1
1378 nmdc:mga08y16_124047_c1
1379 nmdc:mga08y16_139475_c1
1380 nmdc:mga08y16_144803_c1
1381 nmdc:mga08y16_1574_c1
1382 nmdc:mga08y16_32063_c1
1383 nmdc:mga08y16_3239_c1
1384 nmdc:mga08y16_4182_c1
1385 nmdc:mga08y16_459_c1
1386 nmdc:mga08y16_75154_c1
1387 nmdc:mga08y16_7931_c1
1388 nmdc:mga08y16_81203_c1
1389 nmdc:mga08y16_81736_c1
1390 nmdc:mga0n895_13706_c1
1391 nmdc:mga0n895_149948_c1
1392 nmdc:mga0n895_16357_c1
1393 nmdc:mga0n895_32723_c1
1394 nmdc:mga0n895_415657_c1
1395 nmdc:mga0n895_77657_c1
1396 nmdc:mga0rr50_104561_c1
1397 nmdc:mga0rr50_114105_c1
1398 nmdc:mga0rr50_14656_c1
1399 nmdc:mga0rr50_74178_c1
1400 nmdc:mga08x19_11139_c1
1401 nmdc:mga0a205_134125_c1
1402 nmdc:mga0a205_30511_c1
1403 nmdc:mga0a205_4657_c1
1404 nmdc:mga0a205_5083_c2
1405 nmdc:mga0a205_57235_c1
1406 nmdc:mga0a205_70271_c1
1407 nmdc:mga0a205_8953_c1
1408 Ga0495601_0020128
1409 Ga0495619_0016447
1410 Ga0495619_0021864
1411 Ga0495619_0023124
1412 Ga0500566_0002868
1413 Ga0500640_004869
1414 Ga0500554_000113
1415 Ga0500572_002142
1416 Ga0500595_000048
1417 Ga0500614_000160
1418 Ga0500637_0047060
1419 Ga0501082_0036863
1420 8036737102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

322

513

0.87

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

340

514

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9598 8 438
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.9427 8 438
1lfw-assembly1.cif.gz_A crystal structure of pepv 0.8269 236 314
2anp-assembly1.cif.gz_A functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. 0.8089 235 435
1tkj-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with d-methionine 0.8054 232 432
ID Description Score Start End Superfamily
af_Q54MN6_157_296_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9959 83 225 3.40.630.10
af_Q9Y646_117_259_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9931 83 225 3.40.630.10
af_Q54MN6_157_296_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9889 83 225 3.40.630.10
af_Q9Y646_117_259_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9862 83 225 3.40.630.10
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9583 8 438 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7W0JIA6-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9932 8 438 GO:0004180
GO:0005615
GO:0005764
GO:0006508
GO:0043171
GO:0070573
AF-A0A6V7LU19-F1-model_v4 Uncharacterized protein 0.9907 132 214 GO:0005615
GO:0006508
GO:0043171
GO:0070573
AF-A0A7Y5WUK9-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9906 9 438 GO:0004180
GO:0005615
GO:0005764
GO:0006508
GO:0043171
GO:0070573
AF-A0A7W0JIA6-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9886 8 438 GO:0004180
GO:0005615
GO:0005764
GO:0006508
GO:0043171
GO:0070573
AF-A0A382K474-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9884 9 314 GO:0004180
GO:0005615
GO:0005764
GO:0005783
GO:0005794
GO:0006508
GO:0043171
GO:0070573

Map