F476657

General Info

Members Datasets Scaffolds Average Seq Length
709 390 660 167

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10044420|Ga0307513_100444205
Length 201
Sequence MTTSSPPPGASLSAARXXEGANAPSGGSEVRAATSVGALFLDAEALYRELLRGVQQLHTPQTKLVGVTSGGAWLVERLHADLKLAEPPNIISSAMHRDDFSKRGLVSGGRGQTTLNFDVNGAEILLLDDVLYTGRTIRAVLNELFDYGRPASVKLAVLVDRGGRELPVQADFAAARVALASTQLLALAHDNTGGFSFKVEG

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221609 Acidovorax sp. Root217 Isolate Unclassified
7 2643221611 Acidovorax sp. Root219 Isolate Unclassified
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2738541277 Variovorax sp. GV051 Isolate Unclassified
13 2738541307 Variovorax sp. GV008 Isolate Unclassified
14 2738543012 Acidovorax sp. CF301 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2816332133 Acidovorax radicis 2721A Isolate Unclassified
18 2818991446 Variovorax sp. 1180 Isolate Unclassified
19 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
20 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
21 2842677519 Variovorax sp. R-72495 Isolate Unclassified
22 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
23 2842733646 Variovorax sp. R-72446 Isolate Unclassified
24 2842747753 Variovorax sp. R-72060 Isolate Unclassified
25 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
26 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
27 2885198086 Variovorax sp. 679 Isolate Unclassified
28 2885211737 Variovorax sp. 553 Isolate Unclassified
29 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
30 2899924645 Variovorax sp. 369 Isolate Unclassified
31 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
32 2904456579 Variovorax sp. 2002 Isolate Unclassified
33 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
34 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
35 2928037797 Variovorax sp. 1126 Isolate Unclassified
36 2928044640 Variovorax sp. 1128 Isolate Unclassified
37 2928051484 Variovorax sp. 1133 Isolate Unclassified
38 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
39 2928070936 Variovorax gossypii 1167 Isolate Unclassified
40 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
41 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
42 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
43 2929520902 Variovorax beijingensis 502 Isolate Unclassified
44 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
45 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
46 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
47 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
48 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
49 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
50 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
58 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
59 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
149 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
151 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
154 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
162 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
207 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
208 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
209 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
210 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
211 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
212 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
213 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
243 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
244 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
245 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
250 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
253 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
254 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
255 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
256 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
257 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
258 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
259 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
260 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
261 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
262 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
263 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
264 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
265 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
266 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
267 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
268 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
269 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
270 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
271 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
272 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
275 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
276 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
277 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
280 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
281 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
282 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
283 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
289 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
290 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
295 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
296 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
312 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
313 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
314 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
348 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
349 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
350 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
351 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
354 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
364 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
365 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
366 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
369 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
370 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
371 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
372 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
373 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
374 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
375 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
376 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
377 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
378 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
379 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
382 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
383 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
384 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
385 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
386 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
389 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 0.28
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.93
Nodule 0.71
Rhizoplane 2.4
Rhizosphere 58.39
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003589 3300001979 Bacteria 6768
2 JGI24739J22299_10083173 3300001989 Bacteria 981
3 JGI25158J39367_1003768 3300002739 Bacteria 2313
4 JGI25150J39212_1007118 3300002774 Bacteria 2267
5 JGI25159J45721_1013528 3300002987 Bacteria 1882
6 JGI25151J46595_10010236 3300003187 Bacteria 4371
7 JGI25151J46595_10037898 3300003187 Bacteria 1802
8 Ga0006562J51391_1132144 3300003578 Bacteria 3632
9 Ga0006562J51391_1132145 3300003578 Bacteria 2670
10 Ga0055527_1014536 3300003760 Bacteria 866
11 Ga0055535_1001590 3300003761 Bacteria 10852
12 Ga0055542_1000036 3300003762 Bacteria 227346
13 Ga0055537_1000555 3300003773 Bacteria 21167
14 Ga0055536_1009989 3300003781 Bacteria 3837
15 Ga0055536_1032144 3300003781 Bacteria 1362
16 Ga0055534_1000153 3300003784 Bacteria 51189
17 Ga0055534_1000465 3300003784 Bacteria 23108
18 Ga0055528_1000291 3300003790 Bacteria 42773
19 Ga0055528_1023606 3300003790 Bacteria 1870
20 Ga0055530_10002388 3300003791 Bacteria 12164
21 Ga0055530_10021424 3300003791 Bacteria 1905
22 Ga0055540_1011297 3300003792 Bacteria 2890
23 Ga0055540_1017998 3300003792 Bacteria 1952
24 Ga0055540_1031421 3300003792 Bacteria 1219
25 Ga0055531_10000452 3300003794 Bacteria 38120
26 Ga0055531_10020418 3300003794 Bacteria 2621
27 Ga0055543_1001133 3300004625 Bacteria 11427
28 Ga0055543_1017654 3300004625 Bacteria 1339
29 Ga0065165_1001031 3300005262 Bacteria 33766
30 Ga0065165_1129929 3300005262 Bacteria 603
31 Ga0065714_10013668 3300005288 Bacteria 3073
32 Ga0065704_10020258 3300005289 Bacteria 1433
33 Ga0070658_10230320 3300005327 Bacteria 1569
34 Ga0070658_10528064 3300005327 Bacteria 1020
35 Ga0070658_11281683 3300005327 Bacteria 636
36 Ga0068869_100084256 3300005334 Bacteria 2379
37 Ga0068869_100995427 3300005334 Bacteria 730
38 Ga0070666_10019943 3300005335 Bacteria 4331
39 Ga0068868_100157144 3300005338 Bacteria 1876
40 Ga0068868_100276740 3300005338 Bacteria 1419
41 Ga0068868_101337172 3300005338 Bacteria 666
42 Ga0070660_100049803 3300005339 Bacteria 3222
43 Ga0070668_101563388 3300005347 Bacteria 604
44 Ga0070669_100041408 3300005353 Bacteria 3350
45 Ga0070675_100276062 3300005354 Bacteria 1476
46 Ga0070674_100169631 3300005356 Bacteria 1662
47 Ga0070673_100150109 3300005364 Bacteria 1973
48 Ga0070673_101514889 3300005364 Bacteria 633
49 Ga0070659_100720456 3300005366 Bacteria 864
50 Ga0070667_100056587 3300005367 Bacteria 3313
51 Ga0070714_100389048 3300005435 Bacteria 1316
52 Ga0070663_100741519 3300005455 Bacteria 838
53 Ga0070678_100078537 3300005456 Bacteria 2493
54 Ga0070678_100087959 3300005456 Bacteria 2374
55 Ga0070678_100146237 3300005456 Bacteria 1898
56 Ga0070662_100023748 3300005457 Bacteria 4216
57 Ga0070662_100294980 3300005457 Bacteria 1315
58 Ga0070681_10183730 3300005458 Bacteria 2012
59 Ga0068867_100899544 3300005459 Bacteria 796
60 Ga0070679_100003351 3300005530 Bacteria 14680
61 Ga0070679_100238893 3300005530 Bacteria 1775
62 Ga0068853_100117976 3300005539 Bacteria 2364
63 Ga0070672_100156490 3300005543 Bacteria 1888
64 Ga0070672_100317895 3300005543 Bacteria 1323
65 Ga0070672_100843335 3300005543 Bacteria 808
66 Ga0070665_100001342 3300005548 Bacteria 29261
67 Ga0070665_100074863 3300005548 Bacteria 3392
68 Ga0068855_100005901 3300005563 Bacteria 14932
69 Ga0068855_100067788 3300005563 Bacteria 4155
70 Ga0068855_100088468 3300005563 Bacteria 3577
71 Ga0070664_100011880 3300005564 Bacteria 7069
72 Ga0068857_100007211 3300005577 Bacteria 9573
73 Ga0068857_100278939 3300005577 Bacteria 1537
74 Ga0068857_100373630 3300005577 Bacteria 1323
75 Ga0068857_100552560 3300005577 Bacteria 1085
76 Ga0068854_101338760 3300005578 Bacteria 646
77 Ga0068856_100276443 3300005614 Bacteria 1696
78 Ga0068852_100074659 3300005616 Bacteria 2987
79 Ga0068852_100105559 3300005616 Bacteria 2553
80 Ga0068859_100866412 3300005617 Bacteria 989
81 Ga0068866_10575434 3300005718 Bacteria 757
82 Ga0068851_10014073 3300005834 Bacteria 3793
83 Ga0068863_100067610 3300005841 Bacteria 3380
84 Ga0068862_100324040 3300005844 Bacteria 1423
85 Ga0068862_101186363 3300005844 Bacteria 761
86 Ga0075365_10010759 3300006038 Bacteria 5345
87 Ga0075365_10026066 3300006038 Bacteria 3706
88 Ga0075365_10046973 3300006038 Bacteria 2837
89 Ga0075365_10054918 3300006038 Bacteria 2642
90 Ga0075368_10003556 3300006042 Bacteria 5220
91 Ga0075363_100010260 3300006048 Bacteria 4437
92 Ga0075363_100017158 3300006048 Bacteria 3586
93 Ga0075363_100133765 3300006048 Bacteria 1392
94 Ga0075363_100155634 3300006048 Bacteria 1292
95 Ga0075363_100200977 3300006048 Bacteria 1139
96 Ga0075363_100658257 3300006048 Bacteria 630
97 Ga0075364_10050216 3300006051 Bacteria 2722
98 Ga0075364_10104419 3300006051 Bacteria 1887
99 Ga0075362_10009998 3300006177 Bacteria 3689
100 Ga0075362_10016579 3300006177 Bacteria 3019
101 Ga0075362_10044230 3300006177 Bacteria 1974
102 Ga0075362_10045758 3300006177 Bacteria 1944
103 Ga0075362_10054707 3300006177 Bacteria 1794
104 Ga0075367_10024343 3300006178 Bacteria 3413
105 Ga0075367_10069662 3300006178 Bacteria 2112
106 Ga0075367_10442482 3300006178 Bacteria 823
107 Ga0075369_10011519 3300006186 Bacteria 3481
108 Ga0075366_10000589 3300006195 Bacteria 16965
109 Ga0075366_10059307 3300006195 Bacteria 2273
110 Ga0075366_10071595 3300006195 Bacteria 2065
111 Ga0075366_10110206 3300006195 Bacteria 1655
112 Ga0075366_10129934 3300006195 Bacteria 1520
113 Ga0075366_10242191 3300006195 Bacteria 1099
114 Ga0075366_10487844 3300006195 Bacteria 761
115 Ga0075366_10736434 3300006195 Bacteria 612
116 Ga0097621_100777563 3300006237 Bacteria 886
117 Ga0075370_10001649 3300006353 Bacteria 9855
118 Ga0075370_10002258 3300006353 Bacteria 8872
119 Ga0075370_10009173 3300006353 Bacteria 5123
120 Ga0075370_10017268 3300006353 Bacteria 3898
121 Ga0075370_10041778 3300006353 Bacteria 2589
122 Ga0075370_10043241 3300006353 Bacteria 2546
123 Ga0075370_10089862 3300006353 Bacteria 1771
124 Ga0075370_10112371 3300006353 Bacteria 1582
125 Ga0075370_10167614 3300006353 Bacteria 1290
126 Ga0097620_100866423 3300006931 Bacteria 989
127 Ga0099826_10026745 3300006948 Bacteria 4250
128 Ga0099826_10446520 3300006948 Bacteria 617
129 Ga0105244_10027858 3300009036 Bacteria 3039
130 Ga0105244_10100182 3300009036 Bacteria 1418
131 Ga0105244_10117325 3300009036 Bacteria 1291
132 Ga0105244_10252782 3300009036 Bacteria 821
133 Ga0105240_10003014 3300009093 Bacteria 26498
134 Ga0105240_10132454 3300009093 Bacteria 2989
135 Ga0105240_10938232 3300009093 Bacteria 929
136 Ga0105240_11156642 3300009093 Bacteria 821
137 Ga0105245_10138838 3300009098 Bacteria 2287
138 Ga0105245_11068095 3300009098 Bacteria 853
139 Ga0105247_10426243 3300009101 Bacteria 951
140 Ga0105243_10014356 3300009148 Bacteria 5995
141 Ga0105243_10063082 3300009148 Bacteria 2969
142 Ga0105243_10122514 3300009148 Bacteria 2195
143 Ga0105243_10913664 3300009148 Bacteria 874
144 Ga0105241_10117544 3300009174 Bacteria 2137
145 Ga0105241_10410532 3300009174 Bacteria 1190
146 Ga0105241_10482392 3300009174 Bacteria 1102
147 Ga0105237_10001471 3300009545 Bacteria 31034
148 Ga0105237_11052568 3300009545 Bacteria 820
149 Ga0105238_10026974 3300009551 Bacteria 5855
150 Ga0105238_10048663 3300009551 Bacteria 4271
151 Ga0105238_10133660 3300009551 Bacteria 2459
152 Ga0105238_10216769 3300009551 Bacteria 1890
153 Ga0105249_11071879 3300009553 Bacteria 875
154 Ga0105239_10002779 3300010375 Bacteria 21928
155 Ga0105239_10113368 3300010375 Bacteria 3007
156 Ga0105239_10591978 3300010375 Bacteria 1265
157 Ga0105246_10366770 3300011119 Bacteria 1185
158 Ga0105246_11175429 3300011119 Bacteria 705
159 Ga0157345_1016110 3300012498 Bacteria 715
160 Ga0157373_10434712 3300013100 Bacteria 943
161 Ga0157371_10026087 3300013102 Bacteria 4251
162 Ga0157370_10532596 3300013104 Bacteria 1077
163 Ga0157369_10029769 3300013105 Bacteria 6030
164 Ga0157378_10114643 3300013297 Bacteria 2476
165 Ga0163162_10030214 3300013306 Bacteria 5369
166 Ga0157372_10323504 3300013307 Bacteria 1795
167 Ga0157375_10424561 3300013308 Bacteria 1495
168 Ga0182008_10000191 3300014497 Bacteria 48580
169 Ga0182008_10008989 3300014497 Bacteria 5413
170 Ga0182008_10022737 3300014497 Bacteria 3209
171 Ga0182008_10076861 3300014497 Bacteria 1643
172 Ga0157377_10731483 3300014745 Bacteria 722
173 Ga0157379_10404697 3300014968 Bacteria 1255
174 Ga0157376_10324969 3300014969 Bacteria 1464
175 Ga0157376_11621233 3300014969 Bacteria 681
176 Ga0182006_1010781 3300015261 Bacteria 4048
177 Ga0182007_10001495 3300015262 Bacteria 12514
178 Ga0182007_10005458 3300015262 Bacteria 5581
179 Ga0182007_10026502 3300015262 Bacteria 2008
180 Ga0182007_10106535 3300015262 Bacteria 931
181 Ga0183362_10005 3300015683 Bacteria 437616
182 Ga0163161_10066688 3300017792 Bacteria 2629
183 Ga0163161_10258708 3300017792 Bacteria 1359
184 Ga0163161_10461403 3300017792 Bacteria 1028
185 Ga0213872_10034761 3300021361 Bacteria 2306
186 Ga0209672_100321 3300025228 Bacteria 31338
187 Ga0209147_100434 3300025229 Bacteria 26862
188 Ga0209258_100091 3300025242 Bacteria 227454
189 Ga0207425_1000190 3300025245 Bacteria 49963
190 Ga0207425_1016639 3300025245 Bacteria 1629
191 Ga0209148_1000033 3300025254 Bacteria 555508
192 Ga0209129_1000091 3300025258 Bacteria 175716
193 Ga0209129_1001462 3300025258 Bacteria 13171
194 Ga0209129_1002158 3300025258 Bacteria 9947
195 Ga0209565_1000020 3300025263 Bacteria 432627
196 Ga0209565_1000335 3300025263 Bacteria 41834
197 Ga0209565_1004510 3300025263 Bacteria 4213
198 Ga0209673_1000072 3300025273 Bacteria 236935
199 Ga0209673_1000154 3300025273 Bacteria 146394
200 Ga0209673_1002551 3300025273 Bacteria 12441
201 Ga0209673_1002946 3300025273 Bacteria 10686
202 Ga0209673_1044171 3300025273 Bacteria 1236
203 Ga0209130_1000140 3300025284 Bacteria 115434
204 Ga0209130_1000203 3300025284 Bacteria 80023
205 Ga0209130_1003870 3300025284 Bacteria 6030
206 Ga0209675_1000014 3300025291 Bacteria 421902
207 Ga0209675_1001248 3300025291 Bacteria 15267
208 Ga0209675_1002386 3300025291 Bacteria 9687
209 Ga0209675_1003660 3300025291 Bacteria 7197
210 Ga0209675_1030353 3300025291 Bacteria 1290
211 Ga0209675_1070011 3300025291 Bacteria 670
212 Ga0209676_1000088 3300025292 Bacteria 263010
213 Ga0209676_1001287 3300025292 Bacteria 25897
214 Ga0209676_1001392 3300025292 Bacteria 23396
215 Ga0209676_1001762 3300025292 Bacteria 18368
216 Ga0209676_1043089 3300025292 Bacteria 1247
217 Ga0209025_1000207 3300025294 Bacteria 140774
218 Ga0209025_1000286 3300025294 Bacteria 114096
219 Ga0209025_1000356 3300025294 Bacteria 98547
220 Ga0209025_1007998 3300025294 Bacteria 7719
221 Ga0209025_1023793 3300025294 Bacteria 3187
222 Ga0209564_1000103 3300025295 Bacteria 221166
223 Ga0209564_1000597 3300025295 Bacteria 56580
224 Ga0209758_1000092 3300025297 Bacteria 241910
225 Ga0209758_1007051 3300025297 Bacteria 7798
226 Ga0209758_1080166 3300025297 Bacteria 990
227 Ga0209758_1126381 3300025297 Bacteria 683
228 Ga0209050_1000511 3300025298 Bacteria 65746
229 Ga0209050_1000758 3300025298 Bacteria 46473
230 Ga0209256_1000065 3300025299 Bacteria 248104
231 Ga0209256_1000094 3300025299 Bacteria 208177
232 Ga0207426_1000084 3300025302 Bacteria 298123
233 Ga0207426_1002447 3300025302 Bacteria 11852
234 Ga0209051_1000069 3300025303 Bacteria 219208
235 Ga0209051_1000114 3300025303 Bacteria 152303
236 Ga0209051_1000326 3300025303 Bacteria 71572
237 Ga0209051_1000335 3300025303 Bacteria 70515
238 Ga0209051_1000461 3300025303 Bacteria 53478
239 Ga0209051_1020875 3300025303 Bacteria 2805
240 Ga0209051_1047887 3300025303 Bacteria 1455
241 Ga0209257_1000015 3300025304 Bacteria 908141
242 Ga0209257_1000093 3300025304 Bacteria 263088
243 Ga0209257_1000249 3300025304 Bacteria 124522
244 Ga0209257_1012145 3300025304 Bacteria 4028
245 Ga0209257_1030923 3300025304 Bacteria 1720
246 Ga0207656_10087925 3300025321 Bacteria 1406
247 Ga0207655_1001919 3300025728 Bacteria 17800
248 Ga0207682_10101735 3300025893 Bacteria 1257
249 Ga0207680_10012314 3300025903 Bacteria 4353
250 Ga0207647_10115716 3300025904 Bacteria 1583
251 Ga0207705_10224044 3300025909 Bacteria 1429
252 Ga0207705_11017116 3300025909 Bacteria 640
253 Ga0207654_10052049 3300025911 Bacteria 2359
254 Ga0207654_10587457 3300025911 Bacteria 794
255 Ga0207695_10027528 3300025913 Bacteria 6329
256 Ga0207671_10003822 3300025914 Bacteria 14736
257 Ga0207657_10010505 3300025919 Bacteria 9234
258 Ga0207652_10105485 3300025921 Bacteria 2494
259 Ga0207652_11198170 3300025921 Bacteria 661
260 Ga0207681_10011609 3300025923 Bacteria 5414
261 Ga0207694_10158528 3300025924 Bacteria 1827
262 Ga0207694_10305715 3300025924 Bacteria 1310
263 Ga0207694_10364074 3300025924 Bacteria 1198
264 Ga0207687_10445974 3300025927 Bacteria 1072
265 Ga0207664_10728066 3300025929 Bacteria 892
266 Ga0207690_10193762 3300025932 Bacteria 1539
267 Ga0207690_10893228 3300025932 Bacteria 737
268 Ga0207706_10047536 3300025933 Bacteria 3796
269 Ga0207709_10000570 3300025935 Bacteria 31044
270 Ga0207709_10000803 3300025935 Bacteria 24427
271 Ga0207709_10138308 3300025935 Bacteria 1671
272 Ga0207669_10133207 3300025937 Bacteria 1712
273 Ga0207691_10148957 3300025940 Bacteria 2058
274 Ga0207691_10756458 3300025940 Bacteria 818
275 Ga0207689_10257160 3300025942 Bacteria 1444
276 Ga0207679_10033624 3300025945 Bacteria 3610
277 Ga0207667_10149979 3300025949 Bacteria 2400
278 Ga0207667_10538172 3300025949 Bacteria 1182
279 Ga0207651_10135350 3300025960 Bacteria 1894
280 Ga0207640_10030195 3300025981 Bacteria 3336
281 Ga0207640_10361490 3300025981 Bacteria 1170
282 Ga0207658_10012974 3300025986 Bacteria 5691
283 Ga0207677_10241376 3300026023 Bacteria 1462
284 Ga0207639_10089989 3300026041 Bacteria 2454
285 Ga0207639_10305972 3300026041 Bacteria 1407
286 Ga0207702_10399838 3300026078 Bacteria 1325
287 Ga0207641_10054358 3300026088 Bacteria 3397
288 Ga0207641_11341825 3300026088 Bacteria 716
289 Ga0207648_11050964 3300026089 Bacteria 763
290 Ga0207676_10795326 3300026095 Bacteria 922
291 Ga0207674_10138811 3300026116 Bacteria 2391
292 Ga0207674_10150887 3300026116 Bacteria 2281
293 Ga0207674_10260297 3300026116 Bacteria 1682
294 Ga0207683_10068577 3300026121 Bacteria 3131
295 Ga0207683_10134132 3300026121 Bacteria 2228
296 Ga0207698_10057775 3300026142 Bacteria 3003
297 Ga0207698_10359117 3300026142 Bacteria 1379
298 Ga0209970_1030891 3300027614 Bacteria 930
299 Ga0209282_1009487 3300027666 Bacteria 6152
300 Ga0209971_1011840 3300027682 Bacteria 2065
301 Ga0209813_10032502 3300027866 Bacteria 1547
302 Ga0209813_10064604 3300027866 Bacteria 1176
303 Ga0209974_10028493 3300027876 Bacteria 1850
304 Ga0268266_10012485 3300028379 Bacteria 7341
305 Ga0268266_10017085 3300028379 Bacteria 6196
306 Ga0268265_10257501 3300028380 Bacteria 1549
307 Ga0307515_10000419 3300028794 Bacteria 102271
308 Ga0307515_10002488 3300028794 Bacteria 39985
309 Ga0307515_10211356 3300028794 Bacteria 1783
310 Ga0307515_10226265 3300028794 Bacteria 1675
311 Ga0307515_10239529 3300028794 Bacteria 1588
312 Ga0307515_10478530 3300028794 Bacteria 858
313 Ga0316177_1110995 3300030731 Bacteria 3271
314 Ga0314311_1041992 3300030733 Bacteria 18035
315 Ga0316179_1055282 3300030734 Bacteria 3324
316 Ga0316180_1036074 3300030736 Bacteria 671
317 Ga0316183_1039276 3300030742 Bacteria 4389
318 Ga0316181_1029714 3300030744 Bacteria 1767
319 Ga0316181_1154876 3300030744 Bacteria 1076
320 Ga0316182_1102772 3300030745 Bacteria 2615
321 Ga0316182_1407517 3300030745 Bacteria 1579
322 Ga0265332_10020780 3300031238 Bacteria 2900
323 Ga0265329_10012226 3300031242 Bacteria 3092
324 Ga0265331_10075180 3300031250 Bacteria 1575
325 Ga0265316_10279367 3300031344 Bacteria 1220
326 Ga0307513_10000008 3300031456 Bacteria 442128
327 Ga0307513_10044420 3300031456 Bacteria 4868
328 Ga0307513_10250709 3300031456 Bacteria 1567
329 Ga0307408_100100427 3300031548 Bacteria 2203
330 Ga0307408_100117558 3300031548 Bacteria 2054
331 Ga0307408_100673035 3300031548 Bacteria 927
332 Ga0307408_100889256 3300031548 Bacteria 814
333 Ga0307514_10028006 3300031649 Bacteria 4548
334 Ga0307514_10056121 3300031649 Bacteria 3024
335 Ga0265314_10001031 3300031711 Bacteria 32483
336 Ga0265314_10050572 3300031711 Bacteria 2901
337 Ga0307516_10025915 3300031730 Bacteria 5962
338 Ga0307516_10202072 3300031730 Bacteria 1706
339 Ga0307405_10040765 3300031731 Bacteria 2814
340 Ga0307405_10044321 3300031731 Bacteria 2720
341 Ga0307405_10095397 3300031731 Bacteria 1980
342 Ga0307405_10632450 3300031731 Bacteria 878
343 Ga0307413_10494581 3300031824 Bacteria 981
344 Ga0307410_10193073 3300031852 Bacteria 1550
345 Ga0307406_10003068 3300031901 Bacteria 9086
346 Ga0307406_10153607 3300031901 Bacteria 1645
347 Ga0307406_10337936 3300031901 Bacteria 1172
348 Ga0307406_10377146 3300031901 Bacteria 1117
349 Ga0307406_10461136 3300031901 Bacteria 1022
350 Ga0307406_10841538 3300031901 Bacteria 777
351 Ga0307412_10027679 3300031911 Bacteria 3537
352 Ga0307412_10251873 3300031911 Bacteria 1371
353 Ga0307412_10433288 3300031911 Bacteria 1078
354 Ga0307412_10588050 3300031911 Bacteria 941
355 Ga0307412_10664519 3300031911 Bacteria 890
356 Ga0307412_11082029 3300031911 Bacteria 712
357 Ga0307412_11396158 3300031911 Bacteria 633
358 Ga0307409_101546513 3300031995 Bacteria 691
359 Ga0307416_100034322 3300032002 Bacteria 3859
360 Ga0307416_100354569 3300032002 Bacteria 1486
361 Ga0307416_100607535 3300032002 Bacteria 1174
362 Ga0307416_102604010 3300032002 Bacteria 603
363 Ga0307414_10458780 3300032004 Bacteria 1119
364 Ga0307411_10185441 3300032005 Bacteria 1583
365 Ga0307510_10271005 3300033180 Bacteria 1174
366 Ga0373931_0098473 3300035691 Bacteria 1641
367 Ga0373925_0607276 3300037068 Bacteria 901
368 Ga0395899_0004807 3300037312 Bacteria 10518
369 Ga0395899_0021612 3300037312 Bacteria 4880
370 Ga0395899_0181688 3300037312 Bacteria 1476
371 Ga0395900_0038664 3300037418 Bacteria 4918
372 Ga0395900_0078887 3300037418 Bacteria 3383
373 Ga0395900_0161255 3300037418 Bacteria 2287
374 Ga0395900_0588106 3300037418 Bacteria 1054
375 Ga0395900_0701491 3300037418 Bacteria 945
376 Ga0395900_0753521 3300037418 Bacteria 904
377 Ga0395900_0975182 3300037418 Bacteria 768
378 Ga0395898_0004440 3300037466 Bacteria 15334
379 Ga0395898_0007748 3300037466 Bacteria 11401
380 Ga0395898_0038296 3300037466 Bacteria 4753
381 Ga0395898_0258911 3300037466 Bacteria 1659
382 Ga0395898_0897751 3300037466 Bacteria 824
383 Ga0395898_1549064 3300037466 Bacteria 588
384 Ga0395905_0000090 3300037471 Bacteria 152117
385 Ga0395905_0001043 3300037471 Bacteria 35100
386 Ga0395905_0013192 3300037471 Bacteria 7931
387 Ga0395905_0028320 3300037471 Bacteria 5280
388 Ga0395905_0036088 3300037471 Bacteria 4643
389 Ga0395905_0036396 3300037471 Bacteria 4622
390 Ga0395905_0154613 3300037471 Bacteria 2157
391 Ga0395905_0284464 3300037471 Bacteria 1540
392 Ga0395905_0516892 3300037471 Bacteria 1094
393 Ga0395905_0692356 3300037471 Bacteria 921
394 Ga0395905_1203271 3300037471 Bacteria 661
395 Ga0395901_0016203 3300038443 Bacteria 7593
396 Ga0395901_0030389 3300038443 Bacteria 5565
397 Ga0395901_0142052 3300038443 Bacteria 2523
398 Ga0395901_0529574 3300038443 Bacteria 1196
399 Ga0395901_0803293 3300038443 Bacteria 929
400 Ga0395901_1232564 3300038443 Bacteria 712
401 Ga0436365_1498257 3300039437 Bacteria 1688
402 Ga0436361_0324632 3300039447 Bacteria 36992
403 Ga0439436_0000145 3300041404 Bacteria 16462
404 Ga0439436_0001063 3300041404 Bacteria 7736
405 Ga0439436_0055431 3300041404 Bacteria 1114
406 Ga0439439_0064163 3300041406 Bacteria 978
407 Ga0439439_0104976 3300041406 Bacteria 780
408 Ga0439447_025789 3300041407 Bacteria 1512
409 Ga0439453_0053012 3300041408 Bacteria 824
410 Ga0439466_0005347 3300041411 Bacteria 4909
411 Ga0439466_0016359 3300041411 Bacteria 2681
412 Ga0439466_0019274 3300041411 Bacteria 2442
413 Ga0439465_0008576 3300041413 Bacteria 3225
414 Ga0451793_1822058 3300041452 Bacteria 772
415 Ga0451807_0148583 3300041486 Bacteria 541
416 Ga0451833_0202136 3300041491 Bacteria 687
417 Ga0439431_0006720 3300041997 Bacteria 2552
418 Ga0439433_0000215 3300041999 Bacteria 9440
419 Ga0439433_0025676 3300041999 Bacteria 1331
420 Ga0439437_004584 3300042000 Bacteria 1510
421 Ga0439442_010231 3300042002 Bacteria 1900
422 Ga0439442_010282 3300042002 Bacteria 1896
423 Ga0439445_0022552 3300042004 Bacteria 1588
424 Ga0439445_0075303 3300042004 Bacteria 938
425 Ga0439432_000575 3300042006 Bacteria 13780
426 Ga0439432_071431 3300042006 Bacteria 1058
427 Ga0439449_0000484 3300042007 Bacteria 14910
428 Ga0439449_0001297 3300042007 Bacteria 9779
429 Ga0439449_0001545 3300042007 Bacteria 9009
430 Ga0439449_0016242 3300042007 Bacteria 2798
431 Ga0439449_0069419 3300042007 Bacteria 1299
432 Ga0439452_008104 3300042010 Bacteria 3177
433 Ga0439452_029342 3300042010 Bacteria 1366
434 Ga0439455_0069064 3300042012 Bacteria 947
435 Ga0439457_009113 3300042014 Bacteria 2318
436 Ga0439462_0026760 3300042015 Bacteria 1520
437 Ga0439462_0030104 3300042015 Bacteria 1435
438 Ga0439462_0044074 3300042015 Bacteria 1193
439 Ga0439462_0069749 3300042015 Bacteria 954
440 Ga0450920_075715 3300042122 Bacteria 687
441 Ga0450923_020968 3300042125 Bacteria 1270
442 Ga0450894_019197 3300042131 Bacteria 917
443 Ga0450898_002646 3300042134 Bacteria 2508
444 Ga0450898_015673 3300042134 Bacteria 1286
445 Ga0450905_014909 3300042142 Bacteria 1111
446 Ga0450906_028509 3300042145 Bacteria 989
447 Ga0450907_013950 3300042146 Bacteria 1340
448 Ga0450910_001544 3300042147 Bacteria 2921
449 Ga0450910_003817 3300042147 Bacteria 2014
450 Ga0439446_0001157 3300042156 Bacteria 5858
451 Ga0450908_001944 3300042184 Bacteria 4045
452 Ga0450908_007328 3300042184 Bacteria 2080
453 Ga0450909_046920 3300042185 Bacteria 671
454 Ga0439434_0065430 3300042435 Bacteria 1140
455 Ga0439435_0173358 3300042436 Bacteria 702
456 Ga0450918_007108 3300042531 Bacteria 1988
457 Ga0450893_0001490 3300042532 Bacteria 3600
458 Ga0450893_0002953 3300042532 Bacteria 2677
459 Ga0451577_0000453 3300042876 Bacteria 71384
460 Ga0451577_0007854 3300042876 Bacteria 10436
461 Ga0451577_0184803 3300042876 Bacteria 1880
462 Ga0451577_0230034 3300042876 Bacteria 1677
463 Ga0451577_0910306 3300042876 Bacteria 792
464 Ga0451577_0935642 3300042876 Bacteria 780
465 Ga0451577_1155411 3300042876 Bacteria 691
466 Ga0466972_0153662 3300044658 Bacteria 1081
467 Ga0453683_0001384 3300044673 Bacteria 21064
468 Ga0453683_0003629 3300044673 Bacteria 11314
469 Ga0466965_0290391 3300044683 Bacteria 885
470 Ga0466966_0036164 3300044684 Bacteria 3189
471 Ga0466966_0266013 3300044684 Bacteria 1032
472 Ga0453684_0002072 3300044712 Bacteria 50917
473 Ga0453684_0035303 3300044712 Bacteria 6914
474 Ga0453684_0544495 3300044712 Bacteria 1279
475 Ga0466970_0021484 3300044765 Bacteria 3361
476 Ga0466970_0195189 3300044765 Bacteria 1126
477 Ga0466957_0367620 3300044842 Bacteria 979
478 Ga0466959_0061885 3300045049 Bacteria 2721
479 Ga0466959_0380372 3300045049 Bacteria 961
480 Ga0451576_0000950 3300045051 Bacteria 54404
481 Ga0451576_0016302 3300045051 Bacteria 8204
482 Ga0451576_0081288 3300045051 Bacteria 3370
483 Ga0451576_0085491 3300045051 Bacteria 3281
484 Ga0451576_0149889 3300045051 Bacteria 2432
485 Ga0451576_1014632 3300045051 Bacteria 870
486 Ga0466967_0470821 3300045976 Bacteria 1230
487 Ga0495627_071523 3300046453 Bacteria 1013
488 Ga0495590_0122528 3300046457 Bacteria 932
489 Ga0495629_0240844 3300046459 Bacteria 1246
490 Ga0495605_0260505 3300046474 Bacteria 740
491 Ga0495639_0008381 3300046475 Bacteria 4433
492 Ga0495583_0330445 3300046506 Bacteria 603
493 Ga0495610_0030481 3300046512 Bacteria 2826
494 Ga0495616_0001394 3300046513 Bacteria 16839
495 Ga0495620_0028397 3300046515 Bacteria 2602
496 Ga0495631_0001085 3300046518 Bacteria 16886
497 Ga0495632_0018041 3300046519 Bacteria 3880
498 Ga0495637_0022112 3300046520 Bacteria 2905
499 Ga0495637_0113806 3300046520 Bacteria 1046
500 Ga0495643_0086670 3300046522 Bacteria 1622
501 Ga0495663_0018417 3300046525 Bacteria 1989
502 Ga0495654_0021838 3300046530 Bacteria 3328
503 Ga0495654_0107004 3300046530 Bacteria 1280
504 Ga0495654_0137807 3300046530 Bacteria 1090
505 Ga0495609_0082169 3300046538 Bacteria 1408
506 Ga0495621_0015001 3300046539 Bacteria 2463
507 Ga0495621_0064455 3300046539 Bacteria 1337
508 Ga0495656_0000055 3300046615 Bacteria 53908
509 Ga0495656_0034717 3300046615 Bacteria 2067
510 Ga0495656_0038384 3300046615 Bacteria 1983
511 Ga0495668_0059881 3300046616 Bacteria 2101
512 Ga0495625_0002019 3300046660 Bacteria 22847
513 Ga0495625_0029006 3300046660 Bacteria 4142
514 Ga0495635_0063641 3300046663 Bacteria 2533
515 Ga0495661_0382408 3300046665 Bacteria 687
516 Ga0495588_0264290 3300046674 Bacteria 907
517 Ga0495588_0470056 3300046674 Bacteria 659
518 Ga0495624_0451607 3300046690 Bacteria 770
519 Ga0495670_0019185 3300046691 Bacteria 3369
520 Ga0495670_0294458 3300046691 Bacteria 869
521 Ga0495671_0019757 3300046692 Bacteria 3557
522 Ga0495649_0006369 3300046694 Bacteria 7346
523 Ga0495660_0069608 3300046810 Bacteria 1870
524 Ga0495636_0045890 3300047318 Bacteria 1822
525 Ga0495676_0003857 3300047321 Bacteria 13638
526 Ga0495687_013291 3300047443 Bacteria 4308
527 Ga0495677_0055771 3300047445 Bacteria 1459
528 Ga0495681_0140489 3300047470 Bacteria 1021
529 Ga0495593_0065889 3300047673 Bacteria 1888
530 Ga0495626_0079830 3300048091 Bacteria 1455
531 Ga0496100_0001576 3300048903 Bacteria 11234
532 Ga0496102_0102436 3300048905 Bacteria 2661
533 Ga0496103_0194490 3300048906 Bacteria 1304
534 Ga0496105_0006863 3300048908 Bacteria 8761
535 Ga0496107_0054621 3300048910 Bacteria 2883
536 Ga0496109_0082373 3300048912 Bacteria 2965
537 Ga0496110_0364537 3300048913 Bacteria 1316
538 Ga0496110_0629444 3300048913 Bacteria 972
539 Ga0496110_1002642 3300048913 Bacteria 742
540 Ga0496111_0204021 3300048914 Bacteria 1469
541 Ga0496113_0393002 3300048916 Bacteria 1113
542 Ga0496114_0281861 3300048917 Bacteria 1465
543 Ga0496116_0107094 3300048919 Bacteria 1653
544 Ga0496117_0082571 3300048920 Bacteria 2104
545 Ga0496117_0086486 3300048920 Bacteria 2036
546 Ga0496117_0251954 3300048920 Bacteria 962
547 Ga0496118_0097166 3300048921 Bacteria 2005
548 Ga0496118_0106508 3300048921 Bacteria 1875
549 Ga0496121_0012482 3300048924 Bacteria 9253
550 Ga0496121_0069958 3300048924 Bacteria 2829
551 Ga0496122_0000324 3300048925 Bacteria 104220
552 Ga0496122_0051838 3300048925 Bacteria 3113
553 Ga0496122_0058925 3300048925 Bacteria 2838
554 Ga0496122_0146934 3300048925 Bacteria 1463
555 Ga0496122_0185253 3300048925 Bacteria 1236
556 Ga0496123_0000160 3300048926 Bacteria 135310
557 Ga0496123_0067679 3300048926 Bacteria 2254
558 Ga0496123_0121821 3300048926 Bacteria 1465
559 Ga0496123_0193176 3300048926 Bacteria 1051
560 Ga0496123_0236002 3300048926 Bacteria 911
561 Ga0496124_0013362 3300048927 Bacteria 8021
562 Ga0496124_0158716 3300048927 Bacteria 1765
563 Ga0496124_0177864 3300048927 Bacteria 1640
564 Ga0496124_0216047 3300048927 Bacteria 1446
565 Ga0496125_0001477 3300048928 Bacteria 33958
566 Ga0496125_0036017 3300048928 Bacteria 4328
567 Ga0496125_0193321 3300048928 Bacteria 1341
568 Ga0496126_0284309 3300048929 Bacteria 1369
569 Ga0496126_0410964 3300048929 Bacteria 1096
570 Ga0496126_0638770 3300048929 Bacteria 834
571 Ga0501034_0040051 3300049571 Bacteria 4745
572 Ga0501034_0108341 3300049571 Bacteria 2769
573 Ga0501034_0668237 3300049571 Bacteria 939
574 Ga0501043_0062653 3300049579 Bacteria 2920
575 Ga0501043_0371687 3300049579 Bacteria 1084
576 Ga0501046_0055208 3300049580 Bacteria 3123
577 Ga0501047_0162671 3300049581 Bacteria 2103
578 Ga0501073_0294626 3300049589 Bacteria 1119
579 Ga0501243_060169 3300049675 Bacteria 703
580 Ga0501249_002237 3300049679 Bacteria 3928
581 Ga0501257_253990 3300049686 Bacteria 522
582 Ga0501225_0098687 3300049705 Bacteria 852
583 Ga0501234_028828 3300049707 Bacteria 894
584 Ga0501080_0333898 3300049742 Bacteria 1370
585 Ga0501262_000323 3300049759 Bacteria 5797
586 Ga0501273_020091 3300049770 Bacteria 899
587 Ga0501035_0200442 3300049822 Bacteria 1712
588 Ga0501044_0262952 3300049823 Bacteria 1663
589 nmdc:mga03683_11355_c1 3300050489 Bacteria 3223
590 nmdc:mga03683_115246_c1 3300050489 Bacteria 1191
591 nmdc:mga03683_132996_c1 3300050489 Bacteria 1114
592 nmdc:mga03683_25447_c1 3300050489 Bacteria 2325
593 nmdc:mga03683_274438_c1 3300050489 Bacteria 787
594 nmdc:mga03683_38524_c1 3300050489 Bacteria 1953
595 nmdc:mga03683_44131_c1 3300050489 Bacteria 1842
596 nmdc:mga03683_602486_c1 3300050489 Bacteria 538
597 nmdc:mga03n38_14679_c1 3300050490 Bacteria 3009
598 nmdc:mga03n38_23656_c1 3300050490 Bacteria 2503
599 nmdc:mga03n38_254798_c1 3300050490 Bacteria 928
600 nmdc:mga03n38_296622_c1 3300050490 Bacteria 867
601 nmdc:mga03n38_440274_c1 3300050490 Bacteria 723
602 nmdc:mga03n38_460468_c1 3300050490 Bacteria 709
603 nmdc:mga00v17_13376_c1 3300050491 Bacteria 4555
604 nmdc:mga0yw44_11511_c1 3300050492 Bacteria 4572
605 nmdc:mga0yw44_120011_c1 3300050492 Bacteria 1693
606 nmdc:mga0yw44_288067_c1 3300050492 Bacteria 1099
607 nmdc:mga0yw44_573332_c1 3300050492 Bacteria 766
608 nmdc:mga0yw44_757798_c1 3300050492 Bacteria 659
609 nmdc:mga0k408_18277_c1 3300050493 Bacteria 3912
610 nmdc:mga0k408_206388_c1 3300050493 Bacteria 1173
611 nmdc:mga0k408_209841_c1 3300050493 Bacteria 1163
612 nmdc:mga0k408_265481_c1 3300050493 Bacteria 664
613 nmdc:mga0k408_493135_c1 3300050493 Bacteria 726
614 nmdc:mga0k408_6404_c1 3300050493 Bacteria 6280
615 nmdc:mga06z11_1192_c1 3300050494 Bacteria 9568
616 nmdc:mga06z11_383328_c1 3300050494 Bacteria 845
617 nmdc:mga04h51_2632_c1 3300050495 Bacteria 4275
618 nmdc:mga04h51_34726_c1 3300050495 Bacteria 1612
619 nmdc:mga07m45_17784_c1 3300050496 Bacteria 3825
620 nmdc:mga07m45_3563_c1 3300050496 Bacteria 7521
621 nmdc:mga07m45_3602_c1 3300050496 Bacteria 7479
622 nmdc:mga07m45_3690_c1 3300050496 Bacteria 7407
623 nmdc:mga07m45_645240_c1 3300050496 Bacteria 610
624 nmdc:mga07m45_803_c1 3300050496 Bacteria 13535
625 nmdc:mga07m45_814_c1 3300050496 Bacteria 13468
626 nmdc:mga0sz30_15926_c1 3300050516 Bacteria 2977
627 nmdc:mga0sz30_50071_c1 3300050516 Bacteria 697
628 Ga0500610_0000194 3300053079 Bacteria 18457
629 Ga0500610_0090294 3300053079 Bacteria 1591
630 Ga0500643_019165 3300053087 Bacteria 2258
631 Ga0500651_0000082 3300053093 Bacteria 60329
632 Ga0500651_0076169 3300053093 Bacteria 2083
633 Ga0500562_019009 3300053108 Bacteria 1775
634 Ga0500571_000162 3300053110 Bacteria 23449
635 Ga0500593_013811 3300053117 Bacteria 3455
636 Ga0500607_016835 3300053121 Bacteria 4182
637 Ga0500608_010513 3300053122 Bacteria 3976
638 Ga0500608_186786 3300053122 Bacteria 871
639 Ga0500618_063913 3300053125 Bacteria 827
640 Ga0500618_090293 3300053125 Bacteria 688
641 Ga0500628_054417 3300053129 Bacteria 960
642 Ga0500658_0000170 3300053134 Bacteria 30951
643 Ga0500658_0001413 3300053134 Bacteria 9671
644 Ga0500559_0004515 3300053136 Bacteria 6582
645 Ga0500559_0025081 3300053136 Bacteria 2537
646 Ga0500559_0144581 3300053136 Bacteria 1114
647 Ga0500561_0124276 3300053137 Bacteria 790
648 Ga0500564_012901 3300053138 Bacteria 3727
649 Ga0500568_0003074 3300053139 Bacteria 9530
650 Ga0500574_050480 3300053141 Bacteria 1187
651 Ga0500577_0057279 3300053142 Bacteria 1487
652 Ga0500586_088687 3300053145 Bacteria 1087
653 Ga0500616_0074869 3300053153 Bacteria 1715
654 Ga0500634_0013938 3300053161 Bacteria 4230
655 Ga0500634_0030574 3300053161 Bacteria 2935
656 Ga0500638_044950 3300053162 Bacteria 2143
657 Ga0500636_0038384 3300053177 Bacteria 2833
658 Ga0500625_072935 3300053729 Bacteria 1522
659 Ga0590075_095149 3300059424 Bacteria 774
660 Ga0466962_0144833 3300061719 Bacteria 1152

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041408 Ga0439453_0053012 Ga0439453_0053012_390_806 138
2 3300049686 Ga0501257_253990 Ga0501257_253990_39_485 147
3 3300025303 Ga0209051_1020875 Ga0209051_10208753 155
4 3300013102 Ga0157371_10026087 Ga0157371_100260875 156
5 3300050492 nmdc:mga0yw44_573332_c1 nmdc:mga0yw44_573332_c1_11_481 156
6 3300050496 nmdc:mga07m45_17784_c1 nmdc:mga07m45_17784_c1_116_586 156
7 3300006038 Ga0075365_10026066 Ga0075365_100260663 159
8 3300006048 Ga0075363_100155634 Ga0075363_1001556342 159
9 3300006048 Ga0075363_100658257 Ga0075363_1006582571 159
10 3300006195 Ga0075366_10071595 Ga0075366_100715954 159
11 3300006195 Ga0075366_10736434 Ga0075366_107364342 159
12 3300006353 Ga0075370_10041778 Ga0075370_100417784 159
13 3300031548 Ga0307408_100117558 Ga0307408_1001175582 159
14 3300031901 Ga0307406_10377146 Ga0307406_103771462 159
15 3300031911 Ga0307412_10251873 Ga0307412_102518733 159
16 3300031911 Ga0307412_10664519 Ga0307412_106645192 159
17 3300037418 Ga0395900_0753521 Ga0395900_0753521_34_522 159
18 3300037471 Ga0395905_0692356 Ga0395905_0692356_372_863 159
19 3300038443 Ga0395901_0142052 Ga0395901_0142052_982_1470 159
20 3300041404 Ga0439436_0001063 Ga0439436_0001063_2551_3051 159
21 3300041411 Ga0439466_0005347 Ga0439466_0005347_2470_2970 159
22 3300041999 Ga0439433_0025676 Ga0439433_0025676_355_855 159
23 3300042007 Ga0439449_0000484 Ga0439449_0000484_7222_7722 159
24 3300042010 Ga0439452_008104 Ga0439452_008104_2078_2578 159
25 3300042015 Ga0439462_0026760 Ga0439462_0026760_95_595 159
26 3300042125 Ga0450923_020968 Ga0450923_020968_345_845 159
27 3300042134 Ga0450898_002646 Ga0450898_002646_246_746 159
28 3300042147 Ga0450910_001544 Ga0450910_001544_2345_2845 159
29 3300042184 Ga0450908_007328 Ga0450908_007328_948_1448 159
30 3300042876 Ga0451577_0230034 Ga0451577_0230034_279_779 159
31 3300045051 Ga0451576_0081288 Ga0451576_0081288_1284_1781 159
32 3300046525 Ga0495663_0018417 Ga0495663_0018417_797_1288 159
33 3300046615 Ga0495656_0038384 Ga0495656_0038384_254_745 159
34 3300047318 Ga0495636_0045890 Ga0495636_0045890_718_1209 159
35 3300047470 Ga0495681_0140489 Ga0495681_0140489_295_786 159
36 3300049770 Ga0501273_020091 Ga0501273_020091_158_643 159
37 3300050489 nmdc:mga03683_115246_c1 nmdc:mga03683_115246_c1_316_813 159
38 3300050489 nmdc:mga03683_274438_c1 nmdc:mga03683_274438_c1_83_580 159
39 3300050490 nmdc:mga03n38_440274_c1 nmdc:mga03n38_440274_c1_188_682 159
40 3300050490 nmdc:mga03n38_460468_c1 nmdc:mga03n38_460468_c1_154_651 159
41 3300050492 nmdc:mga0yw44_288067_c1 nmdc:mga0yw44_288067_c1_91_579 159
42 3300050492 nmdc:mga0yw44_757798_c1 nmdc:mga0yw44_757798_c1_61_555 159
43 3300050493 nmdc:mga0k408_493135_c1 nmdc:mga0k408_493135_c1_132_626 159
44 3300050494 nmdc:mga06z11_383328_c1 nmdc:mga06z11_383328_c1_195_692 159
45 3300050496 nmdc:mga07m45_803_c1 nmdc:mga07m45_803_c1_6006_6488 159
46 3300059424 Ga0590075_095149 Ga0590075_095149_197_694 159
47 iso_pu_bacteria 2881101125 2881102575 159
48 3300005339 Ga0070660_100049803 Ga0070660_1000498034 160
49 3300005435 Ga0070714_100389048 Ga0070714_1003890482 160
50 3300005458 Ga0070681_10183730 Ga0070681_101837303 160
51 3300005530 Ga0070679_100003351 Ga0070679_1000033515 160
52 3300005563 Ga0068855_100005901 Ga0068855_1000059014 160
53 3300006048 Ga0075363_100133765 Ga0075363_1001337652 160
54 3300006177 Ga0075362_10044230 Ga0075362_100442302 160
55 3300006195 Ga0075366_10242191 Ga0075366_102421912 160
56 3300009093 Ga0105240_10003014 Ga0105240_1000301415 160
57 3300009551 Ga0105238_10048663 Ga0105238_100486633 160
58 3300025913 Ga0207695_10027528 Ga0207695_100275285 160
59 3300025919 Ga0207657_10010505 Ga0207657_100105053 160
60 3300025921 Ga0207652_11198170 Ga0207652_111981702 160
61 3300025924 Ga0207694_10305715 Ga0207694_103057152 160
62 3300025929 Ga0207664_10728066 Ga0207664_107280662 160
63 3300025949 Ga0207667_10538172 Ga0207667_105381721 160
64 3300027866 Ga0209813_10064604 Ga0209813_100646042 160
65 3300031711 Ga0265314_10050572 Ga0265314_100505723 160
66 3300031852 Ga0307410_10193073 Ga0307410_101930732 160
67 3300031901 Ga0307406_10841538 Ga0307406_108415382 160
68 3300032002 Ga0307416_100607535 Ga0307416_1006075352 160
69 3300037418 Ga0395900_0161255 Ga0395900_0161255_716_1210 160
70 3300037466 Ga0395898_0897751 Ga0395898_0897751_232_726 160
71 3300037471 Ga0395905_0154613 Ga0395905_0154613_722_1216 160
72 3300038443 Ga0395901_0529574 Ga0395901_0529574_95_589 160
73 3300039447 Ga0436361_0324632 Ga0436361_0324632_34960_35448 160
74 3300041406 Ga0439439_0104976 Ga0439439_0104976_250_750 160
75 3300042000 Ga0439437_004584 Ga0439437_004584_113_613 160
76 3300042007 Ga0439449_0069419 Ga0439449_0069419_788_1288 160
77 3300042142 Ga0450905_014909 Ga0450905_014909_259_756 160
78 3300042876 Ga0451577_0007854 Ga0451577_0007854_8365_8856 160
79 3300044673 Ga0453683_0003629 Ga0453683_0003629_9288_9779 160
80 3300044712 Ga0453684_0035303 Ga0453684_0035303_123_614 160
81 3300045051 Ga0451576_0016302 Ga0451576_0016302_1411_1902 160
82 3300046615 Ga0495656_0034717 Ga0495656_0034717_17_511 160
83 3300048924 Ga0496121_0012482 Ga0496121_0012482_249_746 160
84 3300048927 Ga0496124_0216047 Ga0496124_0216047_768_1265 160
85 3300048929 Ga0496126_0638770 Ga0496126_0638770_39_536 160
86 3300049675 Ga0501243_060169 Ga0501243_060169_24_524 160
87 3300050493 nmdc:mga0k408_209841_c1 nmdc:mga0k408_209841_c1_445_945 160
88 3300050495 nmdc:mga04h51_34726_c1 nmdc:mga04h51_34726_c1_539_1039 160
89 iso_pu_bacteria 2842733646 2842733947 160
90 iso_pu_bacteria 2842747753 2842752660 160
91 3300005327 Ga0070658_10528064 Ga0070658_105280642 161
92 3300005327 Ga0070658_11281683 Ga0070658_112816831 161
93 3300005334 Ga0068869_100084256 Ga0068869_1000842562 161
94 3300005338 Ga0068868_101337172 Ga0068868_1013371721 161
95 3300005456 Ga0070678_100146237 Ga0070678_1001462373 161
96 3300005563 Ga0068855_100088468 Ga0068855_1000884684 161
97 3300005577 Ga0068857_100552560 Ga0068857_1005525602 161
98 3300005614 Ga0068856_100276443 Ga0068856_1002764432 161
99 3300009093 Ga0105240_11156642 Ga0105240_111566422 161
100 3300009098 Ga0105245_11068095 Ga0105245_110680952 161
101 3300009174 Ga0105241_10117544 Ga0105241_101175441 161
102 3300010375 Ga0105239_10113368 Ga0105239_101133682 161
103 3300013297 Ga0157378_10114643 Ga0157378_101146433 161
104 3300025909 Ga0207705_10224044 Ga0207705_102240443 161
105 3300025909 Ga0207705_11017116 Ga0207705_110171161 161
106 3300025911 Ga0207654_10052049 Ga0207654_100520494 161
107 3300025932 Ga0207690_10893228 Ga0207690_108932282 161
108 3300025949 Ga0207667_10149979 Ga0207667_101499792 161
109 3300026078 Ga0207702_10399838 Ga0207702_103998382 161
110 3300026116 Ga0207674_10150887 Ga0207674_101508872 161
111 3300026121 Ga0207683_10134132 Ga0207683_101341323 161
112 3300027876 Ga0209974_10028493 Ga0209974_100284934 161
113 3300031238 Ga0265332_10020780 Ga0265332_100207803 161
114 3300031242 Ga0265329_10012226 Ga0265329_100122264 161
115 3300031250 Ga0265331_10075180 Ga0265331_100751802 161
116 3300031344 Ga0265316_10279367 Ga0265316_102793672 161
117 3300031711 Ga0265314_10001031 Ga0265314_100010315 161
118 3300031911 Ga0307412_10588050 Ga0307412_105880502 161
119 3300035691 Ga0373931_0098473 Ga0373931_0098473_174_689 161
120 3300037312 Ga0395899_0021612 Ga0395899_0021612_2246_2743 161
121 3300037312 Ga0395899_0181688 Ga0395899_0181688_96_593 161
122 3300037418 Ga0395900_0038664 Ga0395900_0038664_309_806 161
123 3300037418 Ga0395900_0975182 Ga0395900_0975182_155_652 161
124 3300037466 Ga0395898_0004440 Ga0395898_0004440_4103_4600 161
125 3300037466 Ga0395898_0038296 Ga0395898_0038296_1674_2171 161
126 3300037466 Ga0395898_1549064 Ga0395898_1549064_23_520 161
127 3300037471 Ga0395905_0000090 Ga0395905_0000090_23301_23798 161
128 3300037471 Ga0395905_0001043 Ga0395905_0001043_22713_23210 161
129 3300037471 Ga0395905_0028320 Ga0395905_0028320_4078_4575 161
130 3300037471 Ga0395905_0036088 Ga0395905_0036088_1518_2015 161
131 3300037471 Ga0395905_0284464 Ga0395905_0284464_922_1419 161
132 3300037471 Ga0395905_0516892 Ga0395905_0516892_583_1080 161
133 3300037471 Ga0395905_1203271 Ga0395905_1203271_25_522 161
134 3300038443 Ga0395901_0016203 Ga0395901_0016203_1894_2391 161
135 3300038443 Ga0395901_0030389 Ga0395901_0030389_3303_3800 161
136 3300042532 Ga0450893_0002953 Ga0450893_0002953_592_1095 161
137 3300045051 Ga0451576_1014632 Ga0451576_1014632_171_671 161
138 iso_pu_bacteria 2513020051 2513228054 161
139 iso_pu_bacteria 2599185214 2599626266 161
140 iso_pu_bacteria 2599185226 2599675905 161
141 iso_pu_bacteria 2599185227 2599682212 161
142 iso_pu_bacteria 2599185229 2599695863 161
143 iso_pu_bacteria 2643221628 2644164078 161
144 iso_pu_bacteria 2643221683 2644466790 161
145 iso_pu_bacteria 2842677519 2842678696 161
146 iso_pu_bacteria 2885192300 2885193161 161
147 iso_pu_bacteria 2885198086 2885202901 161
148 iso_pu_bacteria 2885211737 2885216702 161
149 iso_pu_bacteria 2904449895 2904452706 161
150 iso_pu_bacteria 2904456579 2904460266 161
151 iso_pu_bacteria 2919462493 2919463672 161
152 iso_pu_bacteria 2928070936 2928075483 161
153 iso_pu_bacteria 2928084124 2928089412 161
154 iso_pu_bacteria 2928115317 2928115771 161
155 iso_pu_bacteria 2929520902 2929525667 161
156 iso_pu_bacteria 2945945610 2945945762 161
157 iso_pu_bacteria 2945972063 2945975421 161
158 3300005338 Ga0068868_100276740 Ga0068868_1002767402 162
159 3300009101 Ga0105247_10426243 Ga0105247_104262432 162
160 3300009174 Ga0105241_10410532 Ga0105241_104105322 162
161 3300009545 Ga0105237_10001471 Ga0105237_1000147133 162
162 3300009551 Ga0105238_10026974 Ga0105238_100269744 162
163 3300009553 Ga0105249_11071879 Ga0105249_110718792 162
164 3300010375 Ga0105239_10002779 Ga0105239_100027794 162
165 3300015262 Ga0182007_10106535 Ga0182007_101065352 162
166 3300025914 Ga0207671_10003822 Ga0207671_100038227 162
167 3300028794 Ga0307515_10211356 Ga0307515_102113561 162
168 3300028794 Ga0307515_10239529 Ga0307515_102395292 162
169 3300031730 Ga0307516_10025915 Ga0307516_100259155 162
170 3300037471 Ga0395905_0013192 Ga0395905_0013192_6863_7366 162
171 3300042007 Ga0439449_0016242 Ga0439449_0016242_336_833 162
172 3300042015 Ga0439462_0069749 Ga0439462_0069749_52_549 162
173 3300042436 Ga0439435_0173358 Ga0439435_0173358_122_619 162
174 3300042876 Ga0451577_0184803 Ga0451577_0184803_62_559 162
175 3300042876 Ga0451577_0910306 Ga0451577_0910306_230_733 162
176 3300042876 Ga0451577_0935642 Ga0451577_0935642_154_651 162
177 3300044658 Ga0466972_0153662 Ga0466972_0153662_370_873 162
178 3300044684 Ga0466966_0036164 Ga0466966_0036164_1086_1589 162
179 3300044684 Ga0466966_0266013 Ga0466966_0266013_240_743 162
180 3300044765 Ga0466970_0021484 Ga0466970_0021484_323_826 162
181 3300045049 Ga0466959_0061885 Ga0466959_0061885_2071_2574 162
182 3300045049 Ga0466959_0380372 Ga0466959_0380372_131_634 162
183 3300045976 Ga0466967_0470821 Ga0466967_0470821_277_777 162
184 3300048913 Ga0496110_0629444 Ga0496110_0629444_125_613 162
185 3300049571 Ga0501034_0108341 Ga0501034_0108341_1080_1583 162
186 3300049579 Ga0501043_0062653 Ga0501043_0062653_491_994 162
187 3300049580 Ga0501046_0055208 Ga0501046_0055208_1141_1644 162
188 3300049581 Ga0501047_0162671 Ga0501047_0162671_836_1339 162
189 3300049589 Ga0501073_0294626 Ga0501073_0294626_105_608 162
190 3300049742 Ga0501080_0333898 Ga0501080_0333898_109_612 162
191 3300049822 Ga0501035_0200442 Ga0501035_0200442_88_591 162
192 3300053108 Ga0500562_019009 Ga0500562_019009_898_1401 162
193 3300053142 Ga0500577_0057279 Ga0500577_0057279_105_608 162
194 3300053145 Ga0500586_088687 Ga0500586_088687_400_903 162
195 3300053153 Ga0500616_0074869 Ga0500616_0074869_848_1351 162
196 iso_pu_bacteria 2643221658 2644326861 162
197 iso_pu_bacteria 2643221672 2644399879 162
198 iso_pu_bacteria 2738543013 2739249650 162
199 iso_pu_bacteria 2818991446 2819601538 162
200 iso_pu_bacteria 2831265667 2831272196 162
201 iso_pu_bacteria 2838054893 2838059360 162
202 iso_pu_bacteria 2894023352 2894027293 162
203 iso_pu_bacteria 2899924645 2899930917 162
204 iso_pu_bacteria 2928037797 2928040850 162
205 iso_pu_bacteria 2928044640 2928047692 162
206 iso_pu_bacteria 2928051484 2928055471 162
207 iso_pu_bacteria 2928064002 2928069578 162
208 3300003792 Ga0055540_1011297 Ga0055540_10112971 163
209 3300003794 Ga0055531_10000452 Ga0055531_1000045229 163
210 3300005577 Ga0068857_100278939 Ga0068857_1002789392 163
211 3300005617 Ga0068859_100866412 Ga0068859_1008664122 163
212 3300006038 Ga0075365_10010759 Ga0075365_100107594 163
213 3300006042 Ga0075368_10003556 Ga0075368_100035562 163
214 3300006051 Ga0075364_10104419 Ga0075364_101044192 163
215 3300006177 Ga0075362_10045758 Ga0075362_100457583 163
216 3300006178 Ga0075367_10069662 Ga0075367_100696622 163
217 3300006186 Ga0075369_10011519 Ga0075369_100115193 163
218 3300006195 Ga0075366_10000589 Ga0075366_1000058917 163
219 3300006195 Ga0075366_10487844 Ga0075366_104878441 163
220 3300006237 Ga0097621_100777563 Ga0097621_1007775632 163
221 3300006353 Ga0075370_10017268 Ga0075370_100172684 163
222 3300006353 Ga0075370_10089862 Ga0075370_100898624 163
223 3300006931 Ga0097620_100866423 Ga0097620_1008664232 163
224 3300009148 Ga0105243_10913664 Ga0105243_109136642 163
225 3300025273 Ga0209673_1044171 Ga0209673_10441712 163
226 3300025297 Ga0209758_1080166 Ga0209758_10801661 163
227 3300025303 Ga0209051_1000114 Ga0209051_1000114117 163
228 3300025304 Ga0209257_1000015 Ga0209257_1000015744 163
229 3300026089 Ga0207648_11050964 Ga0207648_110509642 163
230 3300026116 Ga0207674_10260297 Ga0207674_102602972 163
231 3300027866 Ga0209813_10032502 Ga0209813_100325022 163
232 3300028794 Ga0307515_10002488 Ga0307515_100024885 163
233 3300031456 Ga0307513_10000008 Ga0307513_10000008289 163
234 3300031456 Ga0307513_10044420 Ga0307513_100444205 163
235 3300031649 Ga0307514_10028006 Ga0307514_100280066 163
236 3300031730 Ga0307516_10202072 Ga0307516_102020722 163
237 3300033180 Ga0307510_10271005 Ga0307510_102710052 163
238 3300037068 Ga0373925_0607276 Ga0373925_0607276_322_825 163
239 3300037312 Ga0395899_0004807 Ga0395899_0004807_7572_8096 163
240 3300037418 Ga0395900_0078887 Ga0395900_0078887_2257_2778 163
241 3300037418 Ga0395900_0588106 Ga0395900_0588106_175_693 163
242 3300037418 Ga0395900_0701491 Ga0395900_0701491_64_588 163
243 3300037466 Ga0395898_0007748 Ga0395898_0007748_6576_7100 163
244 3300037466 Ga0395898_0258911 Ga0395898_0258911_984_1502 163
245 3300037471 Ga0395905_0036396 Ga0395905_0036396_625_1146 163
246 3300038443 Ga0395901_0803293 Ga0395901_0803293_69_593 163
247 3300038443 Ga0395901_1232564 Ga0395901_1232564_19_537 163
248 3300039437 Ga0436365_1498257 Ga0436365_1498257_630_1148 163
249 3300042006 Ga0439432_071431 Ga0439432_071431_102_602 163
250 3300042131 Ga0450894_019197 Ga0450894_019197_210_728 163
251 3300044673 Ga0453683_0001384 Ga0453683_0001384_15153_15671 163
252 3300044683 Ga0466965_0290391 Ga0466965_0290391_278_796 163
253 3300044765 Ga0466970_0195189 Ga0466970_0195189_549_1067 163
254 3300044842 Ga0466957_0367620 Ga0466957_0367620_162_686 163
255 3300045051 Ga0451576_0085491 Ga0451576_0085491_231_749 163
256 3300046457 Ga0495590_0122528 Ga0495590_0122528_282_785 163
257 3300046474 Ga0495605_0260505 Ga0495605_0260505_144_647 163
258 3300046519 Ga0495632_0018041 Ga0495632_0018041_1023_1526 163
259 3300046530 Ga0495654_0021838 Ga0495654_0021838_187_723 163
260 3300046530 Ga0495654_0107004 Ga0495654_0107004_619_1122 163
261 3300046660 Ga0495625_0029006 Ga0495625_0029006_109_612 163
262 3300046694 Ga0495649_0006369 Ga0495649_0006369_6071_6574 163
263 3300046810 Ga0495660_0069608 Ga0495660_0069608_514_1017 163
264 3300047443 Ga0495687_013291 Ga0495687_013291_638_1141 163
265 3300048091 Ga0495626_0079830 Ga0495626_0079830_872_1375 163
266 3300048925 Ga0496122_0058925 Ga0496122_0058925_2120_2641 163
267 3300048926 Ga0496123_0121821 Ga0496123_0121821_633_1154 163
268 3300048928 Ga0496125_0001477 Ga0496125_0001477_29935_30456 163
269 3300048929 Ga0496126_0284309 Ga0496126_0284309_558_1079 163
270 3300049571 Ga0501034_0040051 Ga0501034_0040051_3289_3795 163
271 3300049579 Ga0501043_0371687 Ga0501043_0371687_336_857 163
272 3300049707 Ga0501234_028828 Ga0501234_028828_122_640 163
273 3300049823 Ga0501044_0262952 Ga0501044_0262952_211_732 163
274 3300050489 nmdc:mga03683_132996_c1 nmdc:mga03683_132996_c1_116_640 163
275 3300050489 nmdc:mga03683_38524_c1 nmdc:mga03683_38524_c1_673_1179 163
276 3300050490 nmdc:mga03n38_23656_c1 nmdc:mga03n38_23656_c1_186_692 163
277 3300050490 nmdc:mga03n38_254798_c1 nmdc:mga03n38_254798_c1_171_674 163
278 3300050492 nmdc:mga0yw44_11511_c1 nmdc:mga0yw44_11511_c1_3526_4029 163
279 3300050493 nmdc:mga0k408_265481_c1 nmdc:mga0k408_265481_c1_112_618 163
280 3300050493 nmdc:mga0k408_6404_c1 nmdc:mga0k408_6404_c1_4933_5436 163
281 3300050494 nmdc:mga06z11_1192_c1 nmdc:mga06z11_1192_c1_5946_6449 163
282 3300050495 nmdc:mga04h51_2632_c1 nmdc:mga04h51_2632_c1_3448_3954 163
283 3300050496 nmdc:mga07m45_3690_c1 nmdc:mga07m45_3690_c1_6309_6812 163
284 3300050496 nmdc:mga07m45_814_c1 nmdc:mga07m45_814_c1_646_1149 163
285 3300050516 nmdc:mga0sz30_15926_c1 nmdc:mga0sz30_15926_c1_635_1141 163
286 3300053093 Ga0500651_0076169 Ga0500651_0076169_271_783 163
287 3300053129 Ga0500628_054417 Ga0500628_054417_153_674 163
288 3300053161 Ga0500634_0030574 Ga0500634_0030574_2114_2644 163
289 3300061719 Ga0466962_0144833 Ga0466962_0144833_409_927 163
290 iso_pu_bacteria 2643221609 2644059324 163
291 iso_pu_bacteria 2643221611 2644075638 163
292 iso_pu_bacteria 2738543012 2739240820 163
293 iso_pu_bacteria 2816332133 2816472102 163
294 3300005353 Ga0070669_100041408 Ga0070669_1000414084 164
295 3300005356 Ga0070674_100169631 Ga0070674_1001696313 164
296 3300005364 Ga0070673_100150109 Ga0070673_1001501093 164
297 3300005456 Ga0070678_100087959 Ga0070678_1000879592 164
298 3300005530 Ga0070679_100238893 Ga0070679_1002388932 164
299 3300005543 Ga0070672_100317895 Ga0070672_1003178952 164
300 3300005548 Ga0070665_100074863 Ga0070665_1000748633 164
301 3300005841 Ga0068863_100067610 Ga0068863_1000676104 164
302 3300005844 Ga0068862_101186363 Ga0068862_1011863632 164
303 3300006038 Ga0075365_10054918 Ga0075365_100549184 164
304 3300006178 Ga0075367_10442482 Ga0075367_104424822 164
305 3300006195 Ga0075366_10129934 Ga0075366_101299342 164
306 3300006353 Ga0075370_10001649 Ga0075370_100016493 164
307 3300014497 Ga0182008_10000191 Ga0182008_1000019148 164
308 3300015683 Ga0183362_10005 Ga0183362_10005207 164
309 3300021361 Ga0213872_10034761 Ga0213872_100347612 164
310 3300025921 Ga0207652_10105485 Ga0207652_101054852 164
311 3300025923 Ga0207681_10011609 Ga0207681_100116095 164
312 3300025937 Ga0207669_10133207 Ga0207669_101332073 164
313 3300025942 Ga0207689_10257160 Ga0207689_102571602 164
314 3300025960 Ga0207651_10135350 Ga0207651_101353503 164
315 3300026088 Ga0207641_10054358 Ga0207641_100543584 164
316 3300026095 Ga0207676_10795326 Ga0207676_107953261 164
317 3300026121 Ga0207683_10068577 Ga0207683_100685772 164
318 3300028379 Ga0268266_10017085 Ga0268266_100170855 164
319 3300028794 Ga0307515_10000419 Ga0307515_1000041957 164
320 3300031548 Ga0307408_100100427 Ga0307408_1001004274 164
321 3300031731 Ga0307405_10040765 Ga0307405_100407651 164
322 3300031824 Ga0307413_10494581 Ga0307413_104945812 164
323 3300032002 Ga0307416_100034322 Ga0307416_1000343224 164
324 3300042122 Ga0450920_075715 Ga0450920_075715_81_575 164
325 3300042532 Ga0450893_0001490 Ga0450893_0001490_1672_2166 164
326 3300042876 Ga0451577_0000453 Ga0451577_0000453_26530_27063 164
327 3300042876 Ga0451577_1155411 Ga0451577_1155411_108_680 164
328 3300044712 Ga0453684_0002072 Ga0453684_0002072_44433_44966 164
329 3300044712 Ga0453684_0544495 Ga0453684_0544495_409_981 164
330 3300045051 Ga0451576_0000950 Ga0451576_0000950_44439_44972 164
331 3300045051 Ga0451576_0149889 Ga0451576_0149889_1314_1886 164
332 3300048925 Ga0496122_0000324 Ga0496122_0000324_48833_49327 164
333 3300048925 Ga0496122_0185253 Ga0496122_0185253_216_791 164
334 3300048926 Ga0496123_0000160 Ga0496123_0000160_92827_93321 164
335 3300048927 Ga0496124_0177864 Ga0496124_0177864_395_889 164
336 3300049571 Ga0501034_0668237 Ga0501034_0668237_210_731 164
337 3300050489 nmdc:mga03683_11355_c1 nmdc:mga03683_11355_c1_487_981 164
338 3300050489 nmdc:mga03683_602486_c1 nmdc:mga03683_602486_c1_17_511 164
339 3300050493 nmdc:mga0k408_206388_c1 nmdc:mga0k408_206388_c1_235_729 164
340 3300053125 Ga0500618_090293 Ga0500618_090293_36_530 164
341 3300053136 Ga0500559_0004515 Ga0500559_0004515_5567_6076 164
342 3300053136 Ga0500559_0144581 Ga0500559_0144581_252_746 164
343 iso_pu_bacteria 2904541872 2904547110 164
344 iso_pu_bacteria 2929160207 2929165664 164
345 iso_pu_bacteria 2945909444 2945909680 164
346 iso_pu_bacteria 2945984333 2945988348 164
347 iso_pu_bacteria 2954767861 2954769135 164
348 iso_pu_bacteria 2974320154 2974320603 164
349 3300001979 JGI24740J21852_10003589 JGI24740J21852_100035894 165
350 3300001989 JGI24739J22299_10083173 JGI24739J22299_100831732 165
351 3300002739 JGI25158J39367_1003768 JGI25158J39367_10037683 165
352 3300002774 JGI25150J39212_1007118 JGI25150J39212_10071183 165
353 3300002987 JGI25159J45721_1013528 JGI25159J45721_10135281 165
354 3300003187 JGI25151J46595_10010236 JGI25151J46595_100102362 165
355 3300003187 JGI25151J46595_10037898 JGI25151J46595_100378983 165
356 3300003578 Ga0006562J51391_1132144 Ga0006562J51391_11321445 165
357 3300003578 Ga0006562J51391_1132145 Ga0006562J51391_11321451 165
358 3300003760 Ga0055527_1014536 Ga0055527_10145362 165
359 3300003761 Ga0055535_1001590 Ga0055535_10015903 165
360 3300003762 Ga0055542_1000036 Ga0055542_1000036156 165
361 3300003773 Ga0055537_1000555 Ga0055537_100055511 165
362 3300003781 Ga0055536_1009989 Ga0055536_10099892 165
363 3300003781 Ga0055536_1032144 Ga0055536_10321443 165
364 3300003784 Ga0055534_1000153 Ga0055534_100015310 165
365 3300003784 Ga0055534_1000465 Ga0055534_10004655 165
366 3300003790 Ga0055528_1000291 Ga0055528_100029132 165
367 3300003790 Ga0055528_1023606 Ga0055528_10236064 165
368 3300003791 Ga0055530_10002388 Ga0055530_100023886 165
369 3300003791 Ga0055530_10021424 Ga0055530_100214242 165
370 3300003792 Ga0055540_1017998 Ga0055540_10179983 165
371 3300003792 Ga0055540_1031421 Ga0055540_10314212 165
372 3300003794 Ga0055531_10020418 Ga0055531_100204183 165
373 3300004625 Ga0055543_1001133 Ga0055543_10011339 165
374 3300004625 Ga0055543_1017654 Ga0055543_10176542 165
375 3300005262 Ga0065165_1001031 Ga0065165_10010313 165
376 3300005262 Ga0065165_1129929 Ga0065165_11299291 165
377 3300005288 Ga0065714_10013668 Ga0065714_100136683 165
378 3300005289 Ga0065704_10020258 Ga0065704_100202582 165
379 3300005327 Ga0070658_10230320 Ga0070658_102303203 165
380 3300005334 Ga0068869_100995427 Ga0068869_1009954271 165
381 3300005335 Ga0070666_10019943 Ga0070666_100199433 165
382 3300005338 Ga0068868_100157144 Ga0068868_1001571443 165
383 3300005347 Ga0070668_101563388 Ga0070668_1015633881 165
384 3300005354 Ga0070675_100276062 Ga0070675_1002760623 165
385 3300005364 Ga0070673_101514889 Ga0070673_1015148891 165
386 3300005366 Ga0070659_100720456 Ga0070659_1007204562 165
387 3300005367 Ga0070667_100056587 Ga0070667_1000565874 165
388 3300005455 Ga0070663_100741519 Ga0070663_1007415191 165
389 3300005456 Ga0070678_100078537 Ga0070678_1000785374 165
390 3300005457 Ga0070662_100023748 Ga0070662_1000237485 165
391 3300005457 Ga0070662_100294980 Ga0070662_1002949802 165
392 3300005459 Ga0068867_100899544 Ga0068867_1008995441 165
393 3300005539 Ga0068853_100117976 Ga0068853_1001179763 165
394 3300005543 Ga0070672_100156490 Ga0070672_1001564903 165
395 3300005543 Ga0070672_100843335 Ga0070672_1008433352 165
396 3300005548 Ga0070665_100001342 Ga0070665_1000013427 165
397 3300005563 Ga0068855_100067788 Ga0068855_1000677885 165
398 3300005564 Ga0070664_100011880 Ga0070664_1000118802 165
399 3300005577 Ga0068857_100007211 Ga0068857_1000072111 165
400 3300005577 Ga0068857_100373630 Ga0068857_1003736301 165
401 3300005578 Ga0068854_101338760 Ga0068854_1013387601 165
402 3300005616 Ga0068852_100074659 Ga0068852_1000746592 165
403 3300005616 Ga0068852_100105559 Ga0068852_1001055594 165
404 3300005718 Ga0068866_10575434 Ga0068866_105754342 165
405 3300005834 Ga0068851_10014073 Ga0068851_100140734 165
406 3300005844 Ga0068862_100324040 Ga0068862_1003240402 165
407 3300006038 Ga0075365_10046973 Ga0075365_100469732 165
408 3300006048 Ga0075363_100010260 Ga0075363_1000102603 165
409 3300006048 Ga0075363_100017158 Ga0075363_1000171584 165
410 3300006048 Ga0075363_100200977 Ga0075363_1002009771 165
411 3300006051 Ga0075364_10050216 Ga0075364_100502162 165
412 3300006177 Ga0075362_10009998 Ga0075362_100099984 165
413 3300006177 Ga0075362_10016579 Ga0075362_100165792 165
414 3300006177 Ga0075362_10054707 Ga0075362_100547073 165
415 3300006178 Ga0075367_10024343 Ga0075367_100243434 165
416 3300006195 Ga0075366_10059307 Ga0075366_100593071 165
417 3300006195 Ga0075366_10110206 Ga0075366_101102062 165
418 3300006353 Ga0075370_10002258 Ga0075370_100022585 165
419 3300006353 Ga0075370_10009173 Ga0075370_100091735 165
420 3300006353 Ga0075370_10043241 Ga0075370_100432412 165
421 3300006353 Ga0075370_10112371 Ga0075370_101123712 165
422 3300006353 Ga0075370_10167614 Ga0075370_101676142 165
423 3300006948 Ga0099826_10026745 Ga0099826_100267455 165
424 3300006948 Ga0099826_10446520 Ga0099826_104465201 165
425 3300009036 Ga0105244_10027858 Ga0105244_100278583 165
426 3300009036 Ga0105244_10100182 Ga0105244_101001822 165
427 3300009036 Ga0105244_10117325 Ga0105244_101173252 165
428 3300009036 Ga0105244_10252782 Ga0105244_102527822 165
429 3300009093 Ga0105240_10132454 Ga0105240_101324544 165
430 3300009093 Ga0105240_10938232 Ga0105240_109382322 165
431 3300009098 Ga0105245_10138838 Ga0105245_101388382 165
432 3300009148 Ga0105243_10014356 Ga0105243_100143563 165
433 3300009148 Ga0105243_10063082 Ga0105243_100630823 165
434 3300009148 Ga0105243_10122514 Ga0105243_101225143 165
435 3300009174 Ga0105241_10482392 Ga0105241_104823922 165
436 3300009545 Ga0105237_11052568 Ga0105237_110525682 165
437 3300009551 Ga0105238_10133660 Ga0105238_101336604 165
438 3300009551 Ga0105238_10216769 Ga0105238_102167692 165
439 3300010375 Ga0105239_10591978 Ga0105239_105919781 165
440 3300011119 Ga0105246_10366770 Ga0105246_103667702 165
441 3300011119 Ga0105246_11175429 Ga0105246_111754291 165
442 3300012498 Ga0157345_1016110 Ga0157345_10161102 165
443 3300013100 Ga0157373_10434712 Ga0157373_104347122 165
444 3300013104 Ga0157370_10532596 Ga0157370_105325962 165
445 3300013105 Ga0157369_10029769 Ga0157369_100297693 165
446 3300013306 Ga0163162_10030214 Ga0163162_100302143 165
447 3300013307 Ga0157372_10323504 Ga0157372_103235042 165
448 3300013308 Ga0157375_10424561 Ga0157375_104245613 165
449 3300014497 Ga0182008_10008989 Ga0182008_100089896 165
450 3300014497 Ga0182008_10022737 Ga0182008_100227375 165
451 3300014497 Ga0182008_10076861 Ga0182008_100768612 165
452 3300014745 Ga0157377_10731483 Ga0157377_107314832 165
453 3300014968 Ga0157379_10404697 Ga0157379_104046972 165
454 3300014969 Ga0157376_10324969 Ga0157376_103249692 165
455 3300014969 Ga0157376_11621233 Ga0157376_116212331 165
456 3300015261 Ga0182006_1010781 Ga0182006_10107812 165
457 3300015262 Ga0182007_10001495 Ga0182007_100014956 165
458 3300015262 Ga0182007_10005458 Ga0182007_100054584 165
459 3300015262 Ga0182007_10026502 Ga0182007_100265023 165
460 3300017792 Ga0163161_10066688 Ga0163161_100666884 165
461 3300017792 Ga0163161_10258708 Ga0163161_102587083 165
462 3300017792 Ga0163161_10461403 Ga0163161_104614032 165
463 3300025228 Ga0209672_100321 Ga0209672_10032127 165
464 3300025229 Ga0209147_100434 Ga0209147_10043419 165
465 3300025242 Ga0209258_100091 Ga0209258_100091157 165
466 3300025245 Ga0207425_1000190 Ga0207425_10001908 165
467 3300025245 Ga0207425_1016639 Ga0207425_10166392 165
468 3300025254 Ga0209148_1000033 Ga0209148_1000033327 165
469 3300025258 Ga0209129_1000091 Ga0209129_100009135 165
470 3300025258 Ga0209129_1001462 Ga0209129_100146212 165
471 3300025258 Ga0209129_1002158 Ga0209129_10021586 165
472 3300025263 Ga0209565_1000020 Ga0209565_1000020135 165
473 3300025263 Ga0209565_1000335 Ga0209565_10003353 165
474 3300025263 Ga0209565_1004510 Ga0209565_10045103 165
475 3300025273 Ga0209673_1000072 Ga0209673_100007265 165
476 3300025273 Ga0209673_1000154 Ga0209673_100015450 165
477 3300025273 Ga0209673_1002551 Ga0209673_100255111 165
478 3300025273 Ga0209673_1002946 Ga0209673_10029465 165
479 3300025284 Ga0209130_1000140 Ga0209130_100014057 165
480 3300025284 Ga0209130_1000203 Ga0209130_100020359 165
481 3300025284 Ga0209130_1003870 Ga0209130_10038705 165
482 3300025291 Ga0209675_1000014 Ga0209675_1000014123 165
483 3300025291 Ga0209675_1001248 Ga0209675_10012483 165
484 3300025291 Ga0209675_1002386 Ga0209675_10023863 165
485 3300025291 Ga0209675_1003660 Ga0209675_10036605 165
486 3300025291 Ga0209675_1030353 Ga0209675_10303532 165
487 3300025291 Ga0209675_1070011 Ga0209675_10700112 165
488 3300025292 Ga0209676_1000088 Ga0209676_100008834 165
489 3300025292 Ga0209676_1001287 Ga0209676_100128723 165
490 3300025292 Ga0209676_1001392 Ga0209676_100139219 165
491 3300025292 Ga0209676_1001762 Ga0209676_100176223 165
492 3300025292 Ga0209676_1043089 Ga0209676_10430892 165
493 3300025294 Ga0209025_1000207 Ga0209025_100020758 165
494 3300025294 Ga0209025_1000286 Ga0209025_100028636 165
495 3300025294 Ga0209025_1000356 Ga0209025_100035658 165
496 3300025294 Ga0209025_1007998 Ga0209025_10079986 165
497 3300025294 Ga0209025_1023793 Ga0209025_10237933 165
498 3300025295 Ga0209564_1000103 Ga0209564_100010356 165
499 3300025295 Ga0209564_1000597 Ga0209564_10005973 165
500 3300025297 Ga0209758_1000092 Ga0209758_1000092113 165
501 3300025297 Ga0209758_1007051 Ga0209758_10070513 165
502 3300025297 Ga0209758_1126381 Ga0209758_11263811 165
503 3300025298 Ga0209050_1000511 Ga0209050_100051144 165
504 3300025298 Ga0209050_1000758 Ga0209050_10007583 165
505 3300025299 Ga0209256_1000065 Ga0209256_100006526 165
506 3300025299 Ga0209256_1000094 Ga0209256_100009483 165
507 3300025302 Ga0207426_1000084 Ga0207426_1000084146 165
508 3300025302 Ga0207426_1002447 Ga0207426_100244710 165
509 3300025303 Ga0209051_1000069 Ga0209051_1000069168 165
510 3300025303 Ga0209051_1000326 Ga0209051_100032620 165
511 3300025303 Ga0209051_1000335 Ga0209051_100033519 165
512 3300025303 Ga0209051_1000461 Ga0209051_100046122 165
513 3300025303 Ga0209051_1047887 Ga0209051_10478873 165
514 3300025304 Ga0209257_1000093 Ga0209257_1000093210 165
515 3300025304 Ga0209257_1000249 Ga0209257_100024914 165
516 3300025304 Ga0209257_1012145 Ga0209257_10121454 165
517 3300025304 Ga0209257_1030923 Ga0209257_10309233 165
518 3300025321 Ga0207656_10087925 Ga0207656_100879252 165
519 3300025728 Ga0207655_1001919 Ga0207655_100191914 165
520 3300025893 Ga0207682_10101735 Ga0207682_101017353 165
521 3300025903 Ga0207680_10012314 Ga0207680_100123144 165
522 3300025904 Ga0207647_10115716 Ga0207647_101157162 165
523 3300025911 Ga0207654_10587457 Ga0207654_105874572 165
524 3300025924 Ga0207694_10158528 Ga0207694_101585283 165
525 3300025924 Ga0207694_10364074 Ga0207694_103640742 165
526 3300025927 Ga0207687_10445974 Ga0207687_104459742 165
527 3300025932 Ga0207690_10193762 Ga0207690_101937622 165
528 3300025933 Ga0207706_10047536 Ga0207706_100475364 165
529 3300025935 Ga0207709_10000570 Ga0207709_100005706 165
530 3300025935 Ga0207709_10000803 Ga0207709_1000080321 165
531 3300025935 Ga0207709_10138308 Ga0207709_101383082 165
532 3300025940 Ga0207691_10148957 Ga0207691_101489572 165
533 3300025940 Ga0207691_10756458 Ga0207691_107564582 165
534 3300025945 Ga0207679_10033624 Ga0207679_100336245 165
535 3300025981 Ga0207640_10030195 Ga0207640_100301952 165
536 3300025981 Ga0207640_10361490 Ga0207640_103614902 165
537 3300025986 Ga0207658_10012974 Ga0207658_100129744 165
538 3300026023 Ga0207677_10241376 Ga0207677_102413763 165
539 3300026041 Ga0207639_10089989 Ga0207639_100899893 165
540 3300026041 Ga0207639_10305972 Ga0207639_103059722 165
541 3300026088 Ga0207641_11341825 Ga0207641_113418252 165
542 3300026116 Ga0207674_10138811 Ga0207674_101388113 165
543 3300026142 Ga0207698_10057775 Ga0207698_100577752 165
544 3300026142 Ga0207698_10359117 Ga0207698_103591172 165
545 3300027614 Ga0209970_1030891 Ga0209970_10308912 165
546 3300027666 Ga0209282_1009487 Ga0209282_10094875 165
547 3300027682 Ga0209971_1011840 Ga0209971_10118402 165
548 3300028379 Ga0268266_10012485 Ga0268266_100124855 165
549 3300028380 Ga0268265_10257501 Ga0268265_102575013 165
550 3300028794 Ga0307515_10226265 Ga0307515_102262652 165
551 3300028794 Ga0307515_10478530 Ga0307515_104785302 165
552 3300030731 Ga0316177_1110995 Ga0316177_11109952 165
553 3300030733 Ga0314311_1041992 Ga0314311_10419924 165
554 3300030734 Ga0316179_1055282 Ga0316179_10552825 165
555 3300030736 Ga0316180_1036074 Ga0316180_10360742 165
556 3300030742 Ga0316183_1039276 Ga0316183_10392762 165
557 3300030744 Ga0316181_1029714 Ga0316181_10297143 165
558 3300030744 Ga0316181_1154876 Ga0316181_11548762 165
559 3300030745 Ga0316182_1102772 Ga0316182_11027722 165
560 3300030745 Ga0316182_1407517 Ga0316182_14075172 165
561 3300031456 Ga0307513_10250709 Ga0307513_102507092 165
562 3300031548 Ga0307408_100673035 Ga0307408_1006730352 165
563 3300031548 Ga0307408_100889256 Ga0307408_1008892561 165
564 3300031649 Ga0307514_10056121 Ga0307514_100561212 165
565 3300031731 Ga0307405_10044321 Ga0307405_100443214 165
566 3300031731 Ga0307405_10095397 Ga0307405_100953974 165
567 3300031731 Ga0307405_10632450 Ga0307405_106324503 165
568 3300031901 Ga0307406_10003068 Ga0307406_1000306810 165
569 3300031901 Ga0307406_10153607 Ga0307406_101536072 165
570 3300031901 Ga0307406_10337936 Ga0307406_103379362 165
571 3300031901 Ga0307406_10461136 Ga0307406_104611362 165
572 3300031911 Ga0307412_10027679 Ga0307412_100276791 165
573 3300031911 Ga0307412_10433288 Ga0307412_104332881 165
574 3300031911 Ga0307412_11082029 Ga0307412_110820291 165
575 3300031911 Ga0307412_11396158 Ga0307412_113961582 165
576 3300031995 Ga0307409_101546513 Ga0307409_1015465131 165
577 3300032002 Ga0307416_100354569 Ga0307416_1003545692 165
578 3300032002 Ga0307416_102604010 Ga0307416_1026040101 165
579 3300032004 Ga0307414_10458780 Ga0307414_104587802 165
580 3300032005 Ga0307411_10185441 Ga0307411_101854413 165
581 3300041404 Ga0439436_0000145 Ga0439436_0000145_12380_12877 165
582 3300041404 Ga0439436_0055431 Ga0439436_0055431_278_775 165
583 3300041406 Ga0439439_0064163 Ga0439439_0064163_149_646 165
584 3300041407 Ga0439447_025789 Ga0439447_025789_350_847 165
585 3300041411 Ga0439466_0016359 Ga0439466_0016359_301_798 165
586 3300041411 Ga0439466_0019274 Ga0439466_0019274_1724_2221 165
587 3300041413 Ga0439465_0008576 Ga0439465_0008576_845_1342 165
588 3300041452 Ga0451793_1822058 Ga0451793_1822058_141_638 165
589 3300041486 Ga0451807_0148583 Ga0451807_0148583_24_521 165
590 3300041491 Ga0451833_0202136 Ga0451833_0202136_39_554 165
591 3300041997 Ga0439431_0006720 Ga0439431_0006720_1337_1834 165
592 3300041999 Ga0439433_0000215 Ga0439433_0000215_593_1090 165
593 3300042002 Ga0439442_010231 Ga0439442_010231_259_756 165
594 3300042002 Ga0439442_010282 Ga0439442_010282_1298_1795 165
595 3300042004 Ga0439445_0022552 Ga0439445_0022552_420_917 165
596 3300042004 Ga0439445_0075303 Ga0439445_0075303_257_754 165
597 3300042006 Ga0439432_000575 Ga0439432_000575_4839_5336 165
598 3300042007 Ga0439449_0001297 Ga0439449_0001297_8446_8943 165
599 3300042007 Ga0439449_0001545 Ga0439449_0001545_160_657 165
600 3300042010 Ga0439452_029342 Ga0439452_029342_410_907 165
601 3300042012 Ga0439455_0069064 Ga0439455_0069064_89_589 165
602 3300042014 Ga0439457_009113 Ga0439457_009113_1711_2208 165
603 3300042015 Ga0439462_0030104 Ga0439462_0030104_854_1351 165
604 3300042015 Ga0439462_0044074 Ga0439462_0044074_390_887 165
605 3300042134 Ga0450898_015673 Ga0450898_015673_301_798 165
606 3300042145 Ga0450906_028509 Ga0450906_028509_439_939 165
607 3300042146 Ga0450907_013950 Ga0450907_013950_553_1050 165
608 3300042147 Ga0450910_003817 Ga0450910_003817_1397_1894 165
609 3300042156 Ga0439446_0001157 Ga0439446_0001157_5247_5744 165
610 3300042184 Ga0450908_001944 Ga0450908_001944_338_835 165
611 3300042185 Ga0450909_046920 Ga0450909_046920_122_619 165
612 3300042435 Ga0439434_0065430 Ga0439434_0065430_32_529 165
613 3300042531 Ga0450918_007108 Ga0450918_007108_1073_1570 165
614 3300046453 Ga0495627_071523 Ga0495627_071523_333_830 165
615 3300046459 Ga0495629_0240844 Ga0495629_0240844_678_1175 165
616 3300046475 Ga0495639_0008381 Ga0495639_0008381_3341_3838 165
617 3300046506 Ga0495583_0330445 Ga0495583_0330445_81_578 165
618 3300046512 Ga0495610_0030481 Ga0495610_0030481_339_836 165
619 3300046513 Ga0495616_0001394 Ga0495616_0001394_9593_10090 165
620 3300046515 Ga0495620_0028397 Ga0495620_0028397_2033_2530 165
621 3300046518 Ga0495631_0001085 Ga0495631_0001085_3965_4462 165
622 3300046520 Ga0495637_0022112 Ga0495637_0022112_2148_2645 165
623 3300046520 Ga0495637_0113806 Ga0495637_0113806_423_920 165
624 3300046522 Ga0495643_0086670 Ga0495643_0086670_890_1402 165
625 3300046530 Ga0495654_0137807 Ga0495654_0137807_500_997 165
626 3300046538 Ga0495609_0082169 Ga0495609_0082169_440_940 165
627 3300046539 Ga0495621_0015001 Ga0495621_0015001_1856_2353 165
628 3300046539 Ga0495621_0064455 Ga0495621_0064455_205_702 165
629 3300046615 Ga0495656_0000055 Ga0495656_0000055_51992_52489 165
630 3300046616 Ga0495668_0059881 Ga0495668_0059881_280_777 165
631 3300046660 Ga0495625_0002019 Ga0495625_0002019_9132_9629 165
632 3300046663 Ga0495635_0063641 Ga0495635_0063641_198_695 165
633 3300046665 Ga0495661_0382408 Ga0495661_0382408_124_621 165
634 3300046674 Ga0495588_0264290 Ga0495588_0264290_88_585 165
635 3300046674 Ga0495588_0470056 Ga0495588_0470056_17_514 165
636 3300046690 Ga0495624_0451607 Ga0495624_0451607_230_727 165
637 3300046691 Ga0495670_0019185 Ga0495670_0019185_2802_3299 165
638 3300046691 Ga0495670_0294458 Ga0495670_0294458_172_669 165
639 3300046692 Ga0495671_0019757 Ga0495671_0019757_934_1431 165
640 3300047321 Ga0495676_0003857 Ga0495676_0003857_254_751 165
641 3300047445 Ga0495677_0055771 Ga0495677_0055771_393_890 165
642 3300047673 Ga0495593_0065889 Ga0495593_0065889_284_781 165
643 3300048903 Ga0496100_0001576 Ga0496100_0001576_1203_1700 165
644 3300048905 Ga0496102_0102436 Ga0496102_0102436_2024_2521 165
645 3300048906 Ga0496103_0194490 Ga0496103_0194490_525_1022 165
646 3300048908 Ga0496105_0006863 Ga0496105_0006863_326_823 165
647 3300048910 Ga0496107_0054621 Ga0496107_0054621_193_690 165
648 3300048912 Ga0496109_0082373 Ga0496109_0082373_2265_2762 165
649 3300048913 Ga0496110_0364537 Ga0496110_0364537_450_947 165
650 3300048913 Ga0496110_1002642 Ga0496110_1002642_45_542 165
651 3300048914 Ga0496111_0204021 Ga0496111_0204021_323_820 165
652 3300048916 Ga0496113_0393002 Ga0496113_0393002_161_658 165
653 3300048917 Ga0496114_0281861 Ga0496114_0281861_79_576 165
654 3300048919 Ga0496116_0107094 Ga0496116_0107094_625_1125 165
655 3300048920 Ga0496117_0082571 Ga0496117_0082571_549_1046 165
656 3300048920 Ga0496117_0086486 Ga0496117_0086486_479_976 165
657 3300048920 Ga0496117_0251954 Ga0496117_0251954_206_706 165
658 3300048921 Ga0496118_0097166 Ga0496118_0097166_19_516 165
659 3300048921 Ga0496118_0106508 Ga0496118_0106508_484_981 165
660 3300048924 Ga0496121_0069958 Ga0496121_0069958_918_1418 165
661 3300048925 Ga0496122_0051838 Ga0496122_0051838_220_720 165
662 3300048925 Ga0496122_0146934 Ga0496122_0146934_127_660 165
663 3300048926 Ga0496123_0067679 Ga0496123_0067679_199_696 165
664 3300048926 Ga0496123_0193176 Ga0496123_0193176_223_726 165
665 3300048926 Ga0496123_0236002 Ga0496123_0236002_202_735 165
666 3300048927 Ga0496124_0013362 Ga0496124_0013362_6473_6970 165
667 3300048927 Ga0496124_0158716 Ga0496124_0158716_1069_1566 165
668 3300048928 Ga0496125_0036017 Ga0496125_0036017_3407_3904 165
669 3300048928 Ga0496125_0193321 Ga0496125_0193321_618_1115 165
670 3300048929 Ga0496126_0410964 Ga0496126_0410964_260_757 165
671 3300049679 Ga0501249_002237 Ga0501249_002237_1451_1948 165
672 3300049705 Ga0501225_0098687 Ga0501225_0098687_334_831 165
673 3300049759 Ga0501262_000323 Ga0501262_000323_471_968 165
674 3300050489 nmdc:mga03683_25447_c1 nmdc:mga03683_25447_c1_92_589 165
675 3300050489 nmdc:mga03683_44131_c1 nmdc:mga03683_44131_c1_161_658 165
676 3300050490 nmdc:mga03n38_14679_c1 nmdc:mga03n38_14679_c1_378_875 165
677 3300050490 nmdc:mga03n38_296622_c1 nmdc:mga03n38_296622_c1_125_622 165
678 3300050491 nmdc:mga00v17_13376_c1 nmdc:mga00v17_13376_c1_3805_4302 165
679 3300050492 nmdc:mga0yw44_120011_c1 nmdc:mga0yw44_120011_c1_845_1342 165
680 3300050493 nmdc:mga0k408_18277_c1 nmdc:mga0k408_18277_c1_1116_1613 165
681 3300050496 nmdc:mga07m45_3563_c1 nmdc:mga07m45_3563_c1_6874_7371 165
682 3300050496 nmdc:mga07m45_3602_c1 nmdc:mga07m45_3602_c1_4785_5282 165
683 3300050496 nmdc:mga07m45_645240_c1 nmdc:mga07m45_645240_c1_19_525 165
684 3300050516 nmdc:mga0sz30_50071_c1 nmdc:mga0sz30_50071_c1_129_626 165
685 3300053079 Ga0500610_0000194 Ga0500610_0000194_15065_15562 165
686 3300053079 Ga0500610_0090294 Ga0500610_0090294_290_787 165
687 3300053087 Ga0500643_019165 Ga0500643_019165_1080_1577 165
688 3300053093 Ga0500651_0000082 Ga0500651_0000082_10050_10547 165
689 3300053110 Ga0500571_000162 Ga0500571_000162_352_849 165
690 3300053117 Ga0500593_013811 Ga0500593_013811_2881_3378 165
691 3300053121 Ga0500607_016835 Ga0500607_016835_1546_2043 165
692 3300053122 Ga0500608_010513 Ga0500608_010513_177_674 165
693 3300053122 Ga0500608_186786 Ga0500608_186786_256_753 165
694 3300053125 Ga0500618_063913 Ga0500618_063913_267_764 165
695 3300053134 Ga0500658_0000170 Ga0500658_0000170_9062_9559 165
696 3300053134 Ga0500658_0001413 Ga0500658_0001413_460_957 165
697 3300053136 Ga0500559_0025081 Ga0500559_0025081_1864_2361 165
698 3300053137 Ga0500561_0124276 Ga0500561_0124276_207_704 165
699 3300053138 Ga0500564_012901 Ga0500564_012901_3167_3664 165
700 3300053139 Ga0500568_0003074 Ga0500568_0003074_8895_9392 165
701 3300053141 Ga0500574_050480 Ga0500574_050480_99_596 165
702 3300053161 Ga0500634_0013938 Ga0500634_0013938_2409_2906 165
703 3300053162 Ga0500638_044950 Ga0500638_044950_131_628 165
704 3300053177 Ga0500636_0038384 Ga0500636_0038384_2075_2572 165
705 3300053729 Ga0500625_072935 Ga0500625_072935_804_1310 165
706 iso_pu_bacteria 2738541277 2738721439 165
707 iso_pu_bacteria 2738541307 2738880794 165
708 iso_pu_bacteria 2738543019 2739281108 165
709 iso_pu_bacteria 2842718218 2842718430 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

37

179

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p81-assembly1.cif.gz_C structure of ancestral pyrr protein (ancorangepyrr) 0.8 4 163
1w30-assembly1.cif.gz_A-2 pyrr of mycobacterium tuberculosis as a potential drug target 0.7975 6 163
4p83-assembly1.cif.gz_C structure of engineered pyrr protein (purple pyrr) 0.7927 4 163
1ufr-assembly2.cif.gz_D crystal structure of tt1027 from thermus thermophilus hb8 0.791 7 163
4p81-assembly1.cif.gz_A structure of ancestral pyrr protein (ancorangepyrr) 0.7893 1 163
ID Description Score Start End Superfamily
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8033 6 163 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7692 2 163 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7682 6 163 3.40.50.2020
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7646 4 140 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.761 1 140 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A554WYG7-F1-model_v4 Bifunctional protein PyrR 0.9765 1 164
AF-A0A554WYG7-F1-model_v4 Bifunctional protein PyrR 0.9649 1 164
AF-A0A1C9VN93-F1-model_v4 deleted 0.9514 3 165
AF-A0A1L1PG86-F1-model_v4 Phosphoribosyltransferase 0.9513 3 163 GO:0016757
AF-A0A1Y0ELK8-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase 0.9502 4 163 GO:0016757

Feature Viewer

pLDDT pTM Quality
91.3 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map