F476657
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 390 | 660 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10044420|Ga0307513_100444205 |
| Length | 201 |
| Sequence | MTTSSPPPGASLSAARXXEGANAPSGGSEVRAATSVGALFLDAEALYRELLRGVQQLHTPQTKLVGVTSGGAWLVERLHADLKLAEPPNIISSAMHRDDFSKRGLVSGGRGQTTLNFDVNGAEILLLDDVLYTGRTIRAVLNELFDYGRPASVKLAVLVDRGGRELPVQADFAAARVALASTQLLALAHDNTGGFSFKVEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 7 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 8 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 9 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 12 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 13 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 14 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 15 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 16 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 17 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 18 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 19 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 20 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 21 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 22 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 23 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 24 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 25 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 26 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 27 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 28 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 29 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 30 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 31 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 32 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 33 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 34 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 35 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 36 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 37 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 38 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 39 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 40 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 41 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 42 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 43 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 44 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 45 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 46 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 47 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 48 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 49 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 50 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 51 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 52 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 53 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 54 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 55 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 56 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 57 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 69 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 73 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 207 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 208 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 209 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 210 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 211 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 212 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 213 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 243 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 244 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 245 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 248 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 251 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 252 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 253 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 254 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 255 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 256 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 257 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 258 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 259 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 260 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 261 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 262 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 263 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 264 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 265 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 266 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 267 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 268 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 269 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 270 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 271 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 272 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 275 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 276 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 277 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 280 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 281 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 282 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 283 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 338 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 339 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 340 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 348 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 349 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 350 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 351 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 354 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 368 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 369 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 370 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 372 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 373 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 376 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 383 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 384 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 386 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 389 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.81 |
| Metatranscriptomes | 0.28 |
| Isolates | 6.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.93 |
| Nodule | 0.71 |
| Rhizoplane | 2.4 |
| Rhizosphere | 58.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003589 | 3300001979 | Bacteria | 6768 |
| 2 | JGI24739J22299_10083173 | 3300001989 | Bacteria | 981 |
| 3 | JGI25158J39367_1003768 | 3300002739 | Bacteria | 2313 |
| 4 | JGI25150J39212_1007118 | 3300002774 | Bacteria | 2267 |
| 5 | JGI25159J45721_1013528 | 3300002987 | Bacteria | 1882 |
| 6 | JGI25151J46595_10010236 | 3300003187 | Bacteria | 4371 |
| 7 | JGI25151J46595_10037898 | 3300003187 | Bacteria | 1802 |
| 8 | Ga0006562J51391_1132144 | 3300003578 | Bacteria | 3632 |
| 9 | Ga0006562J51391_1132145 | 3300003578 | Bacteria | 2670 |
| 10 | Ga0055527_1014536 | 3300003760 | Bacteria | 866 |
| 11 | Ga0055535_1001590 | 3300003761 | Bacteria | 10852 |
| 12 | Ga0055542_1000036 | 3300003762 | Bacteria | 227346 |
| 13 | Ga0055537_1000555 | 3300003773 | Bacteria | 21167 |
| 14 | Ga0055536_1009989 | 3300003781 | Bacteria | 3837 |
| 15 | Ga0055536_1032144 | 3300003781 | Bacteria | 1362 |
| 16 | Ga0055534_1000153 | 3300003784 | Bacteria | 51189 |
| 17 | Ga0055534_1000465 | 3300003784 | Bacteria | 23108 |
| 18 | Ga0055528_1000291 | 3300003790 | Bacteria | 42773 |
| 19 | Ga0055528_1023606 | 3300003790 | Bacteria | 1870 |
| 20 | Ga0055530_10002388 | 3300003791 | Bacteria | 12164 |
| 21 | Ga0055530_10021424 | 3300003791 | Bacteria | 1905 |
| 22 | Ga0055540_1011297 | 3300003792 | Bacteria | 2890 |
| 23 | Ga0055540_1017998 | 3300003792 | Bacteria | 1952 |
| 24 | Ga0055540_1031421 | 3300003792 | Bacteria | 1219 |
| 25 | Ga0055531_10000452 | 3300003794 | Bacteria | 38120 |
| 26 | Ga0055531_10020418 | 3300003794 | Bacteria | 2621 |
| 27 | Ga0055543_1001133 | 3300004625 | Bacteria | 11427 |
| 28 | Ga0055543_1017654 | 3300004625 | Bacteria | 1339 |
| 29 | Ga0065165_1001031 | 3300005262 | Bacteria | 33766 |
| 30 | Ga0065165_1129929 | 3300005262 | Bacteria | 603 |
| 31 | Ga0065714_10013668 | 3300005288 | Bacteria | 3073 |
| 32 | Ga0065704_10020258 | 3300005289 | Bacteria | 1433 |
| 33 | Ga0070658_10230320 | 3300005327 | Bacteria | 1569 |
| 34 | Ga0070658_10528064 | 3300005327 | Bacteria | 1020 |
| 35 | Ga0070658_11281683 | 3300005327 | Bacteria | 636 |
| 36 | Ga0068869_100084256 | 3300005334 | Bacteria | 2379 |
| 37 | Ga0068869_100995427 | 3300005334 | Bacteria | 730 |
| 38 | Ga0070666_10019943 | 3300005335 | Bacteria | 4331 |
| 39 | Ga0068868_100157144 | 3300005338 | Bacteria | 1876 |
| 40 | Ga0068868_100276740 | 3300005338 | Bacteria | 1419 |
| 41 | Ga0068868_101337172 | 3300005338 | Bacteria | 666 |
| 42 | Ga0070660_100049803 | 3300005339 | Bacteria | 3222 |
| 43 | Ga0070668_101563388 | 3300005347 | Bacteria | 604 |
| 44 | Ga0070669_100041408 | 3300005353 | Bacteria | 3350 |
| 45 | Ga0070675_100276062 | 3300005354 | Bacteria | 1476 |
| 46 | Ga0070674_100169631 | 3300005356 | Bacteria | 1662 |
| 47 | Ga0070673_100150109 | 3300005364 | Bacteria | 1973 |
| 48 | Ga0070673_101514889 | 3300005364 | Bacteria | 633 |
| 49 | Ga0070659_100720456 | 3300005366 | Bacteria | 864 |
| 50 | Ga0070667_100056587 | 3300005367 | Bacteria | 3313 |
| 51 | Ga0070714_100389048 | 3300005435 | Bacteria | 1316 |
| 52 | Ga0070663_100741519 | 3300005455 | Bacteria | 838 |
| 53 | Ga0070678_100078537 | 3300005456 | Bacteria | 2493 |
| 54 | Ga0070678_100087959 | 3300005456 | Bacteria | 2374 |
| 55 | Ga0070678_100146237 | 3300005456 | Bacteria | 1898 |
| 56 | Ga0070662_100023748 | 3300005457 | Bacteria | 4216 |
| 57 | Ga0070662_100294980 | 3300005457 | Bacteria | 1315 |
| 58 | Ga0070681_10183730 | 3300005458 | Bacteria | 2012 |
| 59 | Ga0068867_100899544 | 3300005459 | Bacteria | 796 |
| 60 | Ga0070679_100003351 | 3300005530 | Bacteria | 14680 |
| 61 | Ga0070679_100238893 | 3300005530 | Bacteria | 1775 |
| 62 | Ga0068853_100117976 | 3300005539 | Bacteria | 2364 |
| 63 | Ga0070672_100156490 | 3300005543 | Bacteria | 1888 |
| 64 | Ga0070672_100317895 | 3300005543 | Bacteria | 1323 |
| 65 | Ga0070672_100843335 | 3300005543 | Bacteria | 808 |
| 66 | Ga0070665_100001342 | 3300005548 | Bacteria | 29261 |
| 67 | Ga0070665_100074863 | 3300005548 | Bacteria | 3392 |
| 68 | Ga0068855_100005901 | 3300005563 | Bacteria | 14932 |
| 69 | Ga0068855_100067788 | 3300005563 | Bacteria | 4155 |
| 70 | Ga0068855_100088468 | 3300005563 | Bacteria | 3577 |
| 71 | Ga0070664_100011880 | 3300005564 | Bacteria | 7069 |
| 72 | Ga0068857_100007211 | 3300005577 | Bacteria | 9573 |
| 73 | Ga0068857_100278939 | 3300005577 | Bacteria | 1537 |
| 74 | Ga0068857_100373630 | 3300005577 | Bacteria | 1323 |
| 75 | Ga0068857_100552560 | 3300005577 | Bacteria | 1085 |
| 76 | Ga0068854_101338760 | 3300005578 | Bacteria | 646 |
| 77 | Ga0068856_100276443 | 3300005614 | Bacteria | 1696 |
| 78 | Ga0068852_100074659 | 3300005616 | Bacteria | 2987 |
| 79 | Ga0068852_100105559 | 3300005616 | Bacteria | 2553 |
| 80 | Ga0068859_100866412 | 3300005617 | Bacteria | 989 |
| 81 | Ga0068866_10575434 | 3300005718 | Bacteria | 757 |
| 82 | Ga0068851_10014073 | 3300005834 | Bacteria | 3793 |
| 83 | Ga0068863_100067610 | 3300005841 | Bacteria | 3380 |
| 84 | Ga0068862_100324040 | 3300005844 | Bacteria | 1423 |
| 85 | Ga0068862_101186363 | 3300005844 | Bacteria | 761 |
| 86 | Ga0075365_10010759 | 3300006038 | Bacteria | 5345 |
| 87 | Ga0075365_10026066 | 3300006038 | Bacteria | 3706 |
| 88 | Ga0075365_10046973 | 3300006038 | Bacteria | 2837 |
| 89 | Ga0075365_10054918 | 3300006038 | Bacteria | 2642 |
| 90 | Ga0075368_10003556 | 3300006042 | Bacteria | 5220 |
| 91 | Ga0075363_100010260 | 3300006048 | Bacteria | 4437 |
| 92 | Ga0075363_100017158 | 3300006048 | Bacteria | 3586 |
| 93 | Ga0075363_100133765 | 3300006048 | Bacteria | 1392 |
| 94 | Ga0075363_100155634 | 3300006048 | Bacteria | 1292 |
| 95 | Ga0075363_100200977 | 3300006048 | Bacteria | 1139 |
| 96 | Ga0075363_100658257 | 3300006048 | Bacteria | 630 |
| 97 | Ga0075364_10050216 | 3300006051 | Bacteria | 2722 |
| 98 | Ga0075364_10104419 | 3300006051 | Bacteria | 1887 |
| 99 | Ga0075362_10009998 | 3300006177 | Bacteria | 3689 |
| 100 | Ga0075362_10016579 | 3300006177 | Bacteria | 3019 |
| 101 | Ga0075362_10044230 | 3300006177 | Bacteria | 1974 |
| 102 | Ga0075362_10045758 | 3300006177 | Bacteria | 1944 |
| 103 | Ga0075362_10054707 | 3300006177 | Bacteria | 1794 |
| 104 | Ga0075367_10024343 | 3300006178 | Bacteria | 3413 |
| 105 | Ga0075367_10069662 | 3300006178 | Bacteria | 2112 |
| 106 | Ga0075367_10442482 | 3300006178 | Bacteria | 823 |
| 107 | Ga0075369_10011519 | 3300006186 | Bacteria | 3481 |
| 108 | Ga0075366_10000589 | 3300006195 | Bacteria | 16965 |
| 109 | Ga0075366_10059307 | 3300006195 | Bacteria | 2273 |
| 110 | Ga0075366_10071595 | 3300006195 | Bacteria | 2065 |
| 111 | Ga0075366_10110206 | 3300006195 | Bacteria | 1655 |
| 112 | Ga0075366_10129934 | 3300006195 | Bacteria | 1520 |
| 113 | Ga0075366_10242191 | 3300006195 | Bacteria | 1099 |
| 114 | Ga0075366_10487844 | 3300006195 | Bacteria | 761 |
| 115 | Ga0075366_10736434 | 3300006195 | Bacteria | 612 |
| 116 | Ga0097621_100777563 | 3300006237 | Bacteria | 886 |
| 117 | Ga0075370_10001649 | 3300006353 | Bacteria | 9855 |
| 118 | Ga0075370_10002258 | 3300006353 | Bacteria | 8872 |
| 119 | Ga0075370_10009173 | 3300006353 | Bacteria | 5123 |
| 120 | Ga0075370_10017268 | 3300006353 | Bacteria | 3898 |
| 121 | Ga0075370_10041778 | 3300006353 | Bacteria | 2589 |
| 122 | Ga0075370_10043241 | 3300006353 | Bacteria | 2546 |
| 123 | Ga0075370_10089862 | 3300006353 | Bacteria | 1771 |
| 124 | Ga0075370_10112371 | 3300006353 | Bacteria | 1582 |
| 125 | Ga0075370_10167614 | 3300006353 | Bacteria | 1290 |
| 126 | Ga0097620_100866423 | 3300006931 | Bacteria | 989 |
| 127 | Ga0099826_10026745 | 3300006948 | Bacteria | 4250 |
| 128 | Ga0099826_10446520 | 3300006948 | Bacteria | 617 |
| 129 | Ga0105244_10027858 | 3300009036 | Bacteria | 3039 |
| 130 | Ga0105244_10100182 | 3300009036 | Bacteria | 1418 |
| 131 | Ga0105244_10117325 | 3300009036 | Bacteria | 1291 |
| 132 | Ga0105244_10252782 | 3300009036 | Bacteria | 821 |
| 133 | Ga0105240_10003014 | 3300009093 | Bacteria | 26498 |
| 134 | Ga0105240_10132454 | 3300009093 | Bacteria | 2989 |
| 135 | Ga0105240_10938232 | 3300009093 | Bacteria | 929 |
| 136 | Ga0105240_11156642 | 3300009093 | Bacteria | 821 |
| 137 | Ga0105245_10138838 | 3300009098 | Bacteria | 2287 |
| 138 | Ga0105245_11068095 | 3300009098 | Bacteria | 853 |
| 139 | Ga0105247_10426243 | 3300009101 | Bacteria | 951 |
| 140 | Ga0105243_10014356 | 3300009148 | Bacteria | 5995 |
| 141 | Ga0105243_10063082 | 3300009148 | Bacteria | 2969 |
| 142 | Ga0105243_10122514 | 3300009148 | Bacteria | 2195 |
| 143 | Ga0105243_10913664 | 3300009148 | Bacteria | 874 |
| 144 | Ga0105241_10117544 | 3300009174 | Bacteria | 2137 |
| 145 | Ga0105241_10410532 | 3300009174 | Bacteria | 1190 |
| 146 | Ga0105241_10482392 | 3300009174 | Bacteria | 1102 |
| 147 | Ga0105237_10001471 | 3300009545 | Bacteria | 31034 |
| 148 | Ga0105237_11052568 | 3300009545 | Bacteria | 820 |
| 149 | Ga0105238_10026974 | 3300009551 | Bacteria | 5855 |
| 150 | Ga0105238_10048663 | 3300009551 | Bacteria | 4271 |
| 151 | Ga0105238_10133660 | 3300009551 | Bacteria | 2459 |
| 152 | Ga0105238_10216769 | 3300009551 | Bacteria | 1890 |
| 153 | Ga0105249_11071879 | 3300009553 | Bacteria | 875 |
| 154 | Ga0105239_10002779 | 3300010375 | Bacteria | 21928 |
| 155 | Ga0105239_10113368 | 3300010375 | Bacteria | 3007 |
| 156 | Ga0105239_10591978 | 3300010375 | Bacteria | 1265 |
| 157 | Ga0105246_10366770 | 3300011119 | Bacteria | 1185 |
| 158 | Ga0105246_11175429 | 3300011119 | Bacteria | 705 |
| 159 | Ga0157345_1016110 | 3300012498 | Bacteria | 715 |
| 160 | Ga0157373_10434712 | 3300013100 | Bacteria | 943 |
| 161 | Ga0157371_10026087 | 3300013102 | Bacteria | 4251 |
| 162 | Ga0157370_10532596 | 3300013104 | Bacteria | 1077 |
| 163 | Ga0157369_10029769 | 3300013105 | Bacteria | 6030 |
| 164 | Ga0157378_10114643 | 3300013297 | Bacteria | 2476 |
| 165 | Ga0163162_10030214 | 3300013306 | Bacteria | 5369 |
| 166 | Ga0157372_10323504 | 3300013307 | Bacteria | 1795 |
| 167 | Ga0157375_10424561 | 3300013308 | Bacteria | 1495 |
| 168 | Ga0182008_10000191 | 3300014497 | Bacteria | 48580 |
| 169 | Ga0182008_10008989 | 3300014497 | Bacteria | 5413 |
| 170 | Ga0182008_10022737 | 3300014497 | Bacteria | 3209 |
| 171 | Ga0182008_10076861 | 3300014497 | Bacteria | 1643 |
| 172 | Ga0157377_10731483 | 3300014745 | Bacteria | 722 |
| 173 | Ga0157379_10404697 | 3300014968 | Bacteria | 1255 |
| 174 | Ga0157376_10324969 | 3300014969 | Bacteria | 1464 |
| 175 | Ga0157376_11621233 | 3300014969 | Bacteria | 681 |
| 176 | Ga0182006_1010781 | 3300015261 | Bacteria | 4048 |
| 177 | Ga0182007_10001495 | 3300015262 | Bacteria | 12514 |
| 178 | Ga0182007_10005458 | 3300015262 | Bacteria | 5581 |
| 179 | Ga0182007_10026502 | 3300015262 | Bacteria | 2008 |
| 180 | Ga0182007_10106535 | 3300015262 | Bacteria | 931 |
| 181 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 182 | Ga0163161_10066688 | 3300017792 | Bacteria | 2629 |
| 183 | Ga0163161_10258708 | 3300017792 | Bacteria | 1359 |
| 184 | Ga0163161_10461403 | 3300017792 | Bacteria | 1028 |
| 185 | Ga0213872_10034761 | 3300021361 | Bacteria | 2306 |
| 186 | Ga0209672_100321 | 3300025228 | Bacteria | 31338 |
| 187 | Ga0209147_100434 | 3300025229 | Bacteria | 26862 |
| 188 | Ga0209258_100091 | 3300025242 | Bacteria | 227454 |
| 189 | Ga0207425_1000190 | 3300025245 | Bacteria | 49963 |
| 190 | Ga0207425_1016639 | 3300025245 | Bacteria | 1629 |
| 191 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 192 | Ga0209129_1000091 | 3300025258 | Bacteria | 175716 |
| 193 | Ga0209129_1001462 | 3300025258 | Bacteria | 13171 |
| 194 | Ga0209129_1002158 | 3300025258 | Bacteria | 9947 |
| 195 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 196 | Ga0209565_1000335 | 3300025263 | Bacteria | 41834 |
| 197 | Ga0209565_1004510 | 3300025263 | Bacteria | 4213 |
| 198 | Ga0209673_1000072 | 3300025273 | Bacteria | 236935 |
| 199 | Ga0209673_1000154 | 3300025273 | Bacteria | 146394 |
| 200 | Ga0209673_1002551 | 3300025273 | Bacteria | 12441 |
| 201 | Ga0209673_1002946 | 3300025273 | Bacteria | 10686 |
| 202 | Ga0209673_1044171 | 3300025273 | Bacteria | 1236 |
| 203 | Ga0209130_1000140 | 3300025284 | Bacteria | 115434 |
| 204 | Ga0209130_1000203 | 3300025284 | Bacteria | 80023 |
| 205 | Ga0209130_1003870 | 3300025284 | Bacteria | 6030 |
| 206 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 207 | Ga0209675_1001248 | 3300025291 | Bacteria | 15267 |
| 208 | Ga0209675_1002386 | 3300025291 | Bacteria | 9687 |
| 209 | Ga0209675_1003660 | 3300025291 | Bacteria | 7197 |
| 210 | Ga0209675_1030353 | 3300025291 | Bacteria | 1290 |
| 211 | Ga0209675_1070011 | 3300025291 | Bacteria | 670 |
| 212 | Ga0209676_1000088 | 3300025292 | Bacteria | 263010 |
| 213 | Ga0209676_1001287 | 3300025292 | Bacteria | 25897 |
| 214 | Ga0209676_1001392 | 3300025292 | Bacteria | 23396 |
| 215 | Ga0209676_1001762 | 3300025292 | Bacteria | 18368 |
| 216 | Ga0209676_1043089 | 3300025292 | Bacteria | 1247 |
| 217 | Ga0209025_1000207 | 3300025294 | Bacteria | 140774 |
| 218 | Ga0209025_1000286 | 3300025294 | Bacteria | 114096 |
| 219 | Ga0209025_1000356 | 3300025294 | Bacteria | 98547 |
| 220 | Ga0209025_1007998 | 3300025294 | Bacteria | 7719 |
| 221 | Ga0209025_1023793 | 3300025294 | Bacteria | 3187 |
| 222 | Ga0209564_1000103 | 3300025295 | Bacteria | 221166 |
| 223 | Ga0209564_1000597 | 3300025295 | Bacteria | 56580 |
| 224 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 225 | Ga0209758_1007051 | 3300025297 | Bacteria | 7798 |
| 226 | Ga0209758_1080166 | 3300025297 | Bacteria | 990 |
| 227 | Ga0209758_1126381 | 3300025297 | Bacteria | 683 |
| 228 | Ga0209050_1000511 | 3300025298 | Bacteria | 65746 |
| 229 | Ga0209050_1000758 | 3300025298 | Bacteria | 46473 |
| 230 | Ga0209256_1000065 | 3300025299 | Bacteria | 248104 |
| 231 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 232 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 233 | Ga0207426_1002447 | 3300025302 | Bacteria | 11852 |
| 234 | Ga0209051_1000069 | 3300025303 | Bacteria | 219208 |
| 235 | Ga0209051_1000114 | 3300025303 | Bacteria | 152303 |
| 236 | Ga0209051_1000326 | 3300025303 | Bacteria | 71572 |
| 237 | Ga0209051_1000335 | 3300025303 | Bacteria | 70515 |
| 238 | Ga0209051_1000461 | 3300025303 | Bacteria | 53478 |
| 239 | Ga0209051_1020875 | 3300025303 | Bacteria | 2805 |
| 240 | Ga0209051_1047887 | 3300025303 | Bacteria | 1455 |
| 241 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 242 | Ga0209257_1000093 | 3300025304 | Bacteria | 263088 |
| 243 | Ga0209257_1000249 | 3300025304 | Bacteria | 124522 |
| 244 | Ga0209257_1012145 | 3300025304 | Bacteria | 4028 |
| 245 | Ga0209257_1030923 | 3300025304 | Bacteria | 1720 |
| 246 | Ga0207656_10087925 | 3300025321 | Bacteria | 1406 |
| 247 | Ga0207655_1001919 | 3300025728 | Bacteria | 17800 |
| 248 | Ga0207682_10101735 | 3300025893 | Bacteria | 1257 |
| 249 | Ga0207680_10012314 | 3300025903 | Bacteria | 4353 |
| 250 | Ga0207647_10115716 | 3300025904 | Bacteria | 1583 |
| 251 | Ga0207705_10224044 | 3300025909 | Bacteria | 1429 |
| 252 | Ga0207705_11017116 | 3300025909 | Bacteria | 640 |
| 253 | Ga0207654_10052049 | 3300025911 | Bacteria | 2359 |
| 254 | Ga0207654_10587457 | 3300025911 | Bacteria | 794 |
| 255 | Ga0207695_10027528 | 3300025913 | Bacteria | 6329 |
| 256 | Ga0207671_10003822 | 3300025914 | Bacteria | 14736 |
| 257 | Ga0207657_10010505 | 3300025919 | Bacteria | 9234 |
| 258 | Ga0207652_10105485 | 3300025921 | Bacteria | 2494 |
| 259 | Ga0207652_11198170 | 3300025921 | Bacteria | 661 |
| 260 | Ga0207681_10011609 | 3300025923 | Bacteria | 5414 |
| 261 | Ga0207694_10158528 | 3300025924 | Bacteria | 1827 |
| 262 | Ga0207694_10305715 | 3300025924 | Bacteria | 1310 |
| 263 | Ga0207694_10364074 | 3300025924 | Bacteria | 1198 |
| 264 | Ga0207687_10445974 | 3300025927 | Bacteria | 1072 |
| 265 | Ga0207664_10728066 | 3300025929 | Bacteria | 892 |
| 266 | Ga0207690_10193762 | 3300025932 | Bacteria | 1539 |
| 267 | Ga0207690_10893228 | 3300025932 | Bacteria | 737 |
| 268 | Ga0207706_10047536 | 3300025933 | Bacteria | 3796 |
| 269 | Ga0207709_10000570 | 3300025935 | Bacteria | 31044 |
| 270 | Ga0207709_10000803 | 3300025935 | Bacteria | 24427 |
| 271 | Ga0207709_10138308 | 3300025935 | Bacteria | 1671 |
| 272 | Ga0207669_10133207 | 3300025937 | Bacteria | 1712 |
| 273 | Ga0207691_10148957 | 3300025940 | Bacteria | 2058 |
| 274 | Ga0207691_10756458 | 3300025940 | Bacteria | 818 |
| 275 | Ga0207689_10257160 | 3300025942 | Bacteria | 1444 |
| 276 | Ga0207679_10033624 | 3300025945 | Bacteria | 3610 |
| 277 | Ga0207667_10149979 | 3300025949 | Bacteria | 2400 |
| 278 | Ga0207667_10538172 | 3300025949 | Bacteria | 1182 |
| 279 | Ga0207651_10135350 | 3300025960 | Bacteria | 1894 |
| 280 | Ga0207640_10030195 | 3300025981 | Bacteria | 3336 |
| 281 | Ga0207640_10361490 | 3300025981 | Bacteria | 1170 |
| 282 | Ga0207658_10012974 | 3300025986 | Bacteria | 5691 |
| 283 | Ga0207677_10241376 | 3300026023 | Bacteria | 1462 |
| 284 | Ga0207639_10089989 | 3300026041 | Bacteria | 2454 |
| 285 | Ga0207639_10305972 | 3300026041 | Bacteria | 1407 |
| 286 | Ga0207702_10399838 | 3300026078 | Bacteria | 1325 |
| 287 | Ga0207641_10054358 | 3300026088 | Bacteria | 3397 |
| 288 | Ga0207641_11341825 | 3300026088 | Bacteria | 716 |
| 289 | Ga0207648_11050964 | 3300026089 | Bacteria | 763 |
| 290 | Ga0207676_10795326 | 3300026095 | Bacteria | 922 |
| 291 | Ga0207674_10138811 | 3300026116 | Bacteria | 2391 |
| 292 | Ga0207674_10150887 | 3300026116 | Bacteria | 2281 |
| 293 | Ga0207674_10260297 | 3300026116 | Bacteria | 1682 |
| 294 | Ga0207683_10068577 | 3300026121 | Bacteria | 3131 |
| 295 | Ga0207683_10134132 | 3300026121 | Bacteria | 2228 |
| 296 | Ga0207698_10057775 | 3300026142 | Bacteria | 3003 |
| 297 | Ga0207698_10359117 | 3300026142 | Bacteria | 1379 |
| 298 | Ga0209970_1030891 | 3300027614 | Bacteria | 930 |
| 299 | Ga0209282_1009487 | 3300027666 | Bacteria | 6152 |
| 300 | Ga0209971_1011840 | 3300027682 | Bacteria | 2065 |
| 301 | Ga0209813_10032502 | 3300027866 | Bacteria | 1547 |
| 302 | Ga0209813_10064604 | 3300027866 | Bacteria | 1176 |
| 303 | Ga0209974_10028493 | 3300027876 | Bacteria | 1850 |
| 304 | Ga0268266_10012485 | 3300028379 | Bacteria | 7341 |
| 305 | Ga0268266_10017085 | 3300028379 | Bacteria | 6196 |
| 306 | Ga0268265_10257501 | 3300028380 | Bacteria | 1549 |
| 307 | Ga0307515_10000419 | 3300028794 | Bacteria | 102271 |
| 308 | Ga0307515_10002488 | 3300028794 | Bacteria | 39985 |
| 309 | Ga0307515_10211356 | 3300028794 | Bacteria | 1783 |
| 310 | Ga0307515_10226265 | 3300028794 | Bacteria | 1675 |
| 311 | Ga0307515_10239529 | 3300028794 | Bacteria | 1588 |
| 312 | Ga0307515_10478530 | 3300028794 | Bacteria | 858 |
| 313 | Ga0316177_1110995 | 3300030731 | Bacteria | 3271 |
| 314 | Ga0314311_1041992 | 3300030733 | Bacteria | 18035 |
| 315 | Ga0316179_1055282 | 3300030734 | Bacteria | 3324 |
| 316 | Ga0316180_1036074 | 3300030736 | Bacteria | 671 |
| 317 | Ga0316183_1039276 | 3300030742 | Bacteria | 4389 |
| 318 | Ga0316181_1029714 | 3300030744 | Bacteria | 1767 |
| 319 | Ga0316181_1154876 | 3300030744 | Bacteria | 1076 |
| 320 | Ga0316182_1102772 | 3300030745 | Bacteria | 2615 |
| 321 | Ga0316182_1407517 | 3300030745 | Bacteria | 1579 |
| 322 | Ga0265332_10020780 | 3300031238 | Bacteria | 2900 |
| 323 | Ga0265329_10012226 | 3300031242 | Bacteria | 3092 |
| 324 | Ga0265331_10075180 | 3300031250 | Bacteria | 1575 |
| 325 | Ga0265316_10279367 | 3300031344 | Bacteria | 1220 |
| 326 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 327 | Ga0307513_10044420 | 3300031456 | Bacteria | 4868 |
| 328 | Ga0307513_10250709 | 3300031456 | Bacteria | 1567 |
| 329 | Ga0307408_100100427 | 3300031548 | Bacteria | 2203 |
| 330 | Ga0307408_100117558 | 3300031548 | Bacteria | 2054 |
| 331 | Ga0307408_100673035 | 3300031548 | Bacteria | 927 |
| 332 | Ga0307408_100889256 | 3300031548 | Bacteria | 814 |
| 333 | Ga0307514_10028006 | 3300031649 | Bacteria | 4548 |
| 334 | Ga0307514_10056121 | 3300031649 | Bacteria | 3024 |
| 335 | Ga0265314_10001031 | 3300031711 | Bacteria | 32483 |
| 336 | Ga0265314_10050572 | 3300031711 | Bacteria | 2901 |
| 337 | Ga0307516_10025915 | 3300031730 | Bacteria | 5962 |
| 338 | Ga0307516_10202072 | 3300031730 | Bacteria | 1706 |
| 339 | Ga0307405_10040765 | 3300031731 | Bacteria | 2814 |
| 340 | Ga0307405_10044321 | 3300031731 | Bacteria | 2720 |
| 341 | Ga0307405_10095397 | 3300031731 | Bacteria | 1980 |
| 342 | Ga0307405_10632450 | 3300031731 | Bacteria | 878 |
| 343 | Ga0307413_10494581 | 3300031824 | Bacteria | 981 |
| 344 | Ga0307410_10193073 | 3300031852 | Bacteria | 1550 |
| 345 | Ga0307406_10003068 | 3300031901 | Bacteria | 9086 |
| 346 | Ga0307406_10153607 | 3300031901 | Bacteria | 1645 |
| 347 | Ga0307406_10337936 | 3300031901 | Bacteria | 1172 |
| 348 | Ga0307406_10377146 | 3300031901 | Bacteria | 1117 |
| 349 | Ga0307406_10461136 | 3300031901 | Bacteria | 1022 |
| 350 | Ga0307406_10841538 | 3300031901 | Bacteria | 777 |
| 351 | Ga0307412_10027679 | 3300031911 | Bacteria | 3537 |
| 352 | Ga0307412_10251873 | 3300031911 | Bacteria | 1371 |
| 353 | Ga0307412_10433288 | 3300031911 | Bacteria | 1078 |
| 354 | Ga0307412_10588050 | 3300031911 | Bacteria | 941 |
| 355 | Ga0307412_10664519 | 3300031911 | Bacteria | 890 |
| 356 | Ga0307412_11082029 | 3300031911 | Bacteria | 712 |
| 357 | Ga0307412_11396158 | 3300031911 | Bacteria | 633 |
| 358 | Ga0307409_101546513 | 3300031995 | Bacteria | 691 |
| 359 | Ga0307416_100034322 | 3300032002 | Bacteria | 3859 |
| 360 | Ga0307416_100354569 | 3300032002 | Bacteria | 1486 |
| 361 | Ga0307416_100607535 | 3300032002 | Bacteria | 1174 |
| 362 | Ga0307416_102604010 | 3300032002 | Bacteria | 603 |
| 363 | Ga0307414_10458780 | 3300032004 | Bacteria | 1119 |
| 364 | Ga0307411_10185441 | 3300032005 | Bacteria | 1583 |
| 365 | Ga0307510_10271005 | 3300033180 | Bacteria | 1174 |
| 366 | Ga0373931_0098473 | 3300035691 | Bacteria | 1641 |
| 367 | Ga0373925_0607276 | 3300037068 | Bacteria | 901 |
| 368 | Ga0395899_0004807 | 3300037312 | Bacteria | 10518 |
| 369 | Ga0395899_0021612 | 3300037312 | Bacteria | 4880 |
| 370 | Ga0395899_0181688 | 3300037312 | Bacteria | 1476 |
| 371 | Ga0395900_0038664 | 3300037418 | Bacteria | 4918 |
| 372 | Ga0395900_0078887 | 3300037418 | Bacteria | 3383 |
| 373 | Ga0395900_0161255 | 3300037418 | Bacteria | 2287 |
| 374 | Ga0395900_0588106 | 3300037418 | Bacteria | 1054 |
| 375 | Ga0395900_0701491 | 3300037418 | Bacteria | 945 |
| 376 | Ga0395900_0753521 | 3300037418 | Bacteria | 904 |
| 377 | Ga0395900_0975182 | 3300037418 | Bacteria | 768 |
| 378 | Ga0395898_0004440 | 3300037466 | Bacteria | 15334 |
| 379 | Ga0395898_0007748 | 3300037466 | Bacteria | 11401 |
| 380 | Ga0395898_0038296 | 3300037466 | Bacteria | 4753 |
| 381 | Ga0395898_0258911 | 3300037466 | Bacteria | 1659 |
| 382 | Ga0395898_0897751 | 3300037466 | Bacteria | 824 |
| 383 | Ga0395898_1549064 | 3300037466 | Bacteria | 588 |
| 384 | Ga0395905_0000090 | 3300037471 | Bacteria | 152117 |
| 385 | Ga0395905_0001043 | 3300037471 | Bacteria | 35100 |
| 386 | Ga0395905_0013192 | 3300037471 | Bacteria | 7931 |
| 387 | Ga0395905_0028320 | 3300037471 | Bacteria | 5280 |
| 388 | Ga0395905_0036088 | 3300037471 | Bacteria | 4643 |
| 389 | Ga0395905_0036396 | 3300037471 | Bacteria | 4622 |
| 390 | Ga0395905_0154613 | 3300037471 | Bacteria | 2157 |
| 391 | Ga0395905_0284464 | 3300037471 | Bacteria | 1540 |
| 392 | Ga0395905_0516892 | 3300037471 | Bacteria | 1094 |
| 393 | Ga0395905_0692356 | 3300037471 | Bacteria | 921 |
| 394 | Ga0395905_1203271 | 3300037471 | Bacteria | 661 |
| 395 | Ga0395901_0016203 | 3300038443 | Bacteria | 7593 |
| 396 | Ga0395901_0030389 | 3300038443 | Bacteria | 5565 |
| 397 | Ga0395901_0142052 | 3300038443 | Bacteria | 2523 |
| 398 | Ga0395901_0529574 | 3300038443 | Bacteria | 1196 |
| 399 | Ga0395901_0803293 | 3300038443 | Bacteria | 929 |
| 400 | Ga0395901_1232564 | 3300038443 | Bacteria | 712 |
| 401 | Ga0436365_1498257 | 3300039437 | Bacteria | 1688 |
| 402 | Ga0436361_0324632 | 3300039447 | Bacteria | 36992 |
| 403 | Ga0439436_0000145 | 3300041404 | Bacteria | 16462 |
| 404 | Ga0439436_0001063 | 3300041404 | Bacteria | 7736 |
| 405 | Ga0439436_0055431 | 3300041404 | Bacteria | 1114 |
| 406 | Ga0439439_0064163 | 3300041406 | Bacteria | 978 |
| 407 | Ga0439439_0104976 | 3300041406 | Bacteria | 780 |
| 408 | Ga0439447_025789 | 3300041407 | Bacteria | 1512 |
| 409 | Ga0439453_0053012 | 3300041408 | Bacteria | 824 |
| 410 | Ga0439466_0005347 | 3300041411 | Bacteria | 4909 |
| 411 | Ga0439466_0016359 | 3300041411 | Bacteria | 2681 |
| 412 | Ga0439466_0019274 | 3300041411 | Bacteria | 2442 |
| 413 | Ga0439465_0008576 | 3300041413 | Bacteria | 3225 |
| 414 | Ga0451793_1822058 | 3300041452 | Bacteria | 772 |
| 415 | Ga0451807_0148583 | 3300041486 | Bacteria | 541 |
| 416 | Ga0451833_0202136 | 3300041491 | Bacteria | 687 |
| 417 | Ga0439431_0006720 | 3300041997 | Bacteria | 2552 |
| 418 | Ga0439433_0000215 | 3300041999 | Bacteria | 9440 |
| 419 | Ga0439433_0025676 | 3300041999 | Bacteria | 1331 |
| 420 | Ga0439437_004584 | 3300042000 | Bacteria | 1510 |
| 421 | Ga0439442_010231 | 3300042002 | Bacteria | 1900 |
| 422 | Ga0439442_010282 | 3300042002 | Bacteria | 1896 |
| 423 | Ga0439445_0022552 | 3300042004 | Bacteria | 1588 |
| 424 | Ga0439445_0075303 | 3300042004 | Bacteria | 938 |
| 425 | Ga0439432_000575 | 3300042006 | Bacteria | 13780 |
| 426 | Ga0439432_071431 | 3300042006 | Bacteria | 1058 |
| 427 | Ga0439449_0000484 | 3300042007 | Bacteria | 14910 |
| 428 | Ga0439449_0001297 | 3300042007 | Bacteria | 9779 |
| 429 | Ga0439449_0001545 | 3300042007 | Bacteria | 9009 |
| 430 | Ga0439449_0016242 | 3300042007 | Bacteria | 2798 |
| 431 | Ga0439449_0069419 | 3300042007 | Bacteria | 1299 |
| 432 | Ga0439452_008104 | 3300042010 | Bacteria | 3177 |
| 433 | Ga0439452_029342 | 3300042010 | Bacteria | 1366 |
| 434 | Ga0439455_0069064 | 3300042012 | Bacteria | 947 |
| 435 | Ga0439457_009113 | 3300042014 | Bacteria | 2318 |
| 436 | Ga0439462_0026760 | 3300042015 | Bacteria | 1520 |
| 437 | Ga0439462_0030104 | 3300042015 | Bacteria | 1435 |
| 438 | Ga0439462_0044074 | 3300042015 | Bacteria | 1193 |
| 439 | Ga0439462_0069749 | 3300042015 | Bacteria | 954 |
| 440 | Ga0450920_075715 | 3300042122 | Bacteria | 687 |
| 441 | Ga0450923_020968 | 3300042125 | Bacteria | 1270 |
| 442 | Ga0450894_019197 | 3300042131 | Bacteria | 917 |
| 443 | Ga0450898_002646 | 3300042134 | Bacteria | 2508 |
| 444 | Ga0450898_015673 | 3300042134 | Bacteria | 1286 |
| 445 | Ga0450905_014909 | 3300042142 | Bacteria | 1111 |
| 446 | Ga0450906_028509 | 3300042145 | Bacteria | 989 |
| 447 | Ga0450907_013950 | 3300042146 | Bacteria | 1340 |
| 448 | Ga0450910_001544 | 3300042147 | Bacteria | 2921 |
| 449 | Ga0450910_003817 | 3300042147 | Bacteria | 2014 |
| 450 | Ga0439446_0001157 | 3300042156 | Bacteria | 5858 |
| 451 | Ga0450908_001944 | 3300042184 | Bacteria | 4045 |
| 452 | Ga0450908_007328 | 3300042184 | Bacteria | 2080 |
| 453 | Ga0450909_046920 | 3300042185 | Bacteria | 671 |
| 454 | Ga0439434_0065430 | 3300042435 | Bacteria | 1140 |
| 455 | Ga0439435_0173358 | 3300042436 | Bacteria | 702 |
| 456 | Ga0450918_007108 | 3300042531 | Bacteria | 1988 |
| 457 | Ga0450893_0001490 | 3300042532 | Bacteria | 3600 |
| 458 | Ga0450893_0002953 | 3300042532 | Bacteria | 2677 |
| 459 | Ga0451577_0000453 | 3300042876 | Bacteria | 71384 |
| 460 | Ga0451577_0007854 | 3300042876 | Bacteria | 10436 |
| 461 | Ga0451577_0184803 | 3300042876 | Bacteria | 1880 |
| 462 | Ga0451577_0230034 | 3300042876 | Bacteria | 1677 |
| 463 | Ga0451577_0910306 | 3300042876 | Bacteria | 792 |
| 464 | Ga0451577_0935642 | 3300042876 | Bacteria | 780 |
| 465 | Ga0451577_1155411 | 3300042876 | Bacteria | 691 |
| 466 | Ga0466972_0153662 | 3300044658 | Bacteria | 1081 |
| 467 | Ga0453683_0001384 | 3300044673 | Bacteria | 21064 |
| 468 | Ga0453683_0003629 | 3300044673 | Bacteria | 11314 |
| 469 | Ga0466965_0290391 | 3300044683 | Bacteria | 885 |
| 470 | Ga0466966_0036164 | 3300044684 | Bacteria | 3189 |
| 471 | Ga0466966_0266013 | 3300044684 | Bacteria | 1032 |
| 472 | Ga0453684_0002072 | 3300044712 | Bacteria | 50917 |
| 473 | Ga0453684_0035303 | 3300044712 | Bacteria | 6914 |
| 474 | Ga0453684_0544495 | 3300044712 | Bacteria | 1279 |
| 475 | Ga0466970_0021484 | 3300044765 | Bacteria | 3361 |
| 476 | Ga0466970_0195189 | 3300044765 | Bacteria | 1126 |
| 477 | Ga0466957_0367620 | 3300044842 | Bacteria | 979 |
| 478 | Ga0466959_0061885 | 3300045049 | Bacteria | 2721 |
| 479 | Ga0466959_0380372 | 3300045049 | Bacteria | 961 |
| 480 | Ga0451576_0000950 | 3300045051 | Bacteria | 54404 |
| 481 | Ga0451576_0016302 | 3300045051 | Bacteria | 8204 |
| 482 | Ga0451576_0081288 | 3300045051 | Bacteria | 3370 |
| 483 | Ga0451576_0085491 | 3300045051 | Bacteria | 3281 |
| 484 | Ga0451576_0149889 | 3300045051 | Bacteria | 2432 |
| 485 | Ga0451576_1014632 | 3300045051 | Bacteria | 870 |
| 486 | Ga0466967_0470821 | 3300045976 | Bacteria | 1230 |
| 487 | Ga0495627_071523 | 3300046453 | Bacteria | 1013 |
| 488 | Ga0495590_0122528 | 3300046457 | Bacteria | 932 |
| 489 | Ga0495629_0240844 | 3300046459 | Bacteria | 1246 |
| 490 | Ga0495605_0260505 | 3300046474 | Bacteria | 740 |
| 491 | Ga0495639_0008381 | 3300046475 | Bacteria | 4433 |
| 492 | Ga0495583_0330445 | 3300046506 | Bacteria | 603 |
| 493 | Ga0495610_0030481 | 3300046512 | Bacteria | 2826 |
| 494 | Ga0495616_0001394 | 3300046513 | Bacteria | 16839 |
| 495 | Ga0495620_0028397 | 3300046515 | Bacteria | 2602 |
| 496 | Ga0495631_0001085 | 3300046518 | Bacteria | 16886 |
| 497 | Ga0495632_0018041 | 3300046519 | Bacteria | 3880 |
| 498 | Ga0495637_0022112 | 3300046520 | Bacteria | 2905 |
| 499 | Ga0495637_0113806 | 3300046520 | Bacteria | 1046 |
| 500 | Ga0495643_0086670 | 3300046522 | Bacteria | 1622 |
| 501 | Ga0495663_0018417 | 3300046525 | Bacteria | 1989 |
| 502 | Ga0495654_0021838 | 3300046530 | Bacteria | 3328 |
| 503 | Ga0495654_0107004 | 3300046530 | Bacteria | 1280 |
| 504 | Ga0495654_0137807 | 3300046530 | Bacteria | 1090 |
| 505 | Ga0495609_0082169 | 3300046538 | Bacteria | 1408 |
| 506 | Ga0495621_0015001 | 3300046539 | Bacteria | 2463 |
| 507 | Ga0495621_0064455 | 3300046539 | Bacteria | 1337 |
| 508 | Ga0495656_0000055 | 3300046615 | Bacteria | 53908 |
| 509 | Ga0495656_0034717 | 3300046615 | Bacteria | 2067 |
| 510 | Ga0495656_0038384 | 3300046615 | Bacteria | 1983 |
| 511 | Ga0495668_0059881 | 3300046616 | Bacteria | 2101 |
| 512 | Ga0495625_0002019 | 3300046660 | Bacteria | 22847 |
| 513 | Ga0495625_0029006 | 3300046660 | Bacteria | 4142 |
| 514 | Ga0495635_0063641 | 3300046663 | Bacteria | 2533 |
| 515 | Ga0495661_0382408 | 3300046665 | Bacteria | 687 |
| 516 | Ga0495588_0264290 | 3300046674 | Bacteria | 907 |
| 517 | Ga0495588_0470056 | 3300046674 | Bacteria | 659 |
| 518 | Ga0495624_0451607 | 3300046690 | Bacteria | 770 |
| 519 | Ga0495670_0019185 | 3300046691 | Bacteria | 3369 |
| 520 | Ga0495670_0294458 | 3300046691 | Bacteria | 869 |
| 521 | Ga0495671_0019757 | 3300046692 | Bacteria | 3557 |
| 522 | Ga0495649_0006369 | 3300046694 | Bacteria | 7346 |
| 523 | Ga0495660_0069608 | 3300046810 | Bacteria | 1870 |
| 524 | Ga0495636_0045890 | 3300047318 | Bacteria | 1822 |
| 525 | Ga0495676_0003857 | 3300047321 | Bacteria | 13638 |
| 526 | Ga0495687_013291 | 3300047443 | Bacteria | 4308 |
| 527 | Ga0495677_0055771 | 3300047445 | Bacteria | 1459 |
| 528 | Ga0495681_0140489 | 3300047470 | Bacteria | 1021 |
| 529 | Ga0495593_0065889 | 3300047673 | Bacteria | 1888 |
| 530 | Ga0495626_0079830 | 3300048091 | Bacteria | 1455 |
| 531 | Ga0496100_0001576 | 3300048903 | Bacteria | 11234 |
| 532 | Ga0496102_0102436 | 3300048905 | Bacteria | 2661 |
| 533 | Ga0496103_0194490 | 3300048906 | Bacteria | 1304 |
| 534 | Ga0496105_0006863 | 3300048908 | Bacteria | 8761 |
| 535 | Ga0496107_0054621 | 3300048910 | Bacteria | 2883 |
| 536 | Ga0496109_0082373 | 3300048912 | Bacteria | 2965 |
| 537 | Ga0496110_0364537 | 3300048913 | Bacteria | 1316 |
| 538 | Ga0496110_0629444 | 3300048913 | Bacteria | 972 |
| 539 | Ga0496110_1002642 | 3300048913 | Bacteria | 742 |
| 540 | Ga0496111_0204021 | 3300048914 | Bacteria | 1469 |
| 541 | Ga0496113_0393002 | 3300048916 | Bacteria | 1113 |
| 542 | Ga0496114_0281861 | 3300048917 | Bacteria | 1465 |
| 543 | Ga0496116_0107094 | 3300048919 | Bacteria | 1653 |
| 544 | Ga0496117_0082571 | 3300048920 | Bacteria | 2104 |
| 545 | Ga0496117_0086486 | 3300048920 | Bacteria | 2036 |
| 546 | Ga0496117_0251954 | 3300048920 | Bacteria | 962 |
| 547 | Ga0496118_0097166 | 3300048921 | Bacteria | 2005 |
| 548 | Ga0496118_0106508 | 3300048921 | Bacteria | 1875 |
| 549 | Ga0496121_0012482 | 3300048924 | Bacteria | 9253 |
| 550 | Ga0496121_0069958 | 3300048924 | Bacteria | 2829 |
| 551 | Ga0496122_0000324 | 3300048925 | Bacteria | 104220 |
| 552 | Ga0496122_0051838 | 3300048925 | Bacteria | 3113 |
| 553 | Ga0496122_0058925 | 3300048925 | Bacteria | 2838 |
| 554 | Ga0496122_0146934 | 3300048925 | Bacteria | 1463 |
| 555 | Ga0496122_0185253 | 3300048925 | Bacteria | 1236 |
| 556 | Ga0496123_0000160 | 3300048926 | Bacteria | 135310 |
| 557 | Ga0496123_0067679 | 3300048926 | Bacteria | 2254 |
| 558 | Ga0496123_0121821 | 3300048926 | Bacteria | 1465 |
| 559 | Ga0496123_0193176 | 3300048926 | Bacteria | 1051 |
| 560 | Ga0496123_0236002 | 3300048926 | Bacteria | 911 |
| 561 | Ga0496124_0013362 | 3300048927 | Bacteria | 8021 |
| 562 | Ga0496124_0158716 | 3300048927 | Bacteria | 1765 |
| 563 | Ga0496124_0177864 | 3300048927 | Bacteria | 1640 |
| 564 | Ga0496124_0216047 | 3300048927 | Bacteria | 1446 |
| 565 | Ga0496125_0001477 | 3300048928 | Bacteria | 33958 |
| 566 | Ga0496125_0036017 | 3300048928 | Bacteria | 4328 |
| 567 | Ga0496125_0193321 | 3300048928 | Bacteria | 1341 |
| 568 | Ga0496126_0284309 | 3300048929 | Bacteria | 1369 |
| 569 | Ga0496126_0410964 | 3300048929 | Bacteria | 1096 |
| 570 | Ga0496126_0638770 | 3300048929 | Bacteria | 834 |
| 571 | Ga0501034_0040051 | 3300049571 | Bacteria | 4745 |
| 572 | Ga0501034_0108341 | 3300049571 | Bacteria | 2769 |
| 573 | Ga0501034_0668237 | 3300049571 | Bacteria | 939 |
| 574 | Ga0501043_0062653 | 3300049579 | Bacteria | 2920 |
| 575 | Ga0501043_0371687 | 3300049579 | Bacteria | 1084 |
| 576 | Ga0501046_0055208 | 3300049580 | Bacteria | 3123 |
| 577 | Ga0501047_0162671 | 3300049581 | Bacteria | 2103 |
| 578 | Ga0501073_0294626 | 3300049589 | Bacteria | 1119 |
| 579 | Ga0501243_060169 | 3300049675 | Bacteria | 703 |
| 580 | Ga0501249_002237 | 3300049679 | Bacteria | 3928 |
| 581 | Ga0501257_253990 | 3300049686 | Bacteria | 522 |
| 582 | Ga0501225_0098687 | 3300049705 | Bacteria | 852 |
| 583 | Ga0501234_028828 | 3300049707 | Bacteria | 894 |
| 584 | Ga0501080_0333898 | 3300049742 | Bacteria | 1370 |
| 585 | Ga0501262_000323 | 3300049759 | Bacteria | 5797 |
| 586 | Ga0501273_020091 | 3300049770 | Bacteria | 899 |
| 587 | Ga0501035_0200442 | 3300049822 | Bacteria | 1712 |
| 588 | Ga0501044_0262952 | 3300049823 | Bacteria | 1663 |
| 589 | nmdc:mga03683_11355_c1 | 3300050489 | Bacteria | 3223 |
| 590 | nmdc:mga03683_115246_c1 | 3300050489 | Bacteria | 1191 |
| 591 | nmdc:mga03683_132996_c1 | 3300050489 | Bacteria | 1114 |
| 592 | nmdc:mga03683_25447_c1 | 3300050489 | Bacteria | 2325 |
| 593 | nmdc:mga03683_274438_c1 | 3300050489 | Bacteria | 787 |
| 594 | nmdc:mga03683_38524_c1 | 3300050489 | Bacteria | 1953 |
| 595 | nmdc:mga03683_44131_c1 | 3300050489 | Bacteria | 1842 |
| 596 | nmdc:mga03683_602486_c1 | 3300050489 | Bacteria | 538 |
| 597 | nmdc:mga03n38_14679_c1 | 3300050490 | Bacteria | 3009 |
| 598 | nmdc:mga03n38_23656_c1 | 3300050490 | Bacteria | 2503 |
| 599 | nmdc:mga03n38_254798_c1 | 3300050490 | Bacteria | 928 |
| 600 | nmdc:mga03n38_296622_c1 | 3300050490 | Bacteria | 867 |
| 601 | nmdc:mga03n38_440274_c1 | 3300050490 | Bacteria | 723 |
| 602 | nmdc:mga03n38_460468_c1 | 3300050490 | Bacteria | 709 |
| 603 | nmdc:mga00v17_13376_c1 | 3300050491 | Bacteria | 4555 |
| 604 | nmdc:mga0yw44_11511_c1 | 3300050492 | Bacteria | 4572 |
| 605 | nmdc:mga0yw44_120011_c1 | 3300050492 | Bacteria | 1693 |
| 606 | nmdc:mga0yw44_288067_c1 | 3300050492 | Bacteria | 1099 |
| 607 | nmdc:mga0yw44_573332_c1 | 3300050492 | Bacteria | 766 |
| 608 | nmdc:mga0yw44_757798_c1 | 3300050492 | Bacteria | 659 |
| 609 | nmdc:mga0k408_18277_c1 | 3300050493 | Bacteria | 3912 |
| 610 | nmdc:mga0k408_206388_c1 | 3300050493 | Bacteria | 1173 |
| 611 | nmdc:mga0k408_209841_c1 | 3300050493 | Bacteria | 1163 |
| 612 | nmdc:mga0k408_265481_c1 | 3300050493 | Bacteria | 664 |
| 613 | nmdc:mga0k408_493135_c1 | 3300050493 | Bacteria | 726 |
| 614 | nmdc:mga0k408_6404_c1 | 3300050493 | Bacteria | 6280 |
| 615 | nmdc:mga06z11_1192_c1 | 3300050494 | Bacteria | 9568 |
| 616 | nmdc:mga06z11_383328_c1 | 3300050494 | Bacteria | 845 |
| 617 | nmdc:mga04h51_2632_c1 | 3300050495 | Bacteria | 4275 |
| 618 | nmdc:mga04h51_34726_c1 | 3300050495 | Bacteria | 1612 |
| 619 | nmdc:mga07m45_17784_c1 | 3300050496 | Bacteria | 3825 |
| 620 | nmdc:mga07m45_3563_c1 | 3300050496 | Bacteria | 7521 |
| 621 | nmdc:mga07m45_3602_c1 | 3300050496 | Bacteria | 7479 |
| 622 | nmdc:mga07m45_3690_c1 | 3300050496 | Bacteria | 7407 |
| 623 | nmdc:mga07m45_645240_c1 | 3300050496 | Bacteria | 610 |
| 624 | nmdc:mga07m45_803_c1 | 3300050496 | Bacteria | 13535 |
| 625 | nmdc:mga07m45_814_c1 | 3300050496 | Bacteria | 13468 |
| 626 | nmdc:mga0sz30_15926_c1 | 3300050516 | Bacteria | 2977 |
| 627 | nmdc:mga0sz30_50071_c1 | 3300050516 | Bacteria | 697 |
| 628 | Ga0500610_0000194 | 3300053079 | Bacteria | 18457 |
| 629 | Ga0500610_0090294 | 3300053079 | Bacteria | 1591 |
| 630 | Ga0500643_019165 | 3300053087 | Bacteria | 2258 |
| 631 | Ga0500651_0000082 | 3300053093 | Bacteria | 60329 |
| 632 | Ga0500651_0076169 | 3300053093 | Bacteria | 2083 |
| 633 | Ga0500562_019009 | 3300053108 | Bacteria | 1775 |
| 634 | Ga0500571_000162 | 3300053110 | Bacteria | 23449 |
| 635 | Ga0500593_013811 | 3300053117 | Bacteria | 3455 |
| 636 | Ga0500607_016835 | 3300053121 | Bacteria | 4182 |
| 637 | Ga0500608_010513 | 3300053122 | Bacteria | 3976 |
| 638 | Ga0500608_186786 | 3300053122 | Bacteria | 871 |
| 639 | Ga0500618_063913 | 3300053125 | Bacteria | 827 |
| 640 | Ga0500618_090293 | 3300053125 | Bacteria | 688 |
| 641 | Ga0500628_054417 | 3300053129 | Bacteria | 960 |
| 642 | Ga0500658_0000170 | 3300053134 | Bacteria | 30951 |
| 643 | Ga0500658_0001413 | 3300053134 | Bacteria | 9671 |
| 644 | Ga0500559_0004515 | 3300053136 | Bacteria | 6582 |
| 645 | Ga0500559_0025081 | 3300053136 | Bacteria | 2537 |
| 646 | Ga0500559_0144581 | 3300053136 | Bacteria | 1114 |
| 647 | Ga0500561_0124276 | 3300053137 | Bacteria | 790 |
| 648 | Ga0500564_012901 | 3300053138 | Bacteria | 3727 |
| 649 | Ga0500568_0003074 | 3300053139 | Bacteria | 9530 |
| 650 | Ga0500574_050480 | 3300053141 | Bacteria | 1187 |
| 651 | Ga0500577_0057279 | 3300053142 | Bacteria | 1487 |
| 652 | Ga0500586_088687 | 3300053145 | Bacteria | 1087 |
| 653 | Ga0500616_0074869 | 3300053153 | Bacteria | 1715 |
| 654 | Ga0500634_0013938 | 3300053161 | Bacteria | 4230 |
| 655 | Ga0500634_0030574 | 3300053161 | Bacteria | 2935 |
| 656 | Ga0500638_044950 | 3300053162 | Bacteria | 2143 |
| 657 | Ga0500636_0038384 | 3300053177 | Bacteria | 2833 |
| 658 | Ga0500625_072935 | 3300053729 | Bacteria | 1522 |
| 659 | Ga0590075_095149 | 3300059424 | Bacteria | 774 |
| 660 | Ga0466962_0144833 | 3300061719 | Bacteria | 1152 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041408 | Ga0439453_0053012 | Ga0439453_0053012_390_806 | 138 |
| 2 | 3300049686 | Ga0501257_253990 | Ga0501257_253990_39_485 | 147 |
| 3 | 3300025303 | Ga0209051_1020875 | Ga0209051_10208753 | 155 |
| 4 | 3300013102 | Ga0157371_10026087 | Ga0157371_100260875 | 156 |
| 5 | 3300050492 | nmdc:mga0yw44_573332_c1 | nmdc:mga0yw44_573332_c1_11_481 | 156 |
| 6 | 3300050496 | nmdc:mga07m45_17784_c1 | nmdc:mga07m45_17784_c1_116_586 | 156 |
| 7 | 3300006038 | Ga0075365_10026066 | Ga0075365_100260663 | 159 |
| 8 | 3300006048 | Ga0075363_100155634 | Ga0075363_1001556342 | 159 |
| 9 | 3300006048 | Ga0075363_100658257 | Ga0075363_1006582571 | 159 |
| 10 | 3300006195 | Ga0075366_10071595 | Ga0075366_100715954 | 159 |
| 11 | 3300006195 | Ga0075366_10736434 | Ga0075366_107364342 | 159 |
| 12 | 3300006353 | Ga0075370_10041778 | Ga0075370_100417784 | 159 |
| 13 | 3300031548 | Ga0307408_100117558 | Ga0307408_1001175582 | 159 |
| 14 | 3300031901 | Ga0307406_10377146 | Ga0307406_103771462 | 159 |
| 15 | 3300031911 | Ga0307412_10251873 | Ga0307412_102518733 | 159 |
| 16 | 3300031911 | Ga0307412_10664519 | Ga0307412_106645192 | 159 |
| 17 | 3300037418 | Ga0395900_0753521 | Ga0395900_0753521_34_522 | 159 |
| 18 | 3300037471 | Ga0395905_0692356 | Ga0395905_0692356_372_863 | 159 |
| 19 | 3300038443 | Ga0395901_0142052 | Ga0395901_0142052_982_1470 | 159 |
| 20 | 3300041404 | Ga0439436_0001063 | Ga0439436_0001063_2551_3051 | 159 |
| 21 | 3300041411 | Ga0439466_0005347 | Ga0439466_0005347_2470_2970 | 159 |
| 22 | 3300041999 | Ga0439433_0025676 | Ga0439433_0025676_355_855 | 159 |
| 23 | 3300042007 | Ga0439449_0000484 | Ga0439449_0000484_7222_7722 | 159 |
| 24 | 3300042010 | Ga0439452_008104 | Ga0439452_008104_2078_2578 | 159 |
| 25 | 3300042015 | Ga0439462_0026760 | Ga0439462_0026760_95_595 | 159 |
| 26 | 3300042125 | Ga0450923_020968 | Ga0450923_020968_345_845 | 159 |
| 27 | 3300042134 | Ga0450898_002646 | Ga0450898_002646_246_746 | 159 |
| 28 | 3300042147 | Ga0450910_001544 | Ga0450910_001544_2345_2845 | 159 |
| 29 | 3300042184 | Ga0450908_007328 | Ga0450908_007328_948_1448 | 159 |
| 30 | 3300042876 | Ga0451577_0230034 | Ga0451577_0230034_279_779 | 159 |
| 31 | 3300045051 | Ga0451576_0081288 | Ga0451576_0081288_1284_1781 | 159 |
| 32 | 3300046525 | Ga0495663_0018417 | Ga0495663_0018417_797_1288 | 159 |
| 33 | 3300046615 | Ga0495656_0038384 | Ga0495656_0038384_254_745 | 159 |
| 34 | 3300047318 | Ga0495636_0045890 | Ga0495636_0045890_718_1209 | 159 |
| 35 | 3300047470 | Ga0495681_0140489 | Ga0495681_0140489_295_786 | 159 |
| 36 | 3300049770 | Ga0501273_020091 | Ga0501273_020091_158_643 | 159 |
| 37 | 3300050489 | nmdc:mga03683_115246_c1 | nmdc:mga03683_115246_c1_316_813 | 159 |
| 38 | 3300050489 | nmdc:mga03683_274438_c1 | nmdc:mga03683_274438_c1_83_580 | 159 |
| 39 | 3300050490 | nmdc:mga03n38_440274_c1 | nmdc:mga03n38_440274_c1_188_682 | 159 |
| 40 | 3300050490 | nmdc:mga03n38_460468_c1 | nmdc:mga03n38_460468_c1_154_651 | 159 |
| 41 | 3300050492 | nmdc:mga0yw44_288067_c1 | nmdc:mga0yw44_288067_c1_91_579 | 159 |
| 42 | 3300050492 | nmdc:mga0yw44_757798_c1 | nmdc:mga0yw44_757798_c1_61_555 | 159 |
| 43 | 3300050493 | nmdc:mga0k408_493135_c1 | nmdc:mga0k408_493135_c1_132_626 | 159 |
| 44 | 3300050494 | nmdc:mga06z11_383328_c1 | nmdc:mga06z11_383328_c1_195_692 | 159 |
| 45 | 3300050496 | nmdc:mga07m45_803_c1 | nmdc:mga07m45_803_c1_6006_6488 | 159 |
| 46 | 3300059424 | Ga0590075_095149 | Ga0590075_095149_197_694 | 159 |
| 47 | iso_pu_bacteria | 2881101125 | 2881102575 | 159 |
| 48 | 3300005339 | Ga0070660_100049803 | Ga0070660_1000498034 | 160 |
| 49 | 3300005435 | Ga0070714_100389048 | Ga0070714_1003890482 | 160 |
| 50 | 3300005458 | Ga0070681_10183730 | Ga0070681_101837303 | 160 |
| 51 | 3300005530 | Ga0070679_100003351 | Ga0070679_1000033515 | 160 |
| 52 | 3300005563 | Ga0068855_100005901 | Ga0068855_1000059014 | 160 |
| 53 | 3300006048 | Ga0075363_100133765 | Ga0075363_1001337652 | 160 |
| 54 | 3300006177 | Ga0075362_10044230 | Ga0075362_100442302 | 160 |
| 55 | 3300006195 | Ga0075366_10242191 | Ga0075366_102421912 | 160 |
| 56 | 3300009093 | Ga0105240_10003014 | Ga0105240_1000301415 | 160 |
| 57 | 3300009551 | Ga0105238_10048663 | Ga0105238_100486633 | 160 |
| 58 | 3300025913 | Ga0207695_10027528 | Ga0207695_100275285 | 160 |
| 59 | 3300025919 | Ga0207657_10010505 | Ga0207657_100105053 | 160 |
| 60 | 3300025921 | Ga0207652_11198170 | Ga0207652_111981702 | 160 |
| 61 | 3300025924 | Ga0207694_10305715 | Ga0207694_103057152 | 160 |
| 62 | 3300025929 | Ga0207664_10728066 | Ga0207664_107280662 | 160 |
| 63 | 3300025949 | Ga0207667_10538172 | Ga0207667_105381721 | 160 |
| 64 | 3300027866 | Ga0209813_10064604 | Ga0209813_100646042 | 160 |
| 65 | 3300031711 | Ga0265314_10050572 | Ga0265314_100505723 | 160 |
| 66 | 3300031852 | Ga0307410_10193073 | Ga0307410_101930732 | 160 |
| 67 | 3300031901 | Ga0307406_10841538 | Ga0307406_108415382 | 160 |
| 68 | 3300032002 | Ga0307416_100607535 | Ga0307416_1006075352 | 160 |
| 69 | 3300037418 | Ga0395900_0161255 | Ga0395900_0161255_716_1210 | 160 |
| 70 | 3300037466 | Ga0395898_0897751 | Ga0395898_0897751_232_726 | 160 |
| 71 | 3300037471 | Ga0395905_0154613 | Ga0395905_0154613_722_1216 | 160 |
| 72 | 3300038443 | Ga0395901_0529574 | Ga0395901_0529574_95_589 | 160 |
| 73 | 3300039447 | Ga0436361_0324632 | Ga0436361_0324632_34960_35448 | 160 |
| 74 | 3300041406 | Ga0439439_0104976 | Ga0439439_0104976_250_750 | 160 |
| 75 | 3300042000 | Ga0439437_004584 | Ga0439437_004584_113_613 | 160 |
| 76 | 3300042007 | Ga0439449_0069419 | Ga0439449_0069419_788_1288 | 160 |
| 77 | 3300042142 | Ga0450905_014909 | Ga0450905_014909_259_756 | 160 |
| 78 | 3300042876 | Ga0451577_0007854 | Ga0451577_0007854_8365_8856 | 160 |
| 79 | 3300044673 | Ga0453683_0003629 | Ga0453683_0003629_9288_9779 | 160 |
| 80 | 3300044712 | Ga0453684_0035303 | Ga0453684_0035303_123_614 | 160 |
| 81 | 3300045051 | Ga0451576_0016302 | Ga0451576_0016302_1411_1902 | 160 |
| 82 | 3300046615 | Ga0495656_0034717 | Ga0495656_0034717_17_511 | 160 |
| 83 | 3300048924 | Ga0496121_0012482 | Ga0496121_0012482_249_746 | 160 |
| 84 | 3300048927 | Ga0496124_0216047 | Ga0496124_0216047_768_1265 | 160 |
| 85 | 3300048929 | Ga0496126_0638770 | Ga0496126_0638770_39_536 | 160 |
| 86 | 3300049675 | Ga0501243_060169 | Ga0501243_060169_24_524 | 160 |
| 87 | 3300050493 | nmdc:mga0k408_209841_c1 | nmdc:mga0k408_209841_c1_445_945 | 160 |
| 88 | 3300050495 | nmdc:mga04h51_34726_c1 | nmdc:mga04h51_34726_c1_539_1039 | 160 |
| 89 | iso_pu_bacteria | 2842733646 | 2842733947 | 160 |
| 90 | iso_pu_bacteria | 2842747753 | 2842752660 | 160 |
| 91 | 3300005327 | Ga0070658_10528064 | Ga0070658_105280642 | 161 |
| 92 | 3300005327 | Ga0070658_11281683 | Ga0070658_112816831 | 161 |
| 93 | 3300005334 | Ga0068869_100084256 | Ga0068869_1000842562 | 161 |
| 94 | 3300005338 | Ga0068868_101337172 | Ga0068868_1013371721 | 161 |
| 95 | 3300005456 | Ga0070678_100146237 | Ga0070678_1001462373 | 161 |
| 96 | 3300005563 | Ga0068855_100088468 | Ga0068855_1000884684 | 161 |
| 97 | 3300005577 | Ga0068857_100552560 | Ga0068857_1005525602 | 161 |
| 98 | 3300005614 | Ga0068856_100276443 | Ga0068856_1002764432 | 161 |
| 99 | 3300009093 | Ga0105240_11156642 | Ga0105240_111566422 | 161 |
| 100 | 3300009098 | Ga0105245_11068095 | Ga0105245_110680952 | 161 |
| 101 | 3300009174 | Ga0105241_10117544 | Ga0105241_101175441 | 161 |
| 102 | 3300010375 | Ga0105239_10113368 | Ga0105239_101133682 | 161 |
| 103 | 3300013297 | Ga0157378_10114643 | Ga0157378_101146433 | 161 |
| 104 | 3300025909 | Ga0207705_10224044 | Ga0207705_102240443 | 161 |
| 105 | 3300025909 | Ga0207705_11017116 | Ga0207705_110171161 | 161 |
| 106 | 3300025911 | Ga0207654_10052049 | Ga0207654_100520494 | 161 |
| 107 | 3300025932 | Ga0207690_10893228 | Ga0207690_108932282 | 161 |
| 108 | 3300025949 | Ga0207667_10149979 | Ga0207667_101499792 | 161 |
| 109 | 3300026078 | Ga0207702_10399838 | Ga0207702_103998382 | 161 |
| 110 | 3300026116 | Ga0207674_10150887 | Ga0207674_101508872 | 161 |
| 111 | 3300026121 | Ga0207683_10134132 | Ga0207683_101341323 | 161 |
| 112 | 3300027876 | Ga0209974_10028493 | Ga0209974_100284934 | 161 |
| 113 | 3300031238 | Ga0265332_10020780 | Ga0265332_100207803 | 161 |
| 114 | 3300031242 | Ga0265329_10012226 | Ga0265329_100122264 | 161 |
| 115 | 3300031250 | Ga0265331_10075180 | Ga0265331_100751802 | 161 |
| 116 | 3300031344 | Ga0265316_10279367 | Ga0265316_102793672 | 161 |
| 117 | 3300031711 | Ga0265314_10001031 | Ga0265314_100010315 | 161 |
| 118 | 3300031911 | Ga0307412_10588050 | Ga0307412_105880502 | 161 |
| 119 | 3300035691 | Ga0373931_0098473 | Ga0373931_0098473_174_689 | 161 |
| 120 | 3300037312 | Ga0395899_0021612 | Ga0395899_0021612_2246_2743 | 161 |
| 121 | 3300037312 | Ga0395899_0181688 | Ga0395899_0181688_96_593 | 161 |
| 122 | 3300037418 | Ga0395900_0038664 | Ga0395900_0038664_309_806 | 161 |
| 123 | 3300037418 | Ga0395900_0975182 | Ga0395900_0975182_155_652 | 161 |
| 124 | 3300037466 | Ga0395898_0004440 | Ga0395898_0004440_4103_4600 | 161 |
| 125 | 3300037466 | Ga0395898_0038296 | Ga0395898_0038296_1674_2171 | 161 |
| 126 | 3300037466 | Ga0395898_1549064 | Ga0395898_1549064_23_520 | 161 |
| 127 | 3300037471 | Ga0395905_0000090 | Ga0395905_0000090_23301_23798 | 161 |
| 128 | 3300037471 | Ga0395905_0001043 | Ga0395905_0001043_22713_23210 | 161 |
| 129 | 3300037471 | Ga0395905_0028320 | Ga0395905_0028320_4078_4575 | 161 |
| 130 | 3300037471 | Ga0395905_0036088 | Ga0395905_0036088_1518_2015 | 161 |
| 131 | 3300037471 | Ga0395905_0284464 | Ga0395905_0284464_922_1419 | 161 |
| 132 | 3300037471 | Ga0395905_0516892 | Ga0395905_0516892_583_1080 | 161 |
| 133 | 3300037471 | Ga0395905_1203271 | Ga0395905_1203271_25_522 | 161 |
| 134 | 3300038443 | Ga0395901_0016203 | Ga0395901_0016203_1894_2391 | 161 |
| 135 | 3300038443 | Ga0395901_0030389 | Ga0395901_0030389_3303_3800 | 161 |
| 136 | 3300042532 | Ga0450893_0002953 | Ga0450893_0002953_592_1095 | 161 |
| 137 | 3300045051 | Ga0451576_1014632 | Ga0451576_1014632_171_671 | 161 |
| 138 | iso_pu_bacteria | 2513020051 | 2513228054 | 161 |
| 139 | iso_pu_bacteria | 2599185214 | 2599626266 | 161 |
| 140 | iso_pu_bacteria | 2599185226 | 2599675905 | 161 |
| 141 | iso_pu_bacteria | 2599185227 | 2599682212 | 161 |
| 142 | iso_pu_bacteria | 2599185229 | 2599695863 | 161 |
| 143 | iso_pu_bacteria | 2643221628 | 2644164078 | 161 |
| 144 | iso_pu_bacteria | 2643221683 | 2644466790 | 161 |
| 145 | iso_pu_bacteria | 2842677519 | 2842678696 | 161 |
| 146 | iso_pu_bacteria | 2885192300 | 2885193161 | 161 |
| 147 | iso_pu_bacteria | 2885198086 | 2885202901 | 161 |
| 148 | iso_pu_bacteria | 2885211737 | 2885216702 | 161 |
| 149 | iso_pu_bacteria | 2904449895 | 2904452706 | 161 |
| 150 | iso_pu_bacteria | 2904456579 | 2904460266 | 161 |
| 151 | iso_pu_bacteria | 2919462493 | 2919463672 | 161 |
| 152 | iso_pu_bacteria | 2928070936 | 2928075483 | 161 |
| 153 | iso_pu_bacteria | 2928084124 | 2928089412 | 161 |
| 154 | iso_pu_bacteria | 2928115317 | 2928115771 | 161 |
| 155 | iso_pu_bacteria | 2929520902 | 2929525667 | 161 |
| 156 | iso_pu_bacteria | 2945945610 | 2945945762 | 161 |
| 157 | iso_pu_bacteria | 2945972063 | 2945975421 | 161 |
| 158 | 3300005338 | Ga0068868_100276740 | Ga0068868_1002767402 | 162 |
| 159 | 3300009101 | Ga0105247_10426243 | Ga0105247_104262432 | 162 |
| 160 | 3300009174 | Ga0105241_10410532 | Ga0105241_104105322 | 162 |
| 161 | 3300009545 | Ga0105237_10001471 | Ga0105237_1000147133 | 162 |
| 162 | 3300009551 | Ga0105238_10026974 | Ga0105238_100269744 | 162 |
| 163 | 3300009553 | Ga0105249_11071879 | Ga0105249_110718792 | 162 |
| 164 | 3300010375 | Ga0105239_10002779 | Ga0105239_100027794 | 162 |
| 165 | 3300015262 | Ga0182007_10106535 | Ga0182007_101065352 | 162 |
| 166 | 3300025914 | Ga0207671_10003822 | Ga0207671_100038227 | 162 |
| 167 | 3300028794 | Ga0307515_10211356 | Ga0307515_102113561 | 162 |
| 168 | 3300028794 | Ga0307515_10239529 | Ga0307515_102395292 | 162 |
| 169 | 3300031730 | Ga0307516_10025915 | Ga0307516_100259155 | 162 |
| 170 | 3300037471 | Ga0395905_0013192 | Ga0395905_0013192_6863_7366 | 162 |
| 171 | 3300042007 | Ga0439449_0016242 | Ga0439449_0016242_336_833 | 162 |
| 172 | 3300042015 | Ga0439462_0069749 | Ga0439462_0069749_52_549 | 162 |
| 173 | 3300042436 | Ga0439435_0173358 | Ga0439435_0173358_122_619 | 162 |
| 174 | 3300042876 | Ga0451577_0184803 | Ga0451577_0184803_62_559 | 162 |
| 175 | 3300042876 | Ga0451577_0910306 | Ga0451577_0910306_230_733 | 162 |
| 176 | 3300042876 | Ga0451577_0935642 | Ga0451577_0935642_154_651 | 162 |
| 177 | 3300044658 | Ga0466972_0153662 | Ga0466972_0153662_370_873 | 162 |
| 178 | 3300044684 | Ga0466966_0036164 | Ga0466966_0036164_1086_1589 | 162 |
| 179 | 3300044684 | Ga0466966_0266013 | Ga0466966_0266013_240_743 | 162 |
| 180 | 3300044765 | Ga0466970_0021484 | Ga0466970_0021484_323_826 | 162 |
| 181 | 3300045049 | Ga0466959_0061885 | Ga0466959_0061885_2071_2574 | 162 |
| 182 | 3300045049 | Ga0466959_0380372 | Ga0466959_0380372_131_634 | 162 |
| 183 | 3300045976 | Ga0466967_0470821 | Ga0466967_0470821_277_777 | 162 |
| 184 | 3300048913 | Ga0496110_0629444 | Ga0496110_0629444_125_613 | 162 |
| 185 | 3300049571 | Ga0501034_0108341 | Ga0501034_0108341_1080_1583 | 162 |
| 186 | 3300049579 | Ga0501043_0062653 | Ga0501043_0062653_491_994 | 162 |
| 187 | 3300049580 | Ga0501046_0055208 | Ga0501046_0055208_1141_1644 | 162 |
| 188 | 3300049581 | Ga0501047_0162671 | Ga0501047_0162671_836_1339 | 162 |
| 189 | 3300049589 | Ga0501073_0294626 | Ga0501073_0294626_105_608 | 162 |
| 190 | 3300049742 | Ga0501080_0333898 | Ga0501080_0333898_109_612 | 162 |
| 191 | 3300049822 | Ga0501035_0200442 | Ga0501035_0200442_88_591 | 162 |
| 192 | 3300053108 | Ga0500562_019009 | Ga0500562_019009_898_1401 | 162 |
| 193 | 3300053142 | Ga0500577_0057279 | Ga0500577_0057279_105_608 | 162 |
| 194 | 3300053145 | Ga0500586_088687 | Ga0500586_088687_400_903 | 162 |
| 195 | 3300053153 | Ga0500616_0074869 | Ga0500616_0074869_848_1351 | 162 |
| 196 | iso_pu_bacteria | 2643221658 | 2644326861 | 162 |
| 197 | iso_pu_bacteria | 2643221672 | 2644399879 | 162 |
| 198 | iso_pu_bacteria | 2738543013 | 2739249650 | 162 |
| 199 | iso_pu_bacteria | 2818991446 | 2819601538 | 162 |
| 200 | iso_pu_bacteria | 2831265667 | 2831272196 | 162 |
| 201 | iso_pu_bacteria | 2838054893 | 2838059360 | 162 |
| 202 | iso_pu_bacteria | 2894023352 | 2894027293 | 162 |
| 203 | iso_pu_bacteria | 2899924645 | 2899930917 | 162 |
| 204 | iso_pu_bacteria | 2928037797 | 2928040850 | 162 |
| 205 | iso_pu_bacteria | 2928044640 | 2928047692 | 162 |
| 206 | iso_pu_bacteria | 2928051484 | 2928055471 | 162 |
| 207 | iso_pu_bacteria | 2928064002 | 2928069578 | 162 |
| 208 | 3300003792 | Ga0055540_1011297 | Ga0055540_10112971 | 163 |
| 209 | 3300003794 | Ga0055531_10000452 | Ga0055531_1000045229 | 163 |
| 210 | 3300005577 | Ga0068857_100278939 | Ga0068857_1002789392 | 163 |
| 211 | 3300005617 | Ga0068859_100866412 | Ga0068859_1008664122 | 163 |
| 212 | 3300006038 | Ga0075365_10010759 | Ga0075365_100107594 | 163 |
| 213 | 3300006042 | Ga0075368_10003556 | Ga0075368_100035562 | 163 |
| 214 | 3300006051 | Ga0075364_10104419 | Ga0075364_101044192 | 163 |
| 215 | 3300006177 | Ga0075362_10045758 | Ga0075362_100457583 | 163 |
| 216 | 3300006178 | Ga0075367_10069662 | Ga0075367_100696622 | 163 |
| 217 | 3300006186 | Ga0075369_10011519 | Ga0075369_100115193 | 163 |
| 218 | 3300006195 | Ga0075366_10000589 | Ga0075366_1000058917 | 163 |
| 219 | 3300006195 | Ga0075366_10487844 | Ga0075366_104878441 | 163 |
| 220 | 3300006237 | Ga0097621_100777563 | Ga0097621_1007775632 | 163 |
| 221 | 3300006353 | Ga0075370_10017268 | Ga0075370_100172684 | 163 |
| 222 | 3300006353 | Ga0075370_10089862 | Ga0075370_100898624 | 163 |
| 223 | 3300006931 | Ga0097620_100866423 | Ga0097620_1008664232 | 163 |
| 224 | 3300009148 | Ga0105243_10913664 | Ga0105243_109136642 | 163 |
| 225 | 3300025273 | Ga0209673_1044171 | Ga0209673_10441712 | 163 |
| 226 | 3300025297 | Ga0209758_1080166 | Ga0209758_10801661 | 163 |
| 227 | 3300025303 | Ga0209051_1000114 | Ga0209051_1000114117 | 163 |
| 228 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015744 | 163 |
| 229 | 3300026089 | Ga0207648_11050964 | Ga0207648_110509642 | 163 |
| 230 | 3300026116 | Ga0207674_10260297 | Ga0207674_102602972 | 163 |
| 231 | 3300027866 | Ga0209813_10032502 | Ga0209813_100325022 | 163 |
| 232 | 3300028794 | Ga0307515_10002488 | Ga0307515_100024885 | 163 |
| 233 | 3300031456 | Ga0307513_10000008 | Ga0307513_10000008289 | 163 |
| 234 | 3300031456 | Ga0307513_10044420 | Ga0307513_100444205 | 163 |
| 235 | 3300031649 | Ga0307514_10028006 | Ga0307514_100280066 | 163 |
| 236 | 3300031730 | Ga0307516_10202072 | Ga0307516_102020722 | 163 |
| 237 | 3300033180 | Ga0307510_10271005 | Ga0307510_102710052 | 163 |
| 238 | 3300037068 | Ga0373925_0607276 | Ga0373925_0607276_322_825 | 163 |
| 239 | 3300037312 | Ga0395899_0004807 | Ga0395899_0004807_7572_8096 | 163 |
| 240 | 3300037418 | Ga0395900_0078887 | Ga0395900_0078887_2257_2778 | 163 |
| 241 | 3300037418 | Ga0395900_0588106 | Ga0395900_0588106_175_693 | 163 |
| 242 | 3300037418 | Ga0395900_0701491 | Ga0395900_0701491_64_588 | 163 |
| 243 | 3300037466 | Ga0395898_0007748 | Ga0395898_0007748_6576_7100 | 163 |
| 244 | 3300037466 | Ga0395898_0258911 | Ga0395898_0258911_984_1502 | 163 |
| 245 | 3300037471 | Ga0395905_0036396 | Ga0395905_0036396_625_1146 | 163 |
| 246 | 3300038443 | Ga0395901_0803293 | Ga0395901_0803293_69_593 | 163 |
| 247 | 3300038443 | Ga0395901_1232564 | Ga0395901_1232564_19_537 | 163 |
| 248 | 3300039437 | Ga0436365_1498257 | Ga0436365_1498257_630_1148 | 163 |
| 249 | 3300042006 | Ga0439432_071431 | Ga0439432_071431_102_602 | 163 |
| 250 | 3300042131 | Ga0450894_019197 | Ga0450894_019197_210_728 | 163 |
| 251 | 3300044673 | Ga0453683_0001384 | Ga0453683_0001384_15153_15671 | 163 |
| 252 | 3300044683 | Ga0466965_0290391 | Ga0466965_0290391_278_796 | 163 |
| 253 | 3300044765 | Ga0466970_0195189 | Ga0466970_0195189_549_1067 | 163 |
| 254 | 3300044842 | Ga0466957_0367620 | Ga0466957_0367620_162_686 | 163 |
| 255 | 3300045051 | Ga0451576_0085491 | Ga0451576_0085491_231_749 | 163 |
| 256 | 3300046457 | Ga0495590_0122528 | Ga0495590_0122528_282_785 | 163 |
| 257 | 3300046474 | Ga0495605_0260505 | Ga0495605_0260505_144_647 | 163 |
| 258 | 3300046519 | Ga0495632_0018041 | Ga0495632_0018041_1023_1526 | 163 |
| 259 | 3300046530 | Ga0495654_0021838 | Ga0495654_0021838_187_723 | 163 |
| 260 | 3300046530 | Ga0495654_0107004 | Ga0495654_0107004_619_1122 | 163 |
| 261 | 3300046660 | Ga0495625_0029006 | Ga0495625_0029006_109_612 | 163 |
| 262 | 3300046694 | Ga0495649_0006369 | Ga0495649_0006369_6071_6574 | 163 |
| 263 | 3300046810 | Ga0495660_0069608 | Ga0495660_0069608_514_1017 | 163 |
| 264 | 3300047443 | Ga0495687_013291 | Ga0495687_013291_638_1141 | 163 |
| 265 | 3300048091 | Ga0495626_0079830 | Ga0495626_0079830_872_1375 | 163 |
| 266 | 3300048925 | Ga0496122_0058925 | Ga0496122_0058925_2120_2641 | 163 |
| 267 | 3300048926 | Ga0496123_0121821 | Ga0496123_0121821_633_1154 | 163 |
| 268 | 3300048928 | Ga0496125_0001477 | Ga0496125_0001477_29935_30456 | 163 |
| 269 | 3300048929 | Ga0496126_0284309 | Ga0496126_0284309_558_1079 | 163 |
| 270 | 3300049571 | Ga0501034_0040051 | Ga0501034_0040051_3289_3795 | 163 |
| 271 | 3300049579 | Ga0501043_0371687 | Ga0501043_0371687_336_857 | 163 |
| 272 | 3300049707 | Ga0501234_028828 | Ga0501234_028828_122_640 | 163 |
| 273 | 3300049823 | Ga0501044_0262952 | Ga0501044_0262952_211_732 | 163 |
| 274 | 3300050489 | nmdc:mga03683_132996_c1 | nmdc:mga03683_132996_c1_116_640 | 163 |
| 275 | 3300050489 | nmdc:mga03683_38524_c1 | nmdc:mga03683_38524_c1_673_1179 | 163 |
| 276 | 3300050490 | nmdc:mga03n38_23656_c1 | nmdc:mga03n38_23656_c1_186_692 | 163 |
| 277 | 3300050490 | nmdc:mga03n38_254798_c1 | nmdc:mga03n38_254798_c1_171_674 | 163 |
| 278 | 3300050492 | nmdc:mga0yw44_11511_c1 | nmdc:mga0yw44_11511_c1_3526_4029 | 163 |
| 279 | 3300050493 | nmdc:mga0k408_265481_c1 | nmdc:mga0k408_265481_c1_112_618 | 163 |
| 280 | 3300050493 | nmdc:mga0k408_6404_c1 | nmdc:mga0k408_6404_c1_4933_5436 | 163 |
| 281 | 3300050494 | nmdc:mga06z11_1192_c1 | nmdc:mga06z11_1192_c1_5946_6449 | 163 |
| 282 | 3300050495 | nmdc:mga04h51_2632_c1 | nmdc:mga04h51_2632_c1_3448_3954 | 163 |
| 283 | 3300050496 | nmdc:mga07m45_3690_c1 | nmdc:mga07m45_3690_c1_6309_6812 | 163 |
| 284 | 3300050496 | nmdc:mga07m45_814_c1 | nmdc:mga07m45_814_c1_646_1149 | 163 |
| 285 | 3300050516 | nmdc:mga0sz30_15926_c1 | nmdc:mga0sz30_15926_c1_635_1141 | 163 |
| 286 | 3300053093 | Ga0500651_0076169 | Ga0500651_0076169_271_783 | 163 |
| 287 | 3300053129 | Ga0500628_054417 | Ga0500628_054417_153_674 | 163 |
| 288 | 3300053161 | Ga0500634_0030574 | Ga0500634_0030574_2114_2644 | 163 |
| 289 | 3300061719 | Ga0466962_0144833 | Ga0466962_0144833_409_927 | 163 |
| 290 | iso_pu_bacteria | 2643221609 | 2644059324 | 163 |
| 291 | iso_pu_bacteria | 2643221611 | 2644075638 | 163 |
| 292 | iso_pu_bacteria | 2738543012 | 2739240820 | 163 |
| 293 | iso_pu_bacteria | 2816332133 | 2816472102 | 163 |
| 294 | 3300005353 | Ga0070669_100041408 | Ga0070669_1000414084 | 164 |
| 295 | 3300005356 | Ga0070674_100169631 | Ga0070674_1001696313 | 164 |
| 296 | 3300005364 | Ga0070673_100150109 | Ga0070673_1001501093 | 164 |
| 297 | 3300005456 | Ga0070678_100087959 | Ga0070678_1000879592 | 164 |
| 298 | 3300005530 | Ga0070679_100238893 | Ga0070679_1002388932 | 164 |
| 299 | 3300005543 | Ga0070672_100317895 | Ga0070672_1003178952 | 164 |
| 300 | 3300005548 | Ga0070665_100074863 | Ga0070665_1000748633 | 164 |
| 301 | 3300005841 | Ga0068863_100067610 | Ga0068863_1000676104 | 164 |
| 302 | 3300005844 | Ga0068862_101186363 | Ga0068862_1011863632 | 164 |
| 303 | 3300006038 | Ga0075365_10054918 | Ga0075365_100549184 | 164 |
| 304 | 3300006178 | Ga0075367_10442482 | Ga0075367_104424822 | 164 |
| 305 | 3300006195 | Ga0075366_10129934 | Ga0075366_101299342 | 164 |
| 306 | 3300006353 | Ga0075370_10001649 | Ga0075370_100016493 | 164 |
| 307 | 3300014497 | Ga0182008_10000191 | Ga0182008_1000019148 | 164 |
| 308 | 3300015683 | Ga0183362_10005 | Ga0183362_10005207 | 164 |
| 309 | 3300021361 | Ga0213872_10034761 | Ga0213872_100347612 | 164 |
| 310 | 3300025921 | Ga0207652_10105485 | Ga0207652_101054852 | 164 |
| 311 | 3300025923 | Ga0207681_10011609 | Ga0207681_100116095 | 164 |
| 312 | 3300025937 | Ga0207669_10133207 | Ga0207669_101332073 | 164 |
| 313 | 3300025942 | Ga0207689_10257160 | Ga0207689_102571602 | 164 |
| 314 | 3300025960 | Ga0207651_10135350 | Ga0207651_101353503 | 164 |
| 315 | 3300026088 | Ga0207641_10054358 | Ga0207641_100543584 | 164 |
| 316 | 3300026095 | Ga0207676_10795326 | Ga0207676_107953261 | 164 |
| 317 | 3300026121 | Ga0207683_10068577 | Ga0207683_100685772 | 164 |
| 318 | 3300028379 | Ga0268266_10017085 | Ga0268266_100170855 | 164 |
| 319 | 3300028794 | Ga0307515_10000419 | Ga0307515_1000041957 | 164 |
| 320 | 3300031548 | Ga0307408_100100427 | Ga0307408_1001004274 | 164 |
| 321 | 3300031731 | Ga0307405_10040765 | Ga0307405_100407651 | 164 |
| 322 | 3300031824 | Ga0307413_10494581 | Ga0307413_104945812 | 164 |
| 323 | 3300032002 | Ga0307416_100034322 | Ga0307416_1000343224 | 164 |
| 324 | 3300042122 | Ga0450920_075715 | Ga0450920_075715_81_575 | 164 |
| 325 | 3300042532 | Ga0450893_0001490 | Ga0450893_0001490_1672_2166 | 164 |
| 326 | 3300042876 | Ga0451577_0000453 | Ga0451577_0000453_26530_27063 | 164 |
| 327 | 3300042876 | Ga0451577_1155411 | Ga0451577_1155411_108_680 | 164 |
| 328 | 3300044712 | Ga0453684_0002072 | Ga0453684_0002072_44433_44966 | 164 |
| 329 | 3300044712 | Ga0453684_0544495 | Ga0453684_0544495_409_981 | 164 |
| 330 | 3300045051 | Ga0451576_0000950 | Ga0451576_0000950_44439_44972 | 164 |
| 331 | 3300045051 | Ga0451576_0149889 | Ga0451576_0149889_1314_1886 | 164 |
| 332 | 3300048925 | Ga0496122_0000324 | Ga0496122_0000324_48833_49327 | 164 |
| 333 | 3300048925 | Ga0496122_0185253 | Ga0496122_0185253_216_791 | 164 |
| 334 | 3300048926 | Ga0496123_0000160 | Ga0496123_0000160_92827_93321 | 164 |
| 335 | 3300048927 | Ga0496124_0177864 | Ga0496124_0177864_395_889 | 164 |
| 336 | 3300049571 | Ga0501034_0668237 | Ga0501034_0668237_210_731 | 164 |
| 337 | 3300050489 | nmdc:mga03683_11355_c1 | nmdc:mga03683_11355_c1_487_981 | 164 |
| 338 | 3300050489 | nmdc:mga03683_602486_c1 | nmdc:mga03683_602486_c1_17_511 | 164 |
| 339 | 3300050493 | nmdc:mga0k408_206388_c1 | nmdc:mga0k408_206388_c1_235_729 | 164 |
| 340 | 3300053125 | Ga0500618_090293 | Ga0500618_090293_36_530 | 164 |
| 341 | 3300053136 | Ga0500559_0004515 | Ga0500559_0004515_5567_6076 | 164 |
| 342 | 3300053136 | Ga0500559_0144581 | Ga0500559_0144581_252_746 | 164 |
| 343 | iso_pu_bacteria | 2904541872 | 2904547110 | 164 |
| 344 | iso_pu_bacteria | 2929160207 | 2929165664 | 164 |
| 345 | iso_pu_bacteria | 2945909444 | 2945909680 | 164 |
| 346 | iso_pu_bacteria | 2945984333 | 2945988348 | 164 |
| 347 | iso_pu_bacteria | 2954767861 | 2954769135 | 164 |
| 348 | iso_pu_bacteria | 2974320154 | 2974320603 | 164 |
| 349 | 3300001979 | JGI24740J21852_10003589 | JGI24740J21852_100035894 | 165 |
| 350 | 3300001989 | JGI24739J22299_10083173 | JGI24739J22299_100831732 | 165 |
| 351 | 3300002739 | JGI25158J39367_1003768 | JGI25158J39367_10037683 | 165 |
| 352 | 3300002774 | JGI25150J39212_1007118 | JGI25150J39212_10071183 | 165 |
| 353 | 3300002987 | JGI25159J45721_1013528 | JGI25159J45721_10135281 | 165 |
| 354 | 3300003187 | JGI25151J46595_10010236 | JGI25151J46595_100102362 | 165 |
| 355 | 3300003187 | JGI25151J46595_10037898 | JGI25151J46595_100378983 | 165 |
| 356 | 3300003578 | Ga0006562J51391_1132144 | Ga0006562J51391_11321445 | 165 |
| 357 | 3300003578 | Ga0006562J51391_1132145 | Ga0006562J51391_11321451 | 165 |
| 358 | 3300003760 | Ga0055527_1014536 | Ga0055527_10145362 | 165 |
| 359 | 3300003761 | Ga0055535_1001590 | Ga0055535_10015903 | 165 |
| 360 | 3300003762 | Ga0055542_1000036 | Ga0055542_1000036156 | 165 |
| 361 | 3300003773 | Ga0055537_1000555 | Ga0055537_100055511 | 165 |
| 362 | 3300003781 | Ga0055536_1009989 | Ga0055536_10099892 | 165 |
| 363 | 3300003781 | Ga0055536_1032144 | Ga0055536_10321443 | 165 |
| 364 | 3300003784 | Ga0055534_1000153 | Ga0055534_100015310 | 165 |
| 365 | 3300003784 | Ga0055534_1000465 | Ga0055534_10004655 | 165 |
| 366 | 3300003790 | Ga0055528_1000291 | Ga0055528_100029132 | 165 |
| 367 | 3300003790 | Ga0055528_1023606 | Ga0055528_10236064 | 165 |
| 368 | 3300003791 | Ga0055530_10002388 | Ga0055530_100023886 | 165 |
| 369 | 3300003791 | Ga0055530_10021424 | Ga0055530_100214242 | 165 |
| 370 | 3300003792 | Ga0055540_1017998 | Ga0055540_10179983 | 165 |
| 371 | 3300003792 | Ga0055540_1031421 | Ga0055540_10314212 | 165 |
| 372 | 3300003794 | Ga0055531_10020418 | Ga0055531_100204183 | 165 |
| 373 | 3300004625 | Ga0055543_1001133 | Ga0055543_10011339 | 165 |
| 374 | 3300004625 | Ga0055543_1017654 | Ga0055543_10176542 | 165 |
| 375 | 3300005262 | Ga0065165_1001031 | Ga0065165_10010313 | 165 |
| 376 | 3300005262 | Ga0065165_1129929 | Ga0065165_11299291 | 165 |
| 377 | 3300005288 | Ga0065714_10013668 | Ga0065714_100136683 | 165 |
| 378 | 3300005289 | Ga0065704_10020258 | Ga0065704_100202582 | 165 |
| 379 | 3300005327 | Ga0070658_10230320 | Ga0070658_102303203 | 165 |
| 380 | 3300005334 | Ga0068869_100995427 | Ga0068869_1009954271 | 165 |
| 381 | 3300005335 | Ga0070666_10019943 | Ga0070666_100199433 | 165 |
| 382 | 3300005338 | Ga0068868_100157144 | Ga0068868_1001571443 | 165 |
| 383 | 3300005347 | Ga0070668_101563388 | Ga0070668_1015633881 | 165 |
| 384 | 3300005354 | Ga0070675_100276062 | Ga0070675_1002760623 | 165 |
| 385 | 3300005364 | Ga0070673_101514889 | Ga0070673_1015148891 | 165 |
| 386 | 3300005366 | Ga0070659_100720456 | Ga0070659_1007204562 | 165 |
| 387 | 3300005367 | Ga0070667_100056587 | Ga0070667_1000565874 | 165 |
| 388 | 3300005455 | Ga0070663_100741519 | Ga0070663_1007415191 | 165 |
| 389 | 3300005456 | Ga0070678_100078537 | Ga0070678_1000785374 | 165 |
| 390 | 3300005457 | Ga0070662_100023748 | Ga0070662_1000237485 | 165 |
| 391 | 3300005457 | Ga0070662_100294980 | Ga0070662_1002949802 | 165 |
| 392 | 3300005459 | Ga0068867_100899544 | Ga0068867_1008995441 | 165 |
| 393 | 3300005539 | Ga0068853_100117976 | Ga0068853_1001179763 | 165 |
| 394 | 3300005543 | Ga0070672_100156490 | Ga0070672_1001564903 | 165 |
| 395 | 3300005543 | Ga0070672_100843335 | Ga0070672_1008433352 | 165 |
| 396 | 3300005548 | Ga0070665_100001342 | Ga0070665_1000013427 | 165 |
| 397 | 3300005563 | Ga0068855_100067788 | Ga0068855_1000677885 | 165 |
| 398 | 3300005564 | Ga0070664_100011880 | Ga0070664_1000118802 | 165 |
| 399 | 3300005577 | Ga0068857_100007211 | Ga0068857_1000072111 | 165 |
| 400 | 3300005577 | Ga0068857_100373630 | Ga0068857_1003736301 | 165 |
| 401 | 3300005578 | Ga0068854_101338760 | Ga0068854_1013387601 | 165 |
| 402 | 3300005616 | Ga0068852_100074659 | Ga0068852_1000746592 | 165 |
| 403 | 3300005616 | Ga0068852_100105559 | Ga0068852_1001055594 | 165 |
| 404 | 3300005718 | Ga0068866_10575434 | Ga0068866_105754342 | 165 |
| 405 | 3300005834 | Ga0068851_10014073 | Ga0068851_100140734 | 165 |
| 406 | 3300005844 | Ga0068862_100324040 | Ga0068862_1003240402 | 165 |
| 407 | 3300006038 | Ga0075365_10046973 | Ga0075365_100469732 | 165 |
| 408 | 3300006048 | Ga0075363_100010260 | Ga0075363_1000102603 | 165 |
| 409 | 3300006048 | Ga0075363_100017158 | Ga0075363_1000171584 | 165 |
| 410 | 3300006048 | Ga0075363_100200977 | Ga0075363_1002009771 | 165 |
| 411 | 3300006051 | Ga0075364_10050216 | Ga0075364_100502162 | 165 |
| 412 | 3300006177 | Ga0075362_10009998 | Ga0075362_100099984 | 165 |
| 413 | 3300006177 | Ga0075362_10016579 | Ga0075362_100165792 | 165 |
| 414 | 3300006177 | Ga0075362_10054707 | Ga0075362_100547073 | 165 |
| 415 | 3300006178 | Ga0075367_10024343 | Ga0075367_100243434 | 165 |
| 416 | 3300006195 | Ga0075366_10059307 | Ga0075366_100593071 | 165 |
| 417 | 3300006195 | Ga0075366_10110206 | Ga0075366_101102062 | 165 |
| 418 | 3300006353 | Ga0075370_10002258 | Ga0075370_100022585 | 165 |
| 419 | 3300006353 | Ga0075370_10009173 | Ga0075370_100091735 | 165 |
| 420 | 3300006353 | Ga0075370_10043241 | Ga0075370_100432412 | 165 |
| 421 | 3300006353 | Ga0075370_10112371 | Ga0075370_101123712 | 165 |
| 422 | 3300006353 | Ga0075370_10167614 | Ga0075370_101676142 | 165 |
| 423 | 3300006948 | Ga0099826_10026745 | Ga0099826_100267455 | 165 |
| 424 | 3300006948 | Ga0099826_10446520 | Ga0099826_104465201 | 165 |
| 425 | 3300009036 | Ga0105244_10027858 | Ga0105244_100278583 | 165 |
| 426 | 3300009036 | Ga0105244_10100182 | Ga0105244_101001822 | 165 |
| 427 | 3300009036 | Ga0105244_10117325 | Ga0105244_101173252 | 165 |
| 428 | 3300009036 | Ga0105244_10252782 | Ga0105244_102527822 | 165 |
| 429 | 3300009093 | Ga0105240_10132454 | Ga0105240_101324544 | 165 |
| 430 | 3300009093 | Ga0105240_10938232 | Ga0105240_109382322 | 165 |
| 431 | 3300009098 | Ga0105245_10138838 | Ga0105245_101388382 | 165 |
| 432 | 3300009148 | Ga0105243_10014356 | Ga0105243_100143563 | 165 |
| 433 | 3300009148 | Ga0105243_10063082 | Ga0105243_100630823 | 165 |
| 434 | 3300009148 | Ga0105243_10122514 | Ga0105243_101225143 | 165 |
| 435 | 3300009174 | Ga0105241_10482392 | Ga0105241_104823922 | 165 |
| 436 | 3300009545 | Ga0105237_11052568 | Ga0105237_110525682 | 165 |
| 437 | 3300009551 | Ga0105238_10133660 | Ga0105238_101336604 | 165 |
| 438 | 3300009551 | Ga0105238_10216769 | Ga0105238_102167692 | 165 |
| 439 | 3300010375 | Ga0105239_10591978 | Ga0105239_105919781 | 165 |
| 440 | 3300011119 | Ga0105246_10366770 | Ga0105246_103667702 | 165 |
| 441 | 3300011119 | Ga0105246_11175429 | Ga0105246_111754291 | 165 |
| 442 | 3300012498 | Ga0157345_1016110 | Ga0157345_10161102 | 165 |
| 443 | 3300013100 | Ga0157373_10434712 | Ga0157373_104347122 | 165 |
| 444 | 3300013104 | Ga0157370_10532596 | Ga0157370_105325962 | 165 |
| 445 | 3300013105 | Ga0157369_10029769 | Ga0157369_100297693 | 165 |
| 446 | 3300013306 | Ga0163162_10030214 | Ga0163162_100302143 | 165 |
| 447 | 3300013307 | Ga0157372_10323504 | Ga0157372_103235042 | 165 |
| 448 | 3300013308 | Ga0157375_10424561 | Ga0157375_104245613 | 165 |
| 449 | 3300014497 | Ga0182008_10008989 | Ga0182008_100089896 | 165 |
| 450 | 3300014497 | Ga0182008_10022737 | Ga0182008_100227375 | 165 |
| 451 | 3300014497 | Ga0182008_10076861 | Ga0182008_100768612 | 165 |
| 452 | 3300014745 | Ga0157377_10731483 | Ga0157377_107314832 | 165 |
| 453 | 3300014968 | Ga0157379_10404697 | Ga0157379_104046972 | 165 |
| 454 | 3300014969 | Ga0157376_10324969 | Ga0157376_103249692 | 165 |
| 455 | 3300014969 | Ga0157376_11621233 | Ga0157376_116212331 | 165 |
| 456 | 3300015261 | Ga0182006_1010781 | Ga0182006_10107812 | 165 |
| 457 | 3300015262 | Ga0182007_10001495 | Ga0182007_100014956 | 165 |
| 458 | 3300015262 | Ga0182007_10005458 | Ga0182007_100054584 | 165 |
| 459 | 3300015262 | Ga0182007_10026502 | Ga0182007_100265023 | 165 |
| 460 | 3300017792 | Ga0163161_10066688 | Ga0163161_100666884 | 165 |
| 461 | 3300017792 | Ga0163161_10258708 | Ga0163161_102587083 | 165 |
| 462 | 3300017792 | Ga0163161_10461403 | Ga0163161_104614032 | 165 |
| 463 | 3300025228 | Ga0209672_100321 | Ga0209672_10032127 | 165 |
| 464 | 3300025229 | Ga0209147_100434 | Ga0209147_10043419 | 165 |
| 465 | 3300025242 | Ga0209258_100091 | Ga0209258_100091157 | 165 |
| 466 | 3300025245 | Ga0207425_1000190 | Ga0207425_10001908 | 165 |
| 467 | 3300025245 | Ga0207425_1016639 | Ga0207425_10166392 | 165 |
| 468 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033327 | 165 |
| 469 | 3300025258 | Ga0209129_1000091 | Ga0209129_100009135 | 165 |
| 470 | 3300025258 | Ga0209129_1001462 | Ga0209129_100146212 | 165 |
| 471 | 3300025258 | Ga0209129_1002158 | Ga0209129_10021586 | 165 |
| 472 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020135 | 165 |
| 473 | 3300025263 | Ga0209565_1000335 | Ga0209565_10003353 | 165 |
| 474 | 3300025263 | Ga0209565_1004510 | Ga0209565_10045103 | 165 |
| 475 | 3300025273 | Ga0209673_1000072 | Ga0209673_100007265 | 165 |
| 476 | 3300025273 | Ga0209673_1000154 | Ga0209673_100015450 | 165 |
| 477 | 3300025273 | Ga0209673_1002551 | Ga0209673_100255111 | 165 |
| 478 | 3300025273 | Ga0209673_1002946 | Ga0209673_10029465 | 165 |
| 479 | 3300025284 | Ga0209130_1000140 | Ga0209130_100014057 | 165 |
| 480 | 3300025284 | Ga0209130_1000203 | Ga0209130_100020359 | 165 |
| 481 | 3300025284 | Ga0209130_1003870 | Ga0209130_10038705 | 165 |
| 482 | 3300025291 | Ga0209675_1000014 | Ga0209675_1000014123 | 165 |
| 483 | 3300025291 | Ga0209675_1001248 | Ga0209675_10012483 | 165 |
| 484 | 3300025291 | Ga0209675_1002386 | Ga0209675_10023863 | 165 |
| 485 | 3300025291 | Ga0209675_1003660 | Ga0209675_10036605 | 165 |
| 486 | 3300025291 | Ga0209675_1030353 | Ga0209675_10303532 | 165 |
| 487 | 3300025291 | Ga0209675_1070011 | Ga0209675_10700112 | 165 |
| 488 | 3300025292 | Ga0209676_1000088 | Ga0209676_100008834 | 165 |
| 489 | 3300025292 | Ga0209676_1001287 | Ga0209676_100128723 | 165 |
| 490 | 3300025292 | Ga0209676_1001392 | Ga0209676_100139219 | 165 |
| 491 | 3300025292 | Ga0209676_1001762 | Ga0209676_100176223 | 165 |
| 492 | 3300025292 | Ga0209676_1043089 | Ga0209676_10430892 | 165 |
| 493 | 3300025294 | Ga0209025_1000207 | Ga0209025_100020758 | 165 |
| 494 | 3300025294 | Ga0209025_1000286 | Ga0209025_100028636 | 165 |
| 495 | 3300025294 | Ga0209025_1000356 | Ga0209025_100035658 | 165 |
| 496 | 3300025294 | Ga0209025_1007998 | Ga0209025_10079986 | 165 |
| 497 | 3300025294 | Ga0209025_1023793 | Ga0209025_10237933 | 165 |
| 498 | 3300025295 | Ga0209564_1000103 | Ga0209564_100010356 | 165 |
| 499 | 3300025295 | Ga0209564_1000597 | Ga0209564_10005973 | 165 |
| 500 | 3300025297 | Ga0209758_1000092 | Ga0209758_1000092113 | 165 |
| 501 | 3300025297 | Ga0209758_1007051 | Ga0209758_10070513 | 165 |
| 502 | 3300025297 | Ga0209758_1126381 | Ga0209758_11263811 | 165 |
| 503 | 3300025298 | Ga0209050_1000511 | Ga0209050_100051144 | 165 |
| 504 | 3300025298 | Ga0209050_1000758 | Ga0209050_10007583 | 165 |
| 505 | 3300025299 | Ga0209256_1000065 | Ga0209256_100006526 | 165 |
| 506 | 3300025299 | Ga0209256_1000094 | Ga0209256_100009483 | 165 |
| 507 | 3300025302 | Ga0207426_1000084 | Ga0207426_1000084146 | 165 |
| 508 | 3300025302 | Ga0207426_1002447 | Ga0207426_100244710 | 165 |
| 509 | 3300025303 | Ga0209051_1000069 | Ga0209051_1000069168 | 165 |
| 510 | 3300025303 | Ga0209051_1000326 | Ga0209051_100032620 | 165 |
| 511 | 3300025303 | Ga0209051_1000335 | Ga0209051_100033519 | 165 |
| 512 | 3300025303 | Ga0209051_1000461 | Ga0209051_100046122 | 165 |
| 513 | 3300025303 | Ga0209051_1047887 | Ga0209051_10478873 | 165 |
| 514 | 3300025304 | Ga0209257_1000093 | Ga0209257_1000093210 | 165 |
| 515 | 3300025304 | Ga0209257_1000249 | Ga0209257_100024914 | 165 |
| 516 | 3300025304 | Ga0209257_1012145 | Ga0209257_10121454 | 165 |
| 517 | 3300025304 | Ga0209257_1030923 | Ga0209257_10309233 | 165 |
| 518 | 3300025321 | Ga0207656_10087925 | Ga0207656_100879252 | 165 |
| 519 | 3300025728 | Ga0207655_1001919 | Ga0207655_100191914 | 165 |
| 520 | 3300025893 | Ga0207682_10101735 | Ga0207682_101017353 | 165 |
| 521 | 3300025903 | Ga0207680_10012314 | Ga0207680_100123144 | 165 |
| 522 | 3300025904 | Ga0207647_10115716 | Ga0207647_101157162 | 165 |
| 523 | 3300025911 | Ga0207654_10587457 | Ga0207654_105874572 | 165 |
| 524 | 3300025924 | Ga0207694_10158528 | Ga0207694_101585283 | 165 |
| 525 | 3300025924 | Ga0207694_10364074 | Ga0207694_103640742 | 165 |
| 526 | 3300025927 | Ga0207687_10445974 | Ga0207687_104459742 | 165 |
| 527 | 3300025932 | Ga0207690_10193762 | Ga0207690_101937622 | 165 |
| 528 | 3300025933 | Ga0207706_10047536 | Ga0207706_100475364 | 165 |
| 529 | 3300025935 | Ga0207709_10000570 | Ga0207709_100005706 | 165 |
| 530 | 3300025935 | Ga0207709_10000803 | Ga0207709_1000080321 | 165 |
| 531 | 3300025935 | Ga0207709_10138308 | Ga0207709_101383082 | 165 |
| 532 | 3300025940 | Ga0207691_10148957 | Ga0207691_101489572 | 165 |
| 533 | 3300025940 | Ga0207691_10756458 | Ga0207691_107564582 | 165 |
| 534 | 3300025945 | Ga0207679_10033624 | Ga0207679_100336245 | 165 |
| 535 | 3300025981 | Ga0207640_10030195 | Ga0207640_100301952 | 165 |
| 536 | 3300025981 | Ga0207640_10361490 | Ga0207640_103614902 | 165 |
| 537 | 3300025986 | Ga0207658_10012974 | Ga0207658_100129744 | 165 |
| 538 | 3300026023 | Ga0207677_10241376 | Ga0207677_102413763 | 165 |
| 539 | 3300026041 | Ga0207639_10089989 | Ga0207639_100899893 | 165 |
| 540 | 3300026041 | Ga0207639_10305972 | Ga0207639_103059722 | 165 |
| 541 | 3300026088 | Ga0207641_11341825 | Ga0207641_113418252 | 165 |
| 542 | 3300026116 | Ga0207674_10138811 | Ga0207674_101388113 | 165 |
| 543 | 3300026142 | Ga0207698_10057775 | Ga0207698_100577752 | 165 |
| 544 | 3300026142 | Ga0207698_10359117 | Ga0207698_103591172 | 165 |
| 545 | 3300027614 | Ga0209970_1030891 | Ga0209970_10308912 | 165 |
| 546 | 3300027666 | Ga0209282_1009487 | Ga0209282_10094875 | 165 |
| 547 | 3300027682 | Ga0209971_1011840 | Ga0209971_10118402 | 165 |
| 548 | 3300028379 | Ga0268266_10012485 | Ga0268266_100124855 | 165 |
| 549 | 3300028380 | Ga0268265_10257501 | Ga0268265_102575013 | 165 |
| 550 | 3300028794 | Ga0307515_10226265 | Ga0307515_102262652 | 165 |
| 551 | 3300028794 | Ga0307515_10478530 | Ga0307515_104785302 | 165 |
| 552 | 3300030731 | Ga0316177_1110995 | Ga0316177_11109952 | 165 |
| 553 | 3300030733 | Ga0314311_1041992 | Ga0314311_10419924 | 165 |
| 554 | 3300030734 | Ga0316179_1055282 | Ga0316179_10552825 | 165 |
| 555 | 3300030736 | Ga0316180_1036074 | Ga0316180_10360742 | 165 |
| 556 | 3300030742 | Ga0316183_1039276 | Ga0316183_10392762 | 165 |
| 557 | 3300030744 | Ga0316181_1029714 | Ga0316181_10297143 | 165 |
| 558 | 3300030744 | Ga0316181_1154876 | Ga0316181_11548762 | 165 |
| 559 | 3300030745 | Ga0316182_1102772 | Ga0316182_11027722 | 165 |
| 560 | 3300030745 | Ga0316182_1407517 | Ga0316182_14075172 | 165 |
| 561 | 3300031456 | Ga0307513_10250709 | Ga0307513_102507092 | 165 |
| 562 | 3300031548 | Ga0307408_100673035 | Ga0307408_1006730352 | 165 |
| 563 | 3300031548 | Ga0307408_100889256 | Ga0307408_1008892561 | 165 |
| 564 | 3300031649 | Ga0307514_10056121 | Ga0307514_100561212 | 165 |
| 565 | 3300031731 | Ga0307405_10044321 | Ga0307405_100443214 | 165 |
| 566 | 3300031731 | Ga0307405_10095397 | Ga0307405_100953974 | 165 |
| 567 | 3300031731 | Ga0307405_10632450 | Ga0307405_106324503 | 165 |
| 568 | 3300031901 | Ga0307406_10003068 | Ga0307406_1000306810 | 165 |
| 569 | 3300031901 | Ga0307406_10153607 | Ga0307406_101536072 | 165 |
| 570 | 3300031901 | Ga0307406_10337936 | Ga0307406_103379362 | 165 |
| 571 | 3300031901 | Ga0307406_10461136 | Ga0307406_104611362 | 165 |
| 572 | 3300031911 | Ga0307412_10027679 | Ga0307412_100276791 | 165 |
| 573 | 3300031911 | Ga0307412_10433288 | Ga0307412_104332881 | 165 |
| 574 | 3300031911 | Ga0307412_11082029 | Ga0307412_110820291 | 165 |
| 575 | 3300031911 | Ga0307412_11396158 | Ga0307412_113961582 | 165 |
| 576 | 3300031995 | Ga0307409_101546513 | Ga0307409_1015465131 | 165 |
| 577 | 3300032002 | Ga0307416_100354569 | Ga0307416_1003545692 | 165 |
| 578 | 3300032002 | Ga0307416_102604010 | Ga0307416_1026040101 | 165 |
| 579 | 3300032004 | Ga0307414_10458780 | Ga0307414_104587802 | 165 |
| 580 | 3300032005 | Ga0307411_10185441 | Ga0307411_101854413 | 165 |
| 581 | 3300041404 | Ga0439436_0000145 | Ga0439436_0000145_12380_12877 | 165 |
| 582 | 3300041404 | Ga0439436_0055431 | Ga0439436_0055431_278_775 | 165 |
| 583 | 3300041406 | Ga0439439_0064163 | Ga0439439_0064163_149_646 | 165 |
| 584 | 3300041407 | Ga0439447_025789 | Ga0439447_025789_350_847 | 165 |
| 585 | 3300041411 | Ga0439466_0016359 | Ga0439466_0016359_301_798 | 165 |
| 586 | 3300041411 | Ga0439466_0019274 | Ga0439466_0019274_1724_2221 | 165 |
| 587 | 3300041413 | Ga0439465_0008576 | Ga0439465_0008576_845_1342 | 165 |
| 588 | 3300041452 | Ga0451793_1822058 | Ga0451793_1822058_141_638 | 165 |
| 589 | 3300041486 | Ga0451807_0148583 | Ga0451807_0148583_24_521 | 165 |
| 590 | 3300041491 | Ga0451833_0202136 | Ga0451833_0202136_39_554 | 165 |
| 591 | 3300041997 | Ga0439431_0006720 | Ga0439431_0006720_1337_1834 | 165 |
| 592 | 3300041999 | Ga0439433_0000215 | Ga0439433_0000215_593_1090 | 165 |
| 593 | 3300042002 | Ga0439442_010231 | Ga0439442_010231_259_756 | 165 |
| 594 | 3300042002 | Ga0439442_010282 | Ga0439442_010282_1298_1795 | 165 |
| 595 | 3300042004 | Ga0439445_0022552 | Ga0439445_0022552_420_917 | 165 |
| 596 | 3300042004 | Ga0439445_0075303 | Ga0439445_0075303_257_754 | 165 |
| 597 | 3300042006 | Ga0439432_000575 | Ga0439432_000575_4839_5336 | 165 |
| 598 | 3300042007 | Ga0439449_0001297 | Ga0439449_0001297_8446_8943 | 165 |
| 599 | 3300042007 | Ga0439449_0001545 | Ga0439449_0001545_160_657 | 165 |
| 600 | 3300042010 | Ga0439452_029342 | Ga0439452_029342_410_907 | 165 |
| 601 | 3300042012 | Ga0439455_0069064 | Ga0439455_0069064_89_589 | 165 |
| 602 | 3300042014 | Ga0439457_009113 | Ga0439457_009113_1711_2208 | 165 |
| 603 | 3300042015 | Ga0439462_0030104 | Ga0439462_0030104_854_1351 | 165 |
| 604 | 3300042015 | Ga0439462_0044074 | Ga0439462_0044074_390_887 | 165 |
| 605 | 3300042134 | Ga0450898_015673 | Ga0450898_015673_301_798 | 165 |
| 606 | 3300042145 | Ga0450906_028509 | Ga0450906_028509_439_939 | 165 |
| 607 | 3300042146 | Ga0450907_013950 | Ga0450907_013950_553_1050 | 165 |
| 608 | 3300042147 | Ga0450910_003817 | Ga0450910_003817_1397_1894 | 165 |
| 609 | 3300042156 | Ga0439446_0001157 | Ga0439446_0001157_5247_5744 | 165 |
| 610 | 3300042184 | Ga0450908_001944 | Ga0450908_001944_338_835 | 165 |
| 611 | 3300042185 | Ga0450909_046920 | Ga0450909_046920_122_619 | 165 |
| 612 | 3300042435 | Ga0439434_0065430 | Ga0439434_0065430_32_529 | 165 |
| 613 | 3300042531 | Ga0450918_007108 | Ga0450918_007108_1073_1570 | 165 |
| 614 | 3300046453 | Ga0495627_071523 | Ga0495627_071523_333_830 | 165 |
| 615 | 3300046459 | Ga0495629_0240844 | Ga0495629_0240844_678_1175 | 165 |
| 616 | 3300046475 | Ga0495639_0008381 | Ga0495639_0008381_3341_3838 | 165 |
| 617 | 3300046506 | Ga0495583_0330445 | Ga0495583_0330445_81_578 | 165 |
| 618 | 3300046512 | Ga0495610_0030481 | Ga0495610_0030481_339_836 | 165 |
| 619 | 3300046513 | Ga0495616_0001394 | Ga0495616_0001394_9593_10090 | 165 |
| 620 | 3300046515 | Ga0495620_0028397 | Ga0495620_0028397_2033_2530 | 165 |
| 621 | 3300046518 | Ga0495631_0001085 | Ga0495631_0001085_3965_4462 | 165 |
| 622 | 3300046520 | Ga0495637_0022112 | Ga0495637_0022112_2148_2645 | 165 |
| 623 | 3300046520 | Ga0495637_0113806 | Ga0495637_0113806_423_920 | 165 |
| 624 | 3300046522 | Ga0495643_0086670 | Ga0495643_0086670_890_1402 | 165 |
| 625 | 3300046530 | Ga0495654_0137807 | Ga0495654_0137807_500_997 | 165 |
| 626 | 3300046538 | Ga0495609_0082169 | Ga0495609_0082169_440_940 | 165 |
| 627 | 3300046539 | Ga0495621_0015001 | Ga0495621_0015001_1856_2353 | 165 |
| 628 | 3300046539 | Ga0495621_0064455 | Ga0495621_0064455_205_702 | 165 |
| 629 | 3300046615 | Ga0495656_0000055 | Ga0495656_0000055_51992_52489 | 165 |
| 630 | 3300046616 | Ga0495668_0059881 | Ga0495668_0059881_280_777 | 165 |
| 631 | 3300046660 | Ga0495625_0002019 | Ga0495625_0002019_9132_9629 | 165 |
| 632 | 3300046663 | Ga0495635_0063641 | Ga0495635_0063641_198_695 | 165 |
| 633 | 3300046665 | Ga0495661_0382408 | Ga0495661_0382408_124_621 | 165 |
| 634 | 3300046674 | Ga0495588_0264290 | Ga0495588_0264290_88_585 | 165 |
| 635 | 3300046674 | Ga0495588_0470056 | Ga0495588_0470056_17_514 | 165 |
| 636 | 3300046690 | Ga0495624_0451607 | Ga0495624_0451607_230_727 | 165 |
| 637 | 3300046691 | Ga0495670_0019185 | Ga0495670_0019185_2802_3299 | 165 |
| 638 | 3300046691 | Ga0495670_0294458 | Ga0495670_0294458_172_669 | 165 |
| 639 | 3300046692 | Ga0495671_0019757 | Ga0495671_0019757_934_1431 | 165 |
| 640 | 3300047321 | Ga0495676_0003857 | Ga0495676_0003857_254_751 | 165 |
| 641 | 3300047445 | Ga0495677_0055771 | Ga0495677_0055771_393_890 | 165 |
| 642 | 3300047673 | Ga0495593_0065889 | Ga0495593_0065889_284_781 | 165 |
| 643 | 3300048903 | Ga0496100_0001576 | Ga0496100_0001576_1203_1700 | 165 |
| 644 | 3300048905 | Ga0496102_0102436 | Ga0496102_0102436_2024_2521 | 165 |
| 645 | 3300048906 | Ga0496103_0194490 | Ga0496103_0194490_525_1022 | 165 |
| 646 | 3300048908 | Ga0496105_0006863 | Ga0496105_0006863_326_823 | 165 |
| 647 | 3300048910 | Ga0496107_0054621 | Ga0496107_0054621_193_690 | 165 |
| 648 | 3300048912 | Ga0496109_0082373 | Ga0496109_0082373_2265_2762 | 165 |
| 649 | 3300048913 | Ga0496110_0364537 | Ga0496110_0364537_450_947 | 165 |
| 650 | 3300048913 | Ga0496110_1002642 | Ga0496110_1002642_45_542 | 165 |
| 651 | 3300048914 | Ga0496111_0204021 | Ga0496111_0204021_323_820 | 165 |
| 652 | 3300048916 | Ga0496113_0393002 | Ga0496113_0393002_161_658 | 165 |
| 653 | 3300048917 | Ga0496114_0281861 | Ga0496114_0281861_79_576 | 165 |
| 654 | 3300048919 | Ga0496116_0107094 | Ga0496116_0107094_625_1125 | 165 |
| 655 | 3300048920 | Ga0496117_0082571 | Ga0496117_0082571_549_1046 | 165 |
| 656 | 3300048920 | Ga0496117_0086486 | Ga0496117_0086486_479_976 | 165 |
| 657 | 3300048920 | Ga0496117_0251954 | Ga0496117_0251954_206_706 | 165 |
| 658 | 3300048921 | Ga0496118_0097166 | Ga0496118_0097166_19_516 | 165 |
| 659 | 3300048921 | Ga0496118_0106508 | Ga0496118_0106508_484_981 | 165 |
| 660 | 3300048924 | Ga0496121_0069958 | Ga0496121_0069958_918_1418 | 165 |
| 661 | 3300048925 | Ga0496122_0051838 | Ga0496122_0051838_220_720 | 165 |
| 662 | 3300048925 | Ga0496122_0146934 | Ga0496122_0146934_127_660 | 165 |
| 663 | 3300048926 | Ga0496123_0067679 | Ga0496123_0067679_199_696 | 165 |
| 664 | 3300048926 | Ga0496123_0193176 | Ga0496123_0193176_223_726 | 165 |
| 665 | 3300048926 | Ga0496123_0236002 | Ga0496123_0236002_202_735 | 165 |
| 666 | 3300048927 | Ga0496124_0013362 | Ga0496124_0013362_6473_6970 | 165 |
| 667 | 3300048927 | Ga0496124_0158716 | Ga0496124_0158716_1069_1566 | 165 |
| 668 | 3300048928 | Ga0496125_0036017 | Ga0496125_0036017_3407_3904 | 165 |
| 669 | 3300048928 | Ga0496125_0193321 | Ga0496125_0193321_618_1115 | 165 |
| 670 | 3300048929 | Ga0496126_0410964 | Ga0496126_0410964_260_757 | 165 |
| 671 | 3300049679 | Ga0501249_002237 | Ga0501249_002237_1451_1948 | 165 |
| 672 | 3300049705 | Ga0501225_0098687 | Ga0501225_0098687_334_831 | 165 |
| 673 | 3300049759 | Ga0501262_000323 | Ga0501262_000323_471_968 | 165 |
| 674 | 3300050489 | nmdc:mga03683_25447_c1 | nmdc:mga03683_25447_c1_92_589 | 165 |
| 675 | 3300050489 | nmdc:mga03683_44131_c1 | nmdc:mga03683_44131_c1_161_658 | 165 |
| 676 | 3300050490 | nmdc:mga03n38_14679_c1 | nmdc:mga03n38_14679_c1_378_875 | 165 |
| 677 | 3300050490 | nmdc:mga03n38_296622_c1 | nmdc:mga03n38_296622_c1_125_622 | 165 |
| 678 | 3300050491 | nmdc:mga00v17_13376_c1 | nmdc:mga00v17_13376_c1_3805_4302 | 165 |
| 679 | 3300050492 | nmdc:mga0yw44_120011_c1 | nmdc:mga0yw44_120011_c1_845_1342 | 165 |
| 680 | 3300050493 | nmdc:mga0k408_18277_c1 | nmdc:mga0k408_18277_c1_1116_1613 | 165 |
| 681 | 3300050496 | nmdc:mga07m45_3563_c1 | nmdc:mga07m45_3563_c1_6874_7371 | 165 |
| 682 | 3300050496 | nmdc:mga07m45_3602_c1 | nmdc:mga07m45_3602_c1_4785_5282 | 165 |
| 683 | 3300050496 | nmdc:mga07m45_645240_c1 | nmdc:mga07m45_645240_c1_19_525 | 165 |
| 684 | 3300050516 | nmdc:mga0sz30_50071_c1 | nmdc:mga0sz30_50071_c1_129_626 | 165 |
| 685 | 3300053079 | Ga0500610_0000194 | Ga0500610_0000194_15065_15562 | 165 |
| 686 | 3300053079 | Ga0500610_0090294 | Ga0500610_0090294_290_787 | 165 |
| 687 | 3300053087 | Ga0500643_019165 | Ga0500643_019165_1080_1577 | 165 |
| 688 | 3300053093 | Ga0500651_0000082 | Ga0500651_0000082_10050_10547 | 165 |
| 689 | 3300053110 | Ga0500571_000162 | Ga0500571_000162_352_849 | 165 |
| 690 | 3300053117 | Ga0500593_013811 | Ga0500593_013811_2881_3378 | 165 |
| 691 | 3300053121 | Ga0500607_016835 | Ga0500607_016835_1546_2043 | 165 |
| 692 | 3300053122 | Ga0500608_010513 | Ga0500608_010513_177_674 | 165 |
| 693 | 3300053122 | Ga0500608_186786 | Ga0500608_186786_256_753 | 165 |
| 694 | 3300053125 | Ga0500618_063913 | Ga0500618_063913_267_764 | 165 |
| 695 | 3300053134 | Ga0500658_0000170 | Ga0500658_0000170_9062_9559 | 165 |
| 696 | 3300053134 | Ga0500658_0001413 | Ga0500658_0001413_460_957 | 165 |
| 697 | 3300053136 | Ga0500559_0025081 | Ga0500559_0025081_1864_2361 | 165 |
| 698 | 3300053137 | Ga0500561_0124276 | Ga0500561_0124276_207_704 | 165 |
| 699 | 3300053138 | Ga0500564_012901 | Ga0500564_012901_3167_3664 | 165 |
| 700 | 3300053139 | Ga0500568_0003074 | Ga0500568_0003074_8895_9392 | 165 |
| 701 | 3300053141 | Ga0500574_050480 | Ga0500574_050480_99_596 | 165 |
| 702 | 3300053161 | Ga0500634_0013938 | Ga0500634_0013938_2409_2906 | 165 |
| 703 | 3300053162 | Ga0500638_044950 | Ga0500638_044950_131_628 | 165 |
| 704 | 3300053177 | Ga0500636_0038384 | Ga0500636_0038384_2075_2572 | 165 |
| 705 | 3300053729 | Ga0500625_072935 | Ga0500625_072935_804_1310 | 165 |
| 706 | iso_pu_bacteria | 2738541277 | 2738721439 | 165 |
| 707 | iso_pu_bacteria | 2738541307 | 2738880794 | 165 |
| 708 | iso_pu_bacteria | 2738543019 | 2739281108 | 165 |
| 709 | iso_pu_bacteria | 2842718218 | 2842718430 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p81-assembly1.cif.gz_C | structure of ancestral pyrr protein (ancorangepyrr) | 0.8 | 4 | 163 |
| 1w30-assembly1.cif.gz_A-2 | pyrr of mycobacterium tuberculosis as a potential drug target | 0.7975 | 6 | 163 |
| 4p83-assembly1.cif.gz_C | structure of engineered pyrr protein (purple pyrr) | 0.7927 | 4 | 163 |
| 1ufr-assembly2.cif.gz_D | crystal structure of tt1027 from thermus thermophilus hb8 | 0.791 | 7 | 163 |
| 4p81-assembly1.cif.gz_A | structure of ancestral pyrr protein (ancorangepyrr) | 0.7893 | 1 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHK3_1_193_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8033 | 6 | 163 | 3.40.50.2020 |
| 4p83D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7692 | 2 | 163 | 3.40.50.2020 |
| af_P9WHK3_1_193_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7682 | 6 | 163 | 3.40.50.2020 |
| 3acdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7646 | 4 | 140 | 3.40.50.2020 |
| 1hgxB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.761 | 1 | 140 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554WYG7-F1-model_v4 | Bifunctional protein PyrR | 0.9765 | 1 | 164 |
|
| AF-A0A554WYG7-F1-model_v4 | Bifunctional protein PyrR | 0.9649 | 1 | 164 |
|
| AF-A0A1C9VN93-F1-model_v4 | deleted | 0.9514 | 3 | 165 |
|
| AF-A0A1L1PG86-F1-model_v4 | Phosphoribosyltransferase | 0.9513 | 3 | 163 |
GO:0016757
|
| AF-A0A1Y0ELK8-F1-model_v4 | Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase | 0.9502 | 4 | 163 |
GO:0016757
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar