F476620
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 708 | 361 | 1416 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300048903|Ga0496100_0122470|Ga0496100_0122470_430_1389 |
| Length | 319 |
| Sequence | VEYDSCGARRIVTGKFSLLLASPHVIGEYFPHDDASAAPVFQGAQRMLTQVAEGVLVHEGEFCQSNAVVVQGGTGVLLIDAGVHEDEMSCLVSDLSDLGQTVVAGFSTHPHWDHLLWHAGLGTVPRYGTARCAATARDRLSGGVDVVAKAAGIPEEVSLDLLGLITGLPAETTQIPWDGPGVRIMEHQAHAPGHAALLIEARGVLVAGDMLSDVLIPMLDLNSTGDPIEEYLTALRLLEGVAGDVDVVVPGHGSVGGADQVHARIDQDRAYVHALRDGNDPSDPRIGPSAKPGWEWVSDVHTGQLQRLRQRSRRDGTPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 189 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 219 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 220 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 221 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 224 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 225 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 226 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 227 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 228 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 229 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 230 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 231 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 339 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 340 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 342 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 343 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 347 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 348 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 349 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 350 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 351 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 352 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 353 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 354 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 355 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 356 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 357 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 358 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 359 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 360 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 361 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.46 |
| Metatranscriptomes | 0.42 |
| Isolates | 2.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.98 |
| Nodule | 0 |
| Rhizoplane | 13.28 |
| Rhizosphere | 77.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496100_0122470 | 3300048903 | Bacteria | 1821 |
| 2 | JGI24739J22299_10007843 | 3300001989 | Bacteria | 3995 |
| 3 | JGI24737J22298_10003414 | 3300001990 | Bacteria | 5616 |
| 4 | JGI24735J21928_10010174 | 3300002067 | Bacteria | 3005 |
| 5 | JGI24751J29686_10012395 | 3300002459 | Bacteria | 1759 |
| 6 | rootH2_10019715 | 3300003320 | Bacteria | 11636 |
| 7 | Ga0065714_10006584 | 3300005288 | Bacteria | 9420 |
| 8 | Ga0065707_10176597 | 3300005295 | Bacteria | 1446 |
| 9 | Ga0070658_10089387 | 3300005327 | Bacteria | 2536 |
| 10 | Ga0070683_100000313 | 3300005329 | Bacteria | 33426 |
| 11 | Ga0070683_100070343 | 3300005329 | Bacteria | 3264 |
| 12 | Ga0070683_100112323 | 3300005329 | Bacteria | 2571 |
| 13 | Ga0070690_100049252 | 3300005330 | Bacteria | 2685 |
| 14 | Ga0070670_100005308 | 3300005331 | Bacteria | 10867 |
| 15 | Ga0070670_100021022 | 3300005331 | Bacteria | 5611 |
| 16 | Ga0070670_100065139 | 3300005331 | Bacteria | 3126 |
| 17 | Ga0070670_100140260 | 3300005331 | Bacteria | 2090 |
| 18 | Ga0068869_100034678 | 3300005334 | Bacteria | 3571 |
| 19 | Ga0068869_100164576 | 3300005334 | Bacteria | 1729 |
| 20 | Ga0070680_100307577 | 3300005336 | Bacteria | 1344 |
| 21 | Ga0070680_100310672 | 3300005336 | Bacteria | 1337 |
| 22 | Ga0070682_100009629 | 3300005337 | Bacteria | 5470 |
| 23 | Ga0068868_100004094 | 3300005338 | Bacteria | 10184 |
| 24 | Ga0068868_100024754 | 3300005338 | Bacteria | 4557 |
| 25 | Ga0068868_100095605 | 3300005338 | Bacteria | 2398 |
| 26 | Ga0070660_100024632 | 3300005339 | Bacteria | 4465 |
| 27 | Ga0070691_10003538 | 3300005341 | Bacteria | 7045 |
| 28 | Ga0070691_10032404 | 3300005341 | Bacteria | 2455 |
| 29 | Ga0070661_100021853 | 3300005344 | Bacteria | 4576 |
| 30 | Ga0070661_100478175 | 3300005344 | Bacteria | 994 |
| 31 | Ga0070692_10004357 | 3300005345 | Bacteria | 5897 |
| 32 | Ga0070668_100554962 | 3300005347 | Bacteria | 1000 |
| 33 | Ga0070675_100007270 | 3300005354 | Bacteria | 8543 |
| 34 | Ga0070675_100078329 | 3300005354 | Bacteria | 2752 |
| 35 | Ga0070671_100006123 | 3300005355 | Bacteria | 9580 |
| 36 | Ga0070674_100027990 | 3300005356 | Bacteria | 3698 |
| 37 | Ga0070673_100065129 | 3300005364 | Bacteria | 2906 |
| 38 | Ga0070659_100010690 | 3300005366 | Bacteria | 6761 |
| 39 | Ga0070667_100335689 | 3300005367 | Bacteria | 1366 |
| 40 | Ga0070667_100568872 | 3300005367 | Bacteria | 1043 |
| 41 | Ga0070709_10000307 | 3300005434 | Bacteria | 31007 |
| 42 | Ga0070709_10003443 | 3300005434 | Bacteria | 8488 |
| 43 | Ga0070709_10005852 | 3300005434 | Bacteria | 6668 |
| 44 | Ga0070714_100304191 | 3300005435 | Bacteria | 1487 |
| 45 | Ga0070714_100384104 | 3300005435 | Bacteria | 1324 |
| 46 | Ga0070714_100448173 | 3300005435 | Bacteria | 1226 |
| 47 | Ga0070713_100104498 | 3300005436 | Bacteria | 2459 |
| 48 | Ga0070713_100289280 | 3300005436 | Bacteria | 1505 |
| 49 | Ga0070713_100339569 | 3300005436 | Bacteria | 1391 |
| 50 | Ga0070710_10030370 | 3300005437 | Bacteria | 2907 |
| 51 | Ga0070701_10115560 | 3300005438 | Bacteria | 1505 |
| 52 | Ga0070711_100004870 | 3300005439 | Bacteria | 7969 |
| 53 | Ga0070711_100024045 | 3300005439 | Bacteria | 3970 |
| 54 | Ga0070705_100021374 | 3300005440 | Bacteria | 3442 |
| 55 | Ga0070705_100324043 | 3300005440 | Bacteria | 1113 |
| 56 | Ga0070663_100043802 | 3300005455 | Bacteria | 3151 |
| 57 | Ga0070663_100045629 | 3300005455 | Bacteria | 3097 |
| 58 | Ga0070663_100245195 | 3300005455 | Bacteria | 1416 |
| 59 | Ga0070678_100008891 | 3300005456 | Bacteria | 6046 |
| 60 | Ga0070662_100136208 | 3300005457 | Bacteria | 1899 |
| 61 | Ga0070662_100190655 | 3300005457 | Bacteria | 1621 |
| 62 | Ga0070681_10019993 | 3300005458 | Bacteria | 6708 |
| 63 | Ga0070681_10088346 | 3300005458 | Bacteria | 3051 |
| 64 | Ga0070685_10011039 | 3300005466 | Bacteria | 4715 |
| 65 | Ga0070685_10088416 | 3300005466 | Bacteria | 1871 |
| 66 | Ga0070706_100009179 | 3300005467 | Bacteria | 9208 |
| 67 | Ga0070698_100015870 | 3300005471 | Bacteria | 7953 |
| 68 | Ga0070698_100211542 | 3300005471 | Bacteria | 1874 |
| 69 | Ga0070698_100285762 | 3300005471 | Bacteria | 1581 |
| 70 | Ga0070699_100133806 | 3300005518 | Bacteria | 2186 |
| 71 | Ga0070679_100137135 | 3300005530 | Bacteria | 2428 |
| 72 | Ga0070684_100100743 | 3300005535 | Bacteria | 2580 |
| 73 | Ga0070684_100355068 | 3300005535 | Bacteria | 1349 |
| 74 | Ga0068853_100243209 | 3300005539 | Bacteria | 1650 |
| 75 | Ga0070672_100053698 | 3300005543 | Bacteria | 3151 |
| 76 | Ga0070686_100031286 | 3300005544 | Bacteria | 3252 |
| 77 | Ga0070695_100362456 | 3300005545 | Bacteria | 1089 |
| 78 | Ga0070696_100039223 | 3300005546 | Bacteria | 3271 |
| 79 | Ga0070696_100047770 | 3300005546 | Bacteria | 2970 |
| 80 | Ga0070693_100001955 | 3300005547 | Bacteria | 9433 |
| 81 | Ga0070693_100015714 | 3300005547 | Bacteria | 3902 |
| 82 | Ga0070704_100116519 | 3300005549 | Bacteria | 2043 |
| 83 | Ga0070664_100003778 | 3300005564 | Bacteria | 12219 |
| 84 | Ga0070664_100019320 | 3300005564 | Bacteria | 5606 |
| 85 | Ga0070664_100078008 | 3300005564 | Bacteria | 2849 |
| 86 | Ga0070664_100149745 | 3300005564 | Bacteria | 2059 |
| 87 | Ga0068857_100020742 | 3300005577 | Bacteria | 5783 |
| 88 | Ga0068857_100030428 | 3300005577 | Bacteria | 4767 |
| 89 | Ga0068854_100203625 | 3300005578 | Bacteria | 1557 |
| 90 | Ga0068856_100026993 | 3300005614 | Bacteria | 5601 |
| 91 | Ga0068856_100118270 | 3300005614 | Bacteria | 2651 |
| 92 | Ga0068856_100540031 | 3300005614 | Bacteria | 1187 |
| 93 | Ga0070702_100000548 | 3300005615 | Bacteria | 13650 |
| 94 | Ga0070702_100007830 | 3300005615 | Bacteria | 5137 |
| 95 | Ga0070702_100293427 | 3300005615 | Bacteria | 1121 |
| 96 | Ga0068852_100022828 | 3300005616 | Bacteria | 5025 |
| 97 | Ga0068852_100248325 | 3300005616 | Bacteria | 1704 |
| 98 | Ga0068852_100475844 | 3300005616 | Bacteria | 1240 |
| 99 | Ga0068859_100091377 | 3300005617 | Bacteria | 3095 |
| 100 | Ga0068859_100097788 | 3300005617 | Bacteria | 2988 |
| 101 | Ga0068864_100009245 | 3300005618 | Bacteria | 8127 |
| 102 | Ga0068864_100343522 | 3300005618 | Bacteria | 1407 |
| 103 | Ga0068861_100077924 | 3300005719 | Bacteria | 2587 |
| 104 | Ga0068861_100283951 | 3300005719 | Bacteria | 1426 |
| 105 | Ga0068870_10022744 | 3300005840 | Bacteria | 3083 |
| 106 | Ga0068863_100032260 | 3300005841 | Bacteria | 4992 |
| 107 | Ga0068863_100370567 | 3300005841 | Bacteria | 1397 |
| 108 | Ga0068863_100378548 | 3300005841 | Bacteria | 1382 |
| 109 | Ga0068858_100023922 | 3300005842 | Bacteria | 5691 |
| 110 | Ga0068858_100045903 | 3300005842 | Bacteria | 4051 |
| 111 | Ga0068858_100314607 | 3300005842 | Bacteria | 1495 |
| 112 | Ga0068860_100264453 | 3300005843 | Bacteria | 1677 |
| 113 | Ga0068860_100287108 | 3300005843 | Bacteria | 1609 |
| 114 | Ga0068862_100043417 | 3300005844 | Bacteria | 3833 |
| 115 | Ga0068862_100141340 | 3300005844 | Bacteria | 2137 |
| 116 | Ga0081455_10202155 | 3300005937 | Bacteria | 1487 |
| 117 | Ga0081455_10231002 | 3300005937 | Bacteria | 1365 |
| 118 | Ga0081538_10002596 | 3300005981 | Bacteria | 17528 |
| 119 | Ga0081538_10026602 | 3300005981 | Bacteria | 4041 |
| 120 | Ga0081540_1000388 | 3300005983 | Bacteria | 44164 |
| 121 | Ga0081540_1053439 | 3300005983 | Bacteria | 1981 |
| 122 | Ga0070717_10085061 | 3300006028 | Bacteria | 2661 |
| 123 | Ga0070717_10086829 | 3300006028 | Bacteria | 2634 |
| 124 | Ga0070717_10122872 | 3300006028 | Bacteria | 2226 |
| 125 | Ga0075365_10081941 | 3300006038 | Bacteria | 2187 |
| 126 | Ga0075363_100003308 | 3300006048 | Bacteria | 6828 |
| 127 | Ga0075432_10067699 | 3300006058 | Bacteria | 1279 |
| 128 | Ga0070715_10025741 | 3300006163 | Bacteria | 2334 |
| 129 | Ga0070716_100002016 | 3300006173 | Bacteria | 9280 |
| 130 | Ga0070716_100037994 | 3300006173 | Bacteria | 2663 |
| 131 | Ga0070716_100057593 | 3300006173 | Bacteria | 2233 |
| 132 | Ga0070712_100026189 | 3300006175 | Bacteria | 3883 |
| 133 | Ga0070712_100234513 | 3300006175 | Bacteria | 1459 |
| 134 | Ga0075367_10000964 | 3300006178 | Bacteria | 11746 |
| 135 | Ga0075369_10034275 | 3300006186 | Bacteria | 2154 |
| 136 | Ga0075427_10005411 | 3300006194 | Bacteria | 1819 |
| 137 | Ga0068871_100662678 | 3300006358 | Bacteria | 953 |
| 138 | Ga0075428_100000033 | 3300006844 | Bacteria | 117013 |
| 139 | Ga0075428_100183595 | 3300006844 | Bacteria | 2263 |
| 140 | Ga0075428_100193330 | 3300006844 | Bacteria | 2200 |
| 141 | Ga0075428_100432160 | 3300006844 | Bacteria | 1411 |
| 142 | Ga0075430_100079322 | 3300006846 | Bacteria | 2751 |
| 143 | Ga0075430_100313366 | 3300006846 | Bacteria | 1297 |
| 144 | Ga0075431_100147138 | 3300006847 | Bacteria | 2427 |
| 145 | Ga0075433_10010992 | 3300006852 | Bacteria | 7279 |
| 146 | Ga0075433_10380806 | 3300006852 | Bacteria | 1245 |
| 147 | Ga0075434_100002248 | 3300006871 | Bacteria | 16884 |
| 148 | Ga0075434_100069332 | 3300006871 | Bacteria | 3516 |
| 149 | Ga0075434_100141322 | 3300006871 | Bacteria | 2427 |
| 150 | Ga0075429_100170007 | 3300006880 | Bacteria | 1909 |
| 151 | Ga0068865_100054942 | 3300006881 | Bacteria | 2770 |
| 152 | Ga0097620_100091373 | 3300006931 | Bacteria | 3095 |
| 153 | Ga0097620_100097784 | 3300006931 | Bacteria | 2988 |
| 154 | Ga0075435_100169507 | 3300007076 | Bacteria | 1841 |
| 155 | Ga0075435_100403063 | 3300007076 | Bacteria | 1176 |
| 156 | Ga0105251_10030940 | 3300009011 | Bacteria | 2682 |
| 157 | Ga0105244_10028836 | 3300009036 | Bacteria | 2973 |
| 158 | Ga0105244_10154262 | 3300009036 | Bacteria | 1099 |
| 159 | Ga0111539_10075968 | 3300009094 | Bacteria | 3956 |
| 160 | Ga0111539_10080144 | 3300009094 | Bacteria | 3841 |
| 161 | Ga0111539_10085361 | 3300009094 | Bacteria | 3711 |
| 162 | Ga0105245_10017437 | 3300009098 | Bacteria | 6264 |
| 163 | Ga0105245_10098217 | 3300009098 | Bacteria | 2706 |
| 164 | Ga0105245_10100231 | 3300009098 | Bacteria | 2679 |
| 165 | Ga0105245_10175421 | 3300009098 | Bacteria | 2044 |
| 166 | Ga0114129_10005665 | 3300009147 | Bacteria | 17680 |
| 167 | Ga0114129_10029741 | 3300009147 | Bacteria | 7736 |
| 168 | Ga0114129_10152545 | 3300009147 | Bacteria | 3161 |
| 169 | Ga0105243_10142673 | 3300009148 | Bacteria | 2045 |
| 170 | Ga0105241_10001817 | 3300009174 | Bacteria | 16199 |
| 171 | Ga0105241_10113411 | 3300009174 | Bacteria | 2173 |
| 172 | Ga0105242_10374892 | 3300009176 | Bacteria | 1321 |
| 173 | Ga0105248_10059203 | 3300009177 | Bacteria | 4302 |
| 174 | Ga0105248_10077678 | 3300009177 | Bacteria | 3732 |
| 175 | Ga0105248_10255376 | 3300009177 | Bacteria | 1973 |
| 176 | Ga0105248_10788206 | 3300009177 | Bacteria | 1073 |
| 177 | Ga0105237_10346299 | 3300009545 | Bacteria | 1490 |
| 178 | Ga0105237_10364368 | 3300009545 | Bacteria | 1450 |
| 179 | Ga0105238_10063862 | 3300009551 | Bacteria | 3683 |
| 180 | Ga0105238_10569975 | 3300009551 | Bacteria | 1138 |
| 181 | Ga0105249_10014161 | 3300009553 | Bacteria | 7049 |
| 182 | Ga0105249_10704939 | 3300009553 | Bacteria | 1070 |
| 183 | Ga0105239_10103682 | 3300010375 | Bacteria | 3148 |
| 184 | Ga0105239_10393285 | 3300010375 | Bacteria | 1568 |
| 185 | Ga0157373_10068007 | 3300013100 | Bacteria | 2519 |
| 186 | Ga0157371_10025184 | 3300013102 | Bacteria | 4338 |
| 187 | Ga0157371_10059476 | 3300013102 | Bacteria | 2709 |
| 188 | Ga0157370_10056966 | 3300013104 | Bacteria | 3718 |
| 189 | Ga0157370_10079693 | 3300013104 | Bacteria | 3084 |
| 190 | Ga0157370_10381388 | 3300013104 | Bacteria | 1298 |
| 191 | Ga0157369_10018594 | 3300013105 | Bacteria | 7790 |
| 192 | Ga0157369_10106246 | 3300013105 | Bacteria | 2988 |
| 193 | Ga0171462_1005 | 3300013250 | Bacteria | 598379 |
| 194 | Ga0157378_10027948 | 3300013297 | Bacteria | 4974 |
| 195 | Ga0157378_10055912 | 3300013297 | Bacteria | 3516 |
| 196 | Ga0163162_10090693 | 3300013306 | Bacteria | 3138 |
| 197 | Ga0163162_10100553 | 3300013306 | Bacteria | 2983 |
| 198 | Ga0163162_10183070 | 3300013306 | Bacteria | 2221 |
| 199 | Ga0163162_10245998 | 3300013306 | Bacteria | 1920 |
| 200 | Ga0163162_10294665 | 3300013306 | Bacteria | 1754 |
| 201 | Ga0157372_10152217 | 3300013307 | Bacteria | 2670 |
| 202 | Ga0157372_10401714 | 3300013307 | Bacteria | 1597 |
| 203 | Ga0157375_10027075 | 3300013308 | Bacteria | 5355 |
| 204 | Ga0157375_10040372 | 3300013308 | Bacteria | 4498 |
| 205 | Ga0157375_10616164 | 3300013308 | Bacteria | 1244 |
| 206 | Ga0163163_10008903 | 3300014325 | Bacteria | 8939 |
| 207 | Ga0163163_10021138 | 3300014325 | Bacteria | 6139 |
| 208 | Ga0163163_10236417 | 3300014325 | Bacteria | 1876 |
| 209 | Ga0157380_10022330 | 3300014326 | Bacteria | 4761 |
| 210 | Ga0157380_10354357 | 3300014326 | Bacteria | 1374 |
| 211 | Ga0182008_10099630 | 3300014497 | Bacteria | 1435 |
| 212 | Ga0157377_10009310 | 3300014745 | Bacteria | 4812 |
| 213 | Ga0157377_10209348 | 3300014745 | Bacteria | 1242 |
| 214 | Ga0157379_10024850 | 3300014968 | Bacteria | 5318 |
| 215 | Ga0157379_10377327 | 3300014968 | Bacteria | 1301 |
| 216 | Ga0163161_10185230 | 3300017792 | Bacteria | 1598 |
| 217 | Ga0206353_10500331 | 3300020082 | Bacteria | 1789 |
| 218 | Ga0206353_10706765 | 3300020082 | Bacteria | 3535 |
| 219 | Ga0213874_10007046 | 3300021377 | Bacteria | 2684 |
| 220 | Ga0213876_10018724 | 3300021384 | Bacteria | 3657 |
| 221 | Ga0213876_10129368 | 3300021384 | Bacteria | 1342 |
| 222 | Ga0213875_10012883 | 3300021388 | Bacteria | 4120 |
| 223 | Ga0213875_10120326 | 3300021388 | Bacteria | 1227 |
| 224 | Ga0213875_10135498 | 3300021388 | Bacteria | 1152 |
| 225 | Ga0207697_10008982 | 3300025315 | Bacteria | 4337 |
| 226 | Ga0207692_10000173 | 3300025898 | Bacteria | 20587 |
| 227 | Ga0207692_10007493 | 3300025898 | Bacteria | 4475 |
| 228 | Ga0207688_10008173 | 3300025901 | Bacteria | 5687 |
| 229 | Ga0207647_10016019 | 3300025904 | Bacteria | 5125 |
| 230 | Ga0207685_10056466 | 3300025905 | Bacteria | 1537 |
| 231 | Ga0207685_10058991 | 3300025905 | Bacteria | 1512 |
| 232 | Ga0207699_10000797 | 3300025906 | Bacteria | 15052 |
| 233 | Ga0207699_10001935 | 3300025906 | Bacteria | 9753 |
| 234 | Ga0207699_10006926 | 3300025906 | Bacteria | 5517 |
| 235 | Ga0207699_10031599 | 3300025906 | Bacteria | 2974 |
| 236 | Ga0207699_10127634 | 3300025906 | Bacteria | 1654 |
| 237 | Ga0207699_10203841 | 3300025906 | Bacteria | 1342 |
| 238 | Ga0207645_10011866 | 3300025907 | Bacteria | 5930 |
| 239 | Ga0207645_10033795 | 3300025907 | Bacteria | 3286 |
| 240 | Ga0207643_10000305 | 3300025908 | Bacteria | 33889 |
| 241 | Ga0207643_10006751 | 3300025908 | Bacteria | 6156 |
| 242 | Ga0207643_10103727 | 3300025908 | Bacteria | 1669 |
| 243 | Ga0207684_10000277 | 3300025910 | Bacteria | 75289 |
| 244 | Ga0207654_10035467 | 3300025911 | Bacteria | 2780 |
| 245 | Ga0207707_10029920 | 3300025912 | Bacteria | 4762 |
| 246 | Ga0207693_10038622 | 3300025915 | Bacteria | 3758 |
| 247 | Ga0207693_10061460 | 3300025915 | Bacteria | 2942 |
| 248 | Ga0207693_10343326 | 3300025915 | Bacteria | 1169 |
| 249 | Ga0207663_10007434 | 3300025916 | Bacteria | 5680 |
| 250 | Ga0207663_10029418 | 3300025916 | Bacteria | 3226 |
| 251 | Ga0207660_10018767 | 3300025917 | Bacteria | 4616 |
| 252 | Ga0207660_10549844 | 3300025917 | Bacteria | 939 |
| 253 | Ga0207662_10009513 | 3300025918 | Bacteria | 5353 |
| 254 | Ga0207657_10023629 | 3300025919 | Bacteria | 5719 |
| 255 | Ga0207657_10414084 | 3300025919 | Bacteria | 1060 |
| 256 | Ga0207649_10112750 | 3300025920 | Bacteria | 1820 |
| 257 | Ga0207652_10151402 | 3300025921 | Bacteria | 2077 |
| 258 | Ga0207681_10071447 | 3300025923 | Bacteria | 2421 |
| 259 | Ga0207694_10028304 | 3300025924 | Bacteria | 4272 |
| 260 | Ga0207694_10213303 | 3300025924 | Bacteria | 1573 |
| 261 | Ga0207650_10099801 | 3300025925 | Bacteria | 2233 |
| 262 | Ga0207650_10140514 | 3300025925 | Bacteria | 1898 |
| 263 | Ga0207659_10015468 | 3300025926 | Bacteria | 4945 |
| 264 | Ga0207659_10030819 | 3300025926 | Bacteria | 3667 |
| 265 | Ga0207659_10080850 | 3300025926 | Bacteria | 2401 |
| 266 | Ga0207687_10010202 | 3300025927 | Bacteria | 6138 |
| 267 | Ga0207687_10109387 | 3300025927 | Bacteria | 2048 |
| 268 | Ga0207687_10130251 | 3300025927 | Bacteria | 1895 |
| 269 | Ga0207687_10206414 | 3300025927 | Bacteria | 1539 |
| 270 | Ga0207687_10257179 | 3300025927 | Bacteria | 1391 |
| 271 | Ga0207700_10000291 | 3300025928 | Bacteria | 29714 |
| 272 | Ga0207700_10004416 | 3300025928 | Bacteria | 8291 |
| 273 | Ga0207700_10014266 | 3300025928 | Bacteria | 5200 |
| 274 | Ga0207700_10085395 | 3300025928 | Bacteria | 2477 |
| 275 | Ga0207700_10114600 | 3300025928 | Bacteria | 2175 |
| 276 | Ga0207700_10489975 | 3300025928 | Bacteria | 1087 |
| 277 | Ga0207700_10535690 | 3300025928 | Bacteria | 1038 |
| 278 | Ga0207664_10000163 | 3300025929 | Bacteria | 53290 |
| 279 | Ga0207664_10001490 | 3300025929 | Bacteria | 15333 |
| 280 | Ga0207664_10002073 | 3300025929 | Bacteria | 13192 |
| 281 | Ga0207664_10022162 | 3300025929 | Bacteria | 4738 |
| 282 | Ga0207664_10042160 | 3300025929 | Bacteria | 3561 |
| 283 | Ga0207664_10060660 | 3300025929 | Bacteria | 3015 |
| 284 | Ga0207664_10089294 | 3300025929 | Bacteria | 2523 |
| 285 | Ga0207664_10205139 | 3300025929 | Bacteria | 1703 |
| 286 | Ga0207644_10102464 | 3300025931 | Bacteria | 2153 |
| 287 | Ga0207690_10050805 | 3300025932 | Bacteria | 2769 |
| 288 | Ga0207690_10170916 | 3300025932 | Bacteria | 1628 |
| 289 | Ga0207706_10005899 | 3300025933 | Bacteria | 11395 |
| 290 | Ga0207706_10029243 | 3300025933 | Bacteria | 4919 |
| 291 | Ga0207706_10128715 | 3300025933 | Bacteria | 2226 |
| 292 | Ga0207686_10016771 | 3300025934 | Bacteria | 4114 |
| 293 | Ga0207709_10030391 | 3300025935 | Bacteria | 3142 |
| 294 | Ga0207670_10510578 | 3300025936 | Bacteria | 977 |
| 295 | Ga0207669_10034498 | 3300025937 | Bacteria | 2868 |
| 296 | Ga0207665_10002384 | 3300025939 | Bacteria | 12690 |
| 297 | Ga0207665_10002492 | 3300025939 | Bacteria | 12398 |
| 298 | Ga0207665_10020348 | 3300025939 | Bacteria | 4359 |
| 299 | Ga0207665_10022374 | 3300025939 | Bacteria | 4158 |
| 300 | Ga0207665_10043263 | 3300025939 | Bacteria | 3011 |
| 301 | Ga0207691_10033146 | 3300025940 | Bacteria | 4810 |
| 302 | Ga0207711_10537848 | 3300025941 | Bacteria | 1090 |
| 303 | Ga0207689_10001317 | 3300025942 | Bacteria | 23923 |
| 304 | Ga0207689_10034763 | 3300025942 | Bacteria | 4185 |
| 305 | Ga0207689_10116399 | 3300025942 | Bacteria | 2197 |
| 306 | Ga0207661_10002641 | 3300025944 | Bacteria | 12338 |
| 307 | Ga0207661_10031208 | 3300025944 | Bacteria | 4112 |
| 308 | Ga0207661_10032701 | 3300025944 | Bacteria | 4033 |
| 309 | Ga0207661_10107734 | 3300025944 | Bacteria | 2351 |
| 310 | Ga0207661_10262017 | 3300025944 | Bacteria | 1540 |
| 311 | Ga0207679_10017890 | 3300025945 | Bacteria | 4737 |
| 312 | Ga0207651_10209660 | 3300025960 | Bacteria | 1567 |
| 313 | Ga0207712_10040819 | 3300025961 | Bacteria | 3187 |
| 314 | Ga0207668_10002527 | 3300025972 | Bacteria | 10679 |
| 315 | Ga0207640_10039825 | 3300025981 | Bacteria | 2977 |
| 316 | Ga0207640_10211501 | 3300025981 | Bacteria | 1478 |
| 317 | Ga0207658_10151172 | 3300025986 | Bacteria | 1892 |
| 318 | Ga0207658_10415515 | 3300025986 | Bacteria | 1185 |
| 319 | Ga0207677_10236080 | 3300026023 | Bacteria | 1476 |
| 320 | Ga0207703_10020395 | 3300026035 | Bacteria | 5183 |
| 321 | Ga0207703_10036897 | 3300026035 | Bacteria | 3892 |
| 322 | Ga0207639_10034833 | 3300026041 | Bacteria | 3723 |
| 323 | Ga0207678_10000358 | 3300026067 | Bacteria | 41445 |
| 324 | Ga0207678_10008685 | 3300026067 | Bacteria | 8947 |
| 325 | Ga0207678_10009934 | 3300026067 | Bacteria | 8349 |
| 326 | Ga0207678_10031941 | 3300026067 | Bacteria | 4591 |
| 327 | Ga0207708_10008132 | 3300026075 | Bacteria | 7768 |
| 328 | Ga0207708_10013125 | 3300026075 | Bacteria | 6182 |
| 329 | Ga0207702_10004745 | 3300026078 | Bacteria | 12001 |
| 330 | Ga0207702_10044213 | 3300026078 | Bacteria | 3743 |
| 331 | Ga0207702_10083479 | 3300026078 | Bacteria | 2780 |
| 332 | Ga0207702_10501722 | 3300026078 | Bacteria | 1183 |
| 333 | Ga0207641_10228648 | 3300026088 | Bacteria | 1728 |
| 334 | Ga0207648_10011128 | 3300026089 | Bacteria | 8487 |
| 335 | Ga0207676_10012531 | 3300026095 | Bacteria | 6078 |
| 336 | Ga0207676_10030258 | 3300026095 | Bacteria | 4062 |
| 337 | Ga0207676_10092903 | 3300026095 | Bacteria | 2483 |
| 338 | Ga0207676_10256654 | 3300026095 | Bacteria | 1576 |
| 339 | Ga0207674_10009714 | 3300026116 | Bacteria | 10965 |
| 340 | Ga0207674_10031484 | 3300026116 | Bacteria | 5573 |
| 341 | Ga0207674_10041825 | 3300026116 | Bacteria | 4737 |
| 342 | Ga0207674_10074397 | 3300026116 | Bacteria | 3409 |
| 343 | Ga0207674_10279878 | 3300026116 | Bacteria | 1616 |
| 344 | Ga0207675_100038014 | 3300026118 | Bacteria | 4492 |
| 345 | Ga0207683_10001089 | 3300026121 | Bacteria | 24711 |
| 346 | Ga0207683_10008621 | 3300026121 | Bacteria | 8720 |
| 347 | Ga0207683_10359591 | 3300026121 | Bacteria | 1337 |
| 348 | Ga0207698_10365564 | 3300026142 | Bacteria | 1368 |
| 349 | Ga0207698_10423016 | 3300026142 | Bacteria | 1279 |
| 350 | Ga0207428_10202907 | 3300027907 | Bacteria | 1492 |
| 351 | Ga0207428_10279088 | 3300027907 | Bacteria | 1241 |
| 352 | Ga0268266_10035731 | 3300028379 | Bacteria | 4226 |
| 353 | Ga0268265_10015028 | 3300028380 | Bacteria | 5287 |
| 354 | Ga0268265_10108723 | 3300028380 | Bacteria | 2258 |
| 355 | Ga0268265_10434399 | 3300028380 | Bacteria | 1222 |
| 356 | Ga0268264_10250894 | 3300028381 | Bacteria | 1644 |
| 357 | Ga0307517_10034777 | 3300028786 | Bacteria | 5725 |
| 358 | Ga0307515_10007887 | 3300028794 | Bacteria | 20917 |
| 359 | Ga0307515_10022147 | 3300028794 | Bacteria | 11215 |
| 360 | Ga0307515_10036776 | 3300028794 | Bacteria | 7905 |
| 361 | Ga0307515_10081912 | 3300028794 | Bacteria | 4183 |
| 362 | Ga0307515_10150618 | 3300028794 | Bacteria | 2434 |
| 363 | Ga0307512_10007480 | 3300030522 | Bacteria | 10819 |
| 364 | Ga0265760_10004737 | 3300031090 | Bacteria | 3896 |
| 365 | Ga0307513_10005045 | 3300031456 | Bacteria | 17485 |
| 366 | Ga0307513_10006497 | 3300031456 | Bacteria | 15271 |
| 367 | Ga0307509_10084698 | 3300031507 | Bacteria | 3265 |
| 368 | Ga0307408_100007843 | 3300031548 | Bacteria | 7056 |
| 369 | Ga0307508_10004754 | 3300031616 | Bacteria | 13127 |
| 370 | Ga0307508_10042708 | 3300031616 | Bacteria | 4065 |
| 371 | Ga0307508_10136760 | 3300031616 | Bacteria | 2054 |
| 372 | Ga0307514_10221596 | 3300031649 | Bacteria | 1159 |
| 373 | Ga0307413_10081593 | 3300031824 | Bacteria | 2074 |
| 374 | Ga0307413_10152266 | 3300031824 | Bacteria | 1613 |
| 375 | Ga0307410_10027752 | 3300031852 | Bacteria | 3580 |
| 376 | Ga0307406_10037061 | 3300031901 | Bacteria | 3009 |
| 377 | Ga0307407_10245123 | 3300031903 | Bacteria | 1225 |
| 378 | Ga0307407_10254332 | 3300031903 | Bacteria | 1205 |
| 379 | Ga0307412_10426405 | 3300031911 | Bacteria | 1086 |
| 380 | Ga0307409_100431466 | 3300031995 | Bacteria | 1267 |
| 381 | Ga0307416_100069288 | 3300032002 | Bacteria | 2918 |
| 382 | Ga0307416_100202675 | 3300032002 | Bacteria | 1884 |
| 383 | Ga0307416_100290375 | 3300032002 | Bacteria | 1618 |
| 384 | Ga0307414_10227026 | 3300032004 | Bacteria | 1537 |
| 385 | Ga0307415_100004146 | 3300032126 | Bacteria | 7474 |
| 386 | Ga0307415_100137748 | 3300032126 | Bacteria | 1859 |
| 387 | Ga0307415_100204076 | 3300032126 | Bacteria | 1571 |
| 388 | Ga0307415_100379162 | 3300032126 | Bacteria | 1200 |
| 389 | Ga0307510_10078582 | 3300033180 | Bacteria | 3226 |
| 390 | Ga0307510_10092277 | 3300033180 | Bacteria | 2865 |
| 391 | Ga0316214_1000810 | 3300033545 | Bacteria | 3397 |
| 392 | Ga0373934_0133395 | 3300035086 | Bacteria | 1013 |
| 393 | Ga0373951_0000078 | 3300035091 | Bacteria | 38645 |
| 394 | Ga0373956_0133229 | 3300035119 | Bacteria | 1164 |
| 395 | Ga0373957_0043275 | 3300035120 | Bacteria | 1701 |
| 396 | Ga0373955_0128473 | 3300035172 | Bacteria | 1478 |
| 397 | Ga0373955_0132207 | 3300035172 | Bacteria | 1457 |
| 398 | Ga0373931_0021738 | 3300035691 | Bacteria | 3221 |
| 399 | Ga0373935_0268574 | 3300035692 | Bacteria | 1198 |
| 400 | Ga0373937_0152177 | 3300036401 | Bacteria | 2167 |
| 401 | Ga0373937_0203681 | 3300036401 | Bacteria | 1860 |
| 402 | Ga0373937_0207623 | 3300036401 | Bacteria | 1842 |
| 403 | Ga0373937_0341311 | 3300036401 | Bacteria | 1418 |
| 404 | Ga0373925_0000231 | 3300037068 | Bacteria | 59007 |
| 405 | Ga0395900_0222733 | 3300037418 | Bacteria | 1900 |
| 406 | Ga0395898_0108192 | 3300037466 | Bacteria | 2666 |
| 407 | Ga0395905_0327037 | 3300037471 | Bacteria | 1423 |
| 408 | Ga0395905_0472863 | 3300037471 | Bacteria | 1152 |
| 409 | Ga0436364_0143437 | 3300037853 | Bacteria | 9726 |
| 410 | Ga0436364_0229754 | 3300037853 | Bacteria | 1892 |
| 411 | Ga0436364_1220186 | 3300037853 | Bacteria | 4805 |
| 412 | Ga0395901_0208855 | 3300038443 | Bacteria | 2044 |
| 413 | Ga0395901_0433488 | 3300038443 | Bacteria | 1346 |
| 414 | Ga0436365_0240611 | 3300039437 | Bacteria | 2269 |
| 415 | Ga0436365_0321896 | 3300039437 | Bacteria | 4318 |
| 416 | Ga0436361_0305136 | 3300039447 | Bacteria | 1894 |
| 417 | Ga0436363_0393857 | 3300039450 | Bacteria | 1497 |
| 418 | Ga0436362_0526440 | 3300039453 | Bacteria | 1177 |
| 419 | Ga0451833_0368536 | 3300041491 | Bacteria | 879 |
| 420 | Ga0451837_1620174 | 3300041494 | Bacteria | 956 |
| 421 | Ga0451843_1564856 | 3300041509 | Bacteria | 1044 |
| 422 | Ga0451853_0346248 | 3300041512 | Bacteria | 1315 |
| 423 | Ga0451853_0480461 | 3300041512 | Bacteria | 2514 |
| 424 | Ga0439448_0020025 | 3300042005 | Bacteria | 2066 |
| 425 | Ga0439450_047104 | 3300042008 | Bacteria | 1015 |
| 426 | Ga0439455_0022564 | 3300042012 | Bacteria | 1509 |
| 427 | Ga0439463_001418 | 3300042016 | Bacteria | 6357 |
| 428 | Ga0439463_005247 | 3300042016 | Bacteria | 3221 |
| 429 | Ga0439463_011585 | 3300042016 | Bacteria | 2164 |
| 430 | Ga0439463_033769 | 3300042016 | Bacteria | 1294 |
| 431 | Ga0450902_015058 | 3300042137 | Bacteria | 1253 |
| 432 | Ga0450905_013198 | 3300042142 | Bacteria | 1169 |
| 433 | Ga0439464_0037701 | 3300042439 | Bacteria | 1371 |
| 434 | Ga0439460_0023652 | 3300042461 | Bacteria | 1696 |
| 435 | Ga0439460_0031448 | 3300042461 | Bacteria | 1514 |
| 436 | Ga0450916_000064 | 3300042530 | Bacteria | 6323 |
| 437 | Ga0450916_005535 | 3300042530 | Bacteria | 1464 |
| 438 | Ga0466967_0017594 | 3300045976 | Bacteria | 5682 |
| 439 | Ga0466967_0116322 | 3300045976 | Bacteria | 2463 |
| 440 | Ga0495638_0162016 | 3300046460 | Bacteria | 1290 |
| 441 | Ga0495651_0028022 | 3300046462 | Bacteria | 4390 |
| 442 | Ga0495653_0144857 | 3300046463 | Bacteria | 1666 |
| 443 | Ga0495653_0285079 | 3300046463 | Bacteria | 1082 |
| 444 | Ga0495580_0096817 | 3300046472 | Bacteria | 2052 |
| 445 | Ga0495582_0037598 | 3300046473 | Bacteria | 2662 |
| 446 | Ga0495639_0008150 | 3300046475 | Bacteria | 4499 |
| 447 | Ga0495664_0033174 | 3300046477 | Bacteria | 3034 |
| 448 | Ga0495594_0073842 | 3300046499 | Bacteria | 1899 |
| 449 | Ga0495608_0047648 | 3300046511 | Bacteria | 2848 |
| 450 | Ga0495608_0177787 | 3300046511 | Bacteria | 1347 |
| 451 | Ga0495608_0191685 | 3300046511 | Bacteria | 1290 |
| 452 | Ga0495618_0084632 | 3300046514 | Bacteria | 2026 |
| 453 | Ga0495618_0094058 | 3300046514 | Bacteria | 1916 |
| 454 | Ga0495618_0246984 | 3300046514 | Bacteria | 1120 |
| 455 | Ga0495628_0063970 | 3300046516 | Bacteria | 2881 |
| 456 | Ga0495628_0125845 | 3300046516 | Bacteria | 1963 |
| 457 | Ga0495630_0166656 | 3300046517 | Bacteria | 1677 |
| 458 | Ga0495632_0058282 | 3300046519 | Bacteria | 1883 |
| 459 | Ga0495665_0022257 | 3300046531 | Bacteria | 3407 |
| 460 | Ga0495640_0369397 | 3300046533 | Bacteria | 883 |
| 461 | Ga0495586_0010200 | 3300046535 | Bacteria | 4997 |
| 462 | Ga0495587_0038694 | 3300046536 | Bacteria | 2858 |
| 463 | Ga0495645_0057603 | 3300046543 | Bacteria | 2820 |
| 464 | Ga0495645_0079339 | 3300046543 | Bacteria | 2358 |
| 465 | Ga0495633_0077764 | 3300046558 | Bacteria | 1545 |
| 466 | Ga0495667_0044153 | 3300046559 | Bacteria | 2952 |
| 467 | Ga0495667_0044584 | 3300046559 | Bacteria | 2937 |
| 468 | Ga0495667_0169615 | 3300046559 | Bacteria | 1402 |
| 469 | Ga0495656_0032689 | 3300046615 | Bacteria | 2119 |
| 470 | Ga0495635_0218202 | 3300046663 | Bacteria | 1290 |
| 471 | Ga0495635_0345284 | 3300046663 | Bacteria | 993 |
| 472 | Ga0495588_0014609 | 3300046674 | Bacteria | 3761 |
| 473 | Ga0495588_0018483 | 3300046674 | Bacteria | 3399 |
| 474 | Ga0495657_0086939 | 3300046675 | Bacteria | 2012 |
| 475 | Ga0495599_0055514 | 3300046678 | Bacteria | 2480 |
| 476 | Ga0495623_0035637 | 3300046679 | Bacteria | 3189 |
| 477 | Ga0495647_0046421 | 3300046681 | Bacteria | 1673 |
| 478 | Ga0495624_0494110 | 3300046690 | Bacteria | 732 |
| 479 | Ga0495600_0079593 | 3300046809 | Bacteria | 2139 |
| 480 | Ga0495581_0011875 | 3300047315 | Bacteria | 5040 |
| 481 | Ga0495636_0090715 | 3300047318 | Bacteria | 1326 |
| 482 | Ga0495674_0025323 | 3300047319 | Bacteria | 5441 |
| 483 | Ga0495674_0059161 | 3300047319 | Bacteria | 3347 |
| 484 | Ga0495672_0009893 | 3300047320 | Bacteria | 6852 |
| 485 | Ga0495680_0010512 | 3300047322 | Bacteria | 8259 |
| 486 | Ga0495677_0072977 | 3300047445 | Bacteria | 1280 |
| 487 | Ga0495684_0078933 | 3300047471 | Bacteria | 2498 |
| 488 | Ga0495684_0312145 | 3300047471 | Bacteria | 1126 |
| 489 | Ga0495602_0137226 | 3300048088 | Bacteria | 1941 |
| 490 | Ga0495602_0216178 | 3300048088 | Bacteria | 1450 |
| 491 | Ga0496100_0027053 | 3300048903 | Bacteria | 3522 |
| 492 | Ga0496100_0035074 | 3300048903 | Bacteria | 3153 |
| 493 | Ga0496100_0065742 | 3300048903 | Bacteria | 2404 |
| 494 | Ga0496100_0166149 | 3300048903 | Bacteria | 1585 |
| 495 | Ga0496100_0284555 | 3300048903 | Bacteria | 1233 |
| 496 | Ga0496101_0036954 | 3300048904 | Bacteria | 3461 |
| 497 | Ga0496101_0042810 | 3300048904 | Bacteria | 3233 |
| 498 | Ga0496101_0061044 | 3300048904 | Bacteria | 2736 |
| 499 | Ga0496101_0589316 | 3300048904 | Bacteria | 879 |
| 500 | Ga0496102_0028138 | 3300048905 | Bacteria | 5022 |
| 501 | Ga0496102_0046379 | 3300048905 | Bacteria | 3947 |
| 502 | Ga0496102_0111680 | 3300048905 | Bacteria | 2548 |
| 503 | Ga0496102_0131213 | 3300048905 | Bacteria | 2345 |
| 504 | Ga0496102_0185069 | 3300048905 | Bacteria | 1963 |
| 505 | Ga0496102_0214854 | 3300048905 | Bacteria | 1812 |
| 506 | Ga0496102_0303612 | 3300048905 | Bacteria | 1504 |
| 507 | Ga0496102_0394511 | 3300048905 | Bacteria | 1301 |
| 508 | Ga0496102_0439964 | 3300048905 | Bacteria | 1223 |
| 509 | Ga0496103_0002948 | 3300048906 | Bacteria | 10547 |
| 510 | Ga0496103_0018416 | 3300048906 | Bacteria | 4189 |
| 511 | Ga0496103_0048356 | 3300048906 | Bacteria | 2628 |
| 512 | Ga0496103_0138532 | 3300048906 | Bacteria | 1555 |
| 513 | Ga0496104_0011401 | 3300048907 | Bacteria | 7958 |
| 514 | Ga0496104_0014720 | 3300048907 | Bacteria | 7069 |
| 515 | Ga0496104_0239871 | 3300048907 | Bacteria | 1725 |
| 516 | Ga0496104_0272466 | 3300048907 | Bacteria | 1605 |
| 517 | Ga0496104_0277598 | 3300048907 | Bacteria | 1588 |
| 518 | Ga0496105_0003750 | 3300048908 | Bacteria | 11324 |
| 519 | Ga0496105_0011989 | 3300048908 | Bacteria | 6863 |
| 520 | Ga0496105_0014965 | 3300048908 | Bacteria | 6175 |
| 521 | Ga0496105_0041384 | 3300048908 | Bacteria | 3797 |
| 522 | Ga0496105_0075158 | 3300048908 | Bacteria | 2790 |
| 523 | Ga0496106_0029050 | 3300048909 | Bacteria | 4120 |
| 524 | Ga0496106_0032466 | 3300048909 | Bacteria | 3892 |
| 525 | Ga0496106_0095253 | 3300048909 | Bacteria | 2302 |
| 526 | Ga0496106_0109180 | 3300048909 | Bacteria | 2152 |
| 527 | Ga0496106_0406935 | 3300048909 | Bacteria | 1093 |
| 528 | Ga0496107_0007757 | 3300048910 | Bacteria | 7415 |
| 529 | Ga0496107_0028715 | 3300048910 | Bacteria | 3954 |
| 530 | Ga0496107_0149601 | 3300048910 | Bacteria | 1727 |
| 531 | Ga0496107_0204579 | 3300048910 | Bacteria | 1467 |
| 532 | Ga0496108_0000280 | 3300048911 | Bacteria | 43780 |
| 533 | Ga0496108_0002187 | 3300048911 | Bacteria | 15684 |
| 534 | Ga0496108_0013567 | 3300048911 | Bacteria | 6650 |
| 535 | Ga0496108_0027313 | 3300048911 | Bacteria | 4711 |
| 536 | Ga0496108_0031681 | 3300048911 | Bacteria | 4388 |
| 537 | Ga0496108_0041398 | 3300048911 | Bacteria | 3846 |
| 538 | Ga0496108_0187564 | 3300048911 | Bacteria | 1791 |
| 539 | Ga0496109_0004717 | 3300048912 | Bacteria | 11384 |
| 540 | Ga0496109_0023972 | 3300048912 | Bacteria | 5420 |
| 541 | Ga0496109_0028864 | 3300048912 | Bacteria | 4966 |
| 542 | Ga0496109_0060434 | 3300048912 | Bacteria | 3463 |
| 543 | Ga0496109_0102528 | 3300048912 | Bacteria | 2655 |
| 544 | Ga0496109_0267187 | 3300048912 | Bacteria | 1611 |
| 545 | Ga0496109_0323528 | 3300048912 | Bacteria | 1455 |
| 546 | Ga0496110_0018244 | 3300048913 | Bacteria | 5881 |
| 547 | Ga0496110_0078936 | 3300048913 | Bacteria | 2930 |
| 548 | Ga0496110_0099042 | 3300048913 | Bacteria | 2613 |
| 549 | Ga0496110_0156799 | 3300048913 | Bacteria | 2062 |
| 550 | Ga0496110_0166115 | 3300048913 | Bacteria | 2001 |
| 551 | Ga0496111_0006961 | 3300048914 | Bacteria | 7380 |
| 552 | Ga0496111_0011997 | 3300048914 | Bacteria | 5857 |
| 553 | Ga0496111_0021774 | 3300048914 | Bacteria | 4479 |
| 554 | Ga0496111_0099193 | 3300048914 | Bacteria | 2139 |
| 555 | Ga0496111_0159308 | 3300048914 | Bacteria | 1675 |
| 556 | Ga0496111_0220647 | 3300048914 | Bacteria | 1408 |
| 557 | Ga0496112_0008587 | 3300048915 | Bacteria | 9157 |
| 558 | Ga0496112_0038256 | 3300048915 | Bacteria | 4684 |
| 559 | Ga0496112_0124515 | 3300048915 | Bacteria | 2548 |
| 560 | Ga0496112_0134172 | 3300048915 | Bacteria | 2446 |
| 561 | Ga0496112_0210580 | 3300048915 | Bacteria | 1901 |
| 562 | Ga0496112_0257661 | 3300048915 | Bacteria | 1694 |
| 563 | Ga0496112_0269957 | 3300048915 | Bacteria | 1649 |
| 564 | Ga0496112_0316714 | 3300048915 | Bacteria | 1505 |
| 565 | Ga0496112_0482802 | 3300048915 | Bacteria | 1176 |
| 566 | Ga0496112_0530489 | 3300048915 | Bacteria | 1111 |
| 567 | Ga0496113_0010111 | 3300048916 | Bacteria | 6224 |
| 568 | Ga0496113_0017952 | 3300048916 | Bacteria | 4920 |
| 569 | Ga0496113_0062117 | 3300048916 | Bacteria | 2820 |
| 570 | Ga0496113_0070924 | 3300048916 | Bacteria | 2649 |
| 571 | Ga0496113_0079609 | 3300048916 | Bacteria | 2509 |
| 572 | Ga0496113_0081278 | 3300048916 | Bacteria | 2483 |
| 573 | Ga0496113_0242720 | 3300048916 | Bacteria | 1437 |
| 574 | Ga0496113_0291134 | 3300048916 | Bacteria | 1306 |
| 575 | Ga0496114_0138602 | 3300048917 | Bacteria | 2104 |
| 576 | Ga0496114_0195378 | 3300048917 | Bacteria | 1771 |
| 577 | Ga0496114_0205871 | 3300048917 | Bacteria | 1724 |
| 578 | Ga0496115_0010920 | 3300048918 | Bacteria | 6798 |
| 579 | Ga0496115_0023718 | 3300048918 | Bacteria | 4762 |
| 580 | Ga0496115_0054640 | 3300048918 | Bacteria | 3207 |
| 581 | Ga0496115_0133752 | 3300048918 | Bacteria | 2044 |
| 582 | Ga0496115_0192255 | 3300048918 | Bacteria | 1686 |
| 583 | Ga0496115_0349536 | 3300048918 | Bacteria | 1206 |
| 584 | Ga0496116_0078041 | 3300048919 | Bacteria | 2067 |
| 585 | Ga0496118_0008202 | 3300048921 | Bacteria | 10855 |
| 586 | Ga0496119_0023805 | 3300048922 | Bacteria | 4329 |
| 587 | Ga0496120_0139969 | 3300048923 | Unclassified | 1230 |
| 588 | Ga0496124_0034524 | 3300048927 | Bacteria | 4437 |
| 589 | Ga0496124_0042171 | 3300048927 | Bacteria | 3931 |
| 590 | Ga0496126_0001669 | 3300048929 | Bacteria | 33303 |
| 591 | Ga0501031_0001074 | 3300049568 | Bacteria | 16608 |
| 592 | Ga0501031_0020539 | 3300049568 | Bacteria | 4306 |
| 593 | Ga0501032_0062003 | 3300049569 | Bacteria | 2506 |
| 594 | Ga0501033_0011795 | 3300049570 | Bacteria | 6680 |
| 595 | Ga0501033_0043089 | 3300049570 | Bacteria | 3362 |
| 596 | Ga0501036_0000458 | 3300049572 | Bacteria | 29172 |
| 597 | Ga0501036_0000879 | 3300049572 | Bacteria | 22418 |
| 598 | Ga0501037_0010141 | 3300049573 | Bacteria | 6914 |
| 599 | Ga0501037_0016319 | 3300049573 | Bacteria | 5465 |
| 600 | Ga0501038_0002045 | 3300049574 | Bacteria | 18657 |
| 601 | Ga0501038_0011266 | 3300049574 | Bacteria | 8164 |
| 602 | Ga0501039_0002275 | 3300049575 | Bacteria | 14253 |
| 603 | Ga0501040_0000165 | 3300049576 | Bacteria | 37255 |
| 604 | Ga0501040_0001288 | 3300049576 | Bacteria | 15957 |
| 605 | Ga0501040_0343092 | 3300049576 | Bacteria | 1069 |
| 606 | Ga0501041_0000036 | 3300049577 | Bacteria | 44442 |
| 607 | Ga0501041_0000751 | 3300049577 | Bacteria | 17359 |
| 608 | Ga0501041_0346076 | 3300049577 | Bacteria | 939 |
| 609 | Ga0501042_0000114 | 3300049578 | Bacteria | 33922 |
| 610 | Ga0501042_0000773 | 3300049578 | Bacteria | 17446 |
| 611 | Ga0501042_0000870 | 3300049578 | Bacteria | 16867 |
| 612 | Ga0501042_0010184 | 3300049578 | Bacteria | 6292 |
| 613 | Ga0501043_0007544 | 3300049579 | Bacteria | 8633 |
| 614 | Ga0501043_0065696 | 3300049579 | Bacteria | 2849 |
| 615 | Ga0501046_0000353 | 3300049580 | Bacteria | 46190 |
| 616 | Ga0501046_0006512 | 3300049580 | Bacteria | 10327 |
| 617 | Ga0501047_0119805 | 3300049581 | Bacteria | 2514 |
| 618 | Ga0501048_0000036 | 3300049582 | Bacteria | 64488 |
| 619 | Ga0501048_0001504 | 3300049582 | Bacteria | 17641 |
| 620 | Ga0501068_0019621 | 3300049584 | Bacteria | 3929 |
| 621 | Ga0501069_0004934 | 3300049585 | Bacteria | 6920 |
| 622 | Ga0501069_0029945 | 3300049585 | Bacteria | 2988 |
| 623 | Ga0501070_0114033 | 3300049586 | Bacteria | 2233 |
| 624 | Ga0501071_0000198 | 3300049587 | Bacteria | 27162 |
| 625 | Ga0501071_0032381 | 3300049587 | Bacteria | 3712 |
| 626 | Ga0501072_0000540 | 3300049588 | Bacteria | 27142 |
| 627 | Ga0501072_0007301 | 3300049588 | Bacteria | 8379 |
| 628 | Ga0501073_0287740 | 3300049589 | Bacteria | 1134 |
| 629 | Ga0501074_0001709 | 3300049590 | Bacteria | 14977 |
| 630 | Ga0501074_0002235 | 3300049590 | Bacteria | 13434 |
| 631 | Ga0501075_0000081 | 3300049591 | Bacteria | 43290 |
| 632 | Ga0501075_0001803 | 3300049591 | Bacteria | 14103 |
| 633 | Ga0501076_0000318 | 3300049592 | Bacteria | 29783 |
| 634 | Ga0501076_0000620 | 3300049592 | Bacteria | 22673 |
| 635 | Ga0501077_0001186 | 3300049593 | Bacteria | 15722 |
| 636 | Ga0501077_0012987 | 3300049593 | Bacteria | 5217 |
| 637 | Ga0501079_0007867 | 3300049741 | Bacteria | 8074 |
| 638 | Ga0501079_0013533 | 3300049741 | Bacteria | 6222 |
| 639 | Ga0501080_0019483 | 3300049742 | Bacteria | 6284 |
| 640 | Ga0501080_0084498 | 3300049742 | Bacteria | 2949 |
| 641 | Ga0501081_0000200 | 3300049743 | Bacteria | 29149 |
| 642 | Ga0501081_0001725 | 3300049743 | Bacteria | 13573 |
| 643 | Ga0501083_0130084 | 3300049744 | Bacteria | 1650 |
| 644 | Ga0501035_0005748 | 3300049822 | Bacteria | 11700 |
| 645 | Ga0501035_0027940 | 3300049822 | Bacteria | 5154 |
| 646 | Ga0501044_0389257 | 3300049823 | Bacteria | 1308 |
| 647 | Ga0501045_0000509 | 3300049824 | Bacteria | 24172 |
| 648 | Ga0501045_0001062 | 3300049824 | Bacteria | 18138 |
| 649 | nmdc:mga03n38_8624_c1 | 3300050490 | Bacteria | 3667 |
| 650 | nmdc:mga00v17_18633_c1 | 3300050491 | Bacteria | 3947 |
| 651 | nmdc:mga0yw44_6817_c1 | 3300050492 | Bacteria | 5554 |
| 652 | nmdc:mga06z11_17081_c1 | 3300050494 | Bacteria | 3285 |
| 653 | nmdc:mga05p37_20126_c1 | 3300050507 | Bacteria | 4580 |
| 654 | nmdc:mga05p37_359658_c1 | 3300050507 | Bacteria | 1712 |
| 655 | nmdc:mga05p37_563656_c1 | 3300050507 | Bacteria | 1294 |
| 656 | nmdc:mga09592_121710_c1 | 3300050508 | Bacteria | 2242 |
| 657 | nmdc:mga09592_418705_c1 | 3300050508 | Bacteria | 1157 |
| 658 | nmdc:mga0qj67_115089_c1 | 3300050509 | Bacteria | 2173 |
| 659 | nmdc:mga0qj67_372573_c1 | 3300050509 | Bacteria | 1153 |
| 660 | nmdc:mga0qj67_636123_c1 | 3300050509 | Bacteria | 852 |
| 661 | nmdc:mga0qj67_70792_c1 | 3300050509 | Bacteria | 2783 |
| 662 | nmdc:mga06r32_306624_c1 | 3300050510 | Bacteria | 1573 |
| 663 | nmdc:mga06r32_36033_c1 | 3300050510 | Bacteria | 4672 |
| 664 | nmdc:mga08y16_190700_c1 | 3300050511 | Bacteria | 2126 |
| 665 | nmdc:mga08y16_227487_c1 | 3300050511 | Bacteria | 1930 |
| 666 | nmdc:mga08y16_242846_c1 | 3300050511 | Bacteria | 1862 |
| 667 | nmdc:mga08y16_248793_c1 | 3300050511 | Bacteria | 1837 |
| 668 | nmdc:mga08y16_46839_c1 | 3300050511 | Bacteria | 4526 |
| 669 | nmdc:mga0n895_455288_c1 | 3300050512 | Bacteria | 1292 |
| 670 | nmdc:mga0n895_590122_c1 | 3300050512 | Bacteria | 1114 |
| 671 | nmdc:mga0n895_75224_c1 | 3300050512 | Bacteria | 3356 |
| 672 | nmdc:mga0rr50_18097_c1 | 3300050513 | Bacteria | 4725 |
| 673 | nmdc:mga0rr50_232399_c1 | 3300050513 | Bacteria | 1526 |
| 674 | nmdc:mga08x19_209780_c1 | 3300050514 | Bacteria | 1337 |
| 675 | nmdc:mga0a205_251960_c1 | 3300050515 | Bacteria | 1645 |
| 676 | nmdc:mga0a205_687480_c1 | 3300050515 | Bacteria | 873 |
| 677 | nmdc:mga0sz30_31984_c1 | 3300050516 | Bacteria | 2179 |
| 678 | Ga0495612_0048563 | 3300053078 | Bacteria | 1740 |
| 679 | Ga0495612_0101341 | 3300053078 | Bacteria | 1226 |
| 680 | Ga0495595_0036515 | 3300053084 | Bacteria | 2230 |
| 681 | Ga0500646_0032872 | 3300053090 | Bacteria | 1433 |
| 682 | Ga0500651_0114083 | 3300053093 | Bacteria | 1646 |
| 683 | Ga0500556_0101835 | 3300053104 | Bacteria | 1107 |
| 684 | Ga0500594_0013130 | 3300053118 | Bacteria | 1964 |
| 685 | Ga0500573_0000014 | 3300053140 | Bacteria | 193353 |
| 686 | Ga0501084_0001726 | 3300054114 | Bacteria | 17333 |
| 687 | Ga0501084_0075782 | 3300054114 | Bacteria | 2818 |
| 688 | Ga0501084_0275289 | 3300054114 | Bacteria | 1421 |
| 689 | Ga0590071_030606 | 3300059421 | Bacteria | 1282 |
| 690 | Ga0501082_0000746 | 3300060353 | Bacteria | 28590 |
| 691 | Ga0501082_0002688 | 3300060353 | Bacteria | 15533 |
| 692 | Ga0530510_0000421 | 3300061734 | Bacteria | 27366 |
| 693 | Ga0530510_0002045 | 3300061734 | Bacteria | 13865 |
| 694 | 2643875295 | 2643221572 | Bacteria | 3614809 |
| 695 | 2644382351 | 2643221669 | Bacteria | 3611286 |
| 696 | 2676483638 | 2675903059 | Bacteria | 8644972 |
| 697 | 2753076351 | 2751185734 | Bacteria | 8863695 |
| 698 | 2791912420 | 2791354901 | Bacteria | 8322202 |
| 699 | 2867314809 | 2867312974 | Bacteria | 7058875 |
| 700 | 2867322177 | 2867319477 | Bacteria | 7069771 |
| 701 | 2870623232 | 2870622029 | Bacteria | 3643329 |
| 702 | 2873319826 | 2873314349 | Bacteria | 8512634 |
| 703 | 2891397179 | 2891395885 | Bacteria | 9251614 |
| 704 | 2895436997 | 2895427314 | Bacteria | 13147766 |
| 705 | 2895661384 | 2895660088 | Bacteria | 3782833 |
| 706 | 2905927972 | 2905926851 | Bacteria | 4423176 |
| 707 | 8055066357 | 8055066027 | Bacteria | 9479577 |
| 708 | 8055180468 | 8055172936 | Bacteria | 9305943 |
| 709 | Ga0496100_0122470 | |||
| 710 | JGI24739J22299_10007843 | |||
| 711 | JGI24737J22298_10003414 | |||
| 712 | JGI24735J21928_10010174 | |||
| 713 | JGI24751J29686_10012395 | |||
| 714 | rootH2_10019715 | |||
| 715 | Ga0065714_10006584 | |||
| 716 | Ga0065707_10176597 | |||
| 717 | Ga0070658_10089387 | |||
| 718 | Ga0070683_100000313 | |||
| 719 | Ga0070683_100070343 | |||
| 720 | Ga0070683_100112323 | |||
| 721 | Ga0070690_100049252 | |||
| 722 | Ga0070670_100005308 | |||
| 723 | Ga0070670_100021022 | |||
| 724 | Ga0070670_100065139 | |||
| 725 | Ga0070670_100140260 | |||
| 726 | Ga0068869_100034678 | |||
| 727 | Ga0068869_100164576 | |||
| 728 | Ga0070680_100307577 | |||
| 729 | Ga0070680_100310672 | |||
| 730 | Ga0070682_100009629 | |||
| 731 | Ga0068868_100004094 | |||
| 732 | Ga0068868_100024754 | |||
| 733 | Ga0068868_100095605 | |||
| 734 | Ga0070660_100024632 | |||
| 735 | Ga0070691_10003538 | |||
| 736 | Ga0070691_10032404 | |||
| 737 | Ga0070661_100021853 | |||
| 738 | Ga0070661_100478175 | |||
| 739 | Ga0070692_10004357 | |||
| 740 | Ga0070668_100554962 | |||
| 741 | Ga0070675_100007270 | |||
| 742 | Ga0070675_100078329 | |||
| 743 | Ga0070671_100006123 | |||
| 744 | Ga0070674_100027990 | |||
| 745 | Ga0070673_100065129 | |||
| 746 | Ga0070659_100010690 | |||
| 747 | Ga0070667_100335689 | |||
| 748 | Ga0070667_100568872 | |||
| 749 | Ga0070709_10000307 | |||
| 750 | Ga0070709_10003443 | |||
| 751 | Ga0070709_10005852 | |||
| 752 | Ga0070714_100304191 | |||
| 753 | Ga0070714_100384104 | |||
| 754 | Ga0070714_100448173 | |||
| 755 | Ga0070713_100104498 | |||
| 756 | Ga0070713_100289280 | |||
| 757 | Ga0070713_100339569 | |||
| 758 | Ga0070710_10030370 | |||
| 759 | Ga0070701_10115560 | |||
| 760 | Ga0070711_100004870 | |||
| 761 | Ga0070711_100024045 | |||
| 762 | Ga0070705_100021374 | |||
| 763 | Ga0070705_100324043 | |||
| 764 | Ga0070663_100043802 | |||
| 765 | Ga0070663_100045629 | |||
| 766 | Ga0070663_100245195 | |||
| 767 | Ga0070678_100008891 | |||
| 768 | Ga0070662_100136208 | |||
| 769 | Ga0070662_100190655 | |||
| 770 | Ga0070681_10019993 | |||
| 771 | Ga0070681_10088346 | |||
| 772 | Ga0070685_10011039 | |||
| 773 | Ga0070685_10088416 | |||
| 774 | Ga0070706_100009179 | |||
| 775 | Ga0070698_100015870 | |||
| 776 | Ga0070698_100211542 | |||
| 777 | Ga0070698_100285762 | |||
| 778 | Ga0070699_100133806 | |||
| 779 | Ga0070679_100137135 | |||
| 780 | Ga0070684_100100743 | |||
| 781 | Ga0070684_100355068 | |||
| 782 | Ga0068853_100243209 | |||
| 783 | Ga0070672_100053698 | |||
| 784 | Ga0070686_100031286 | |||
| 785 | Ga0070695_100362456 | |||
| 786 | Ga0070696_100039223 | |||
| 787 | Ga0070696_100047770 | |||
| 788 | Ga0070693_100001955 | |||
| 789 | Ga0070693_100015714 | |||
| 790 | Ga0070704_100116519 | |||
| 791 | Ga0070664_100003778 | |||
| 792 | Ga0070664_100019320 | |||
| 793 | Ga0070664_100078008 | |||
| 794 | Ga0070664_100149745 | |||
| 795 | Ga0068857_100020742 | |||
| 796 | Ga0068857_100030428 | |||
| 797 | Ga0068854_100203625 | |||
| 798 | Ga0068856_100026993 | |||
| 799 | Ga0068856_100118270 | |||
| 800 | Ga0068856_100540031 | |||
| 801 | Ga0070702_100000548 | |||
| 802 | Ga0070702_100007830 | |||
| 803 | Ga0070702_100293427 | |||
| 804 | Ga0068852_100022828 | |||
| 805 | Ga0068852_100248325 | |||
| 806 | Ga0068852_100475844 | |||
| 807 | Ga0068859_100091377 | |||
| 808 | Ga0068859_100097788 | |||
| 809 | Ga0068864_100009245 | |||
| 810 | Ga0068864_100343522 | |||
| 811 | Ga0068861_100077924 | |||
| 812 | Ga0068861_100283951 | |||
| 813 | Ga0068870_10022744 | |||
| 814 | Ga0068863_100032260 | |||
| 815 | Ga0068863_100370567 | |||
| 816 | Ga0068863_100378548 | |||
| 817 | Ga0068858_100023922 | |||
| 818 | Ga0068858_100045903 | |||
| 819 | Ga0068858_100314607 | |||
| 820 | Ga0068860_100264453 | |||
| 821 | Ga0068860_100287108 | |||
| 822 | Ga0068862_100043417 | |||
| 823 | Ga0068862_100141340 | |||
| 824 | Ga0081455_10202155 | |||
| 825 | Ga0081455_10231002 | |||
| 826 | Ga0081538_10002596 | |||
| 827 | Ga0081538_10026602 | |||
| 828 | Ga0081540_1000388 | |||
| 829 | Ga0081540_1053439 | |||
| 830 | Ga0070717_10085061 | |||
| 831 | Ga0070717_10086829 | |||
| 832 | Ga0070717_10122872 | |||
| 833 | Ga0075365_10081941 | |||
| 834 | Ga0075363_100003308 | |||
| 835 | Ga0075432_10067699 | |||
| 836 | Ga0070715_10025741 | |||
| 837 | Ga0070716_100002016 | |||
| 838 | Ga0070716_100037994 | |||
| 839 | Ga0070716_100057593 | |||
| 840 | Ga0070712_100026189 | |||
| 841 | Ga0070712_100234513 | |||
| 842 | Ga0075367_10000964 | |||
| 843 | Ga0075369_10034275 | |||
| 844 | Ga0075427_10005411 | |||
| 845 | Ga0068871_100662678 | |||
| 846 | Ga0075428_100000033 | |||
| 847 | Ga0075428_100183595 | |||
| 848 | Ga0075428_100193330 | |||
| 849 | Ga0075428_100432160 | |||
| 850 | Ga0075430_100079322 | |||
| 851 | Ga0075430_100313366 | |||
| 852 | Ga0075431_100147138 | |||
| 853 | Ga0075433_10010992 | |||
| 854 | Ga0075433_10380806 | |||
| 855 | Ga0075434_100002248 | |||
| 856 | Ga0075434_100069332 | |||
| 857 | Ga0075434_100141322 | |||
| 858 | Ga0075429_100170007 | |||
| 859 | Ga0068865_100054942 | |||
| 860 | Ga0097620_100091373 | |||
| 861 | Ga0097620_100097784 | |||
| 862 | Ga0075435_100169507 | |||
| 863 | Ga0075435_100403063 | |||
| 864 | Ga0105251_10030940 | |||
| 865 | Ga0105244_10028836 | |||
| 866 | Ga0105244_10154262 | |||
| 867 | Ga0111539_10075968 | |||
| 868 | Ga0111539_10080144 | |||
| 869 | Ga0111539_10085361 | |||
| 870 | Ga0105245_10017437 | |||
| 871 | Ga0105245_10098217 | |||
| 872 | Ga0105245_10100231 | |||
| 873 | Ga0105245_10175421 | |||
| 874 | Ga0114129_10005665 | |||
| 875 | Ga0114129_10029741 | |||
| 876 | Ga0114129_10152545 | |||
| 877 | Ga0105243_10142673 | |||
| 878 | Ga0105241_10001817 | |||
| 879 | Ga0105241_10113411 | |||
| 880 | Ga0105242_10374892 | |||
| 881 | Ga0105248_10059203 | |||
| 882 | Ga0105248_10077678 | |||
| 883 | Ga0105248_10255376 | |||
| 884 | Ga0105248_10788206 | |||
| 885 | Ga0105237_10346299 | |||
| 886 | Ga0105237_10364368 | |||
| 887 | Ga0105238_10063862 | |||
| 888 | Ga0105238_10569975 | |||
| 889 | Ga0105249_10014161 | |||
| 890 | Ga0105249_10704939 | |||
| 891 | Ga0105239_10103682 | |||
| 892 | Ga0105239_10393285 | |||
| 893 | Ga0157373_10068007 | |||
| 894 | Ga0157371_10025184 | |||
| 895 | Ga0157371_10059476 | |||
| 896 | Ga0157370_10056966 | |||
| 897 | Ga0157370_10079693 | |||
| 898 | Ga0157370_10381388 | |||
| 899 | Ga0157369_10018594 | |||
| 900 | Ga0157369_10106246 | |||
| 901 | Ga0171462_1005 | |||
| 902 | Ga0157378_10027948 | |||
| 903 | Ga0157378_10055912 | |||
| 904 | Ga0163162_10090693 | |||
| 905 | Ga0163162_10100553 | |||
| 906 | Ga0163162_10183070 | |||
| 907 | Ga0163162_10245998 | |||
| 908 | Ga0163162_10294665 | |||
| 909 | Ga0157372_10152217 | |||
| 910 | Ga0157372_10401714 | |||
| 911 | Ga0157375_10027075 | |||
| 912 | Ga0157375_10040372 | |||
| 913 | Ga0157375_10616164 | |||
| 914 | Ga0163163_10008903 | |||
| 915 | Ga0163163_10021138 | |||
| 916 | Ga0163163_10236417 | |||
| 917 | Ga0157380_10022330 | |||
| 918 | Ga0157380_10354357 | |||
| 919 | Ga0182008_10099630 | |||
| 920 | Ga0157377_10009310 | |||
| 921 | Ga0157377_10209348 | |||
| 922 | Ga0157379_10024850 | |||
| 923 | Ga0157379_10377327 | |||
| 924 | Ga0163161_10185230 | |||
| 925 | Ga0206353_10500331 | |||
| 926 | Ga0206353_10706765 | |||
| 927 | Ga0213874_10007046 | |||
| 928 | Ga0213876_10018724 | |||
| 929 | Ga0213876_10129368 | |||
| 930 | Ga0213875_10012883 | |||
| 931 | Ga0213875_10120326 | |||
| 932 | Ga0213875_10135498 | |||
| 933 | Ga0207697_10008982 | |||
| 934 | Ga0207692_10000173 | |||
| 935 | Ga0207692_10007493 | |||
| 936 | Ga0207688_10008173 | |||
| 937 | Ga0207647_10016019 | |||
| 938 | Ga0207685_10056466 | |||
| 939 | Ga0207685_10058991 | |||
| 940 | Ga0207699_10000797 | |||
| 941 | Ga0207699_10001935 | |||
| 942 | Ga0207699_10006926 | |||
| 943 | Ga0207699_10031599 | |||
| 944 | Ga0207699_10127634 | |||
| 945 | Ga0207699_10203841 | |||
| 946 | Ga0207645_10011866 | |||
| 947 | Ga0207645_10033795 | |||
| 948 | Ga0207643_10000305 | |||
| 949 | Ga0207643_10006751 | |||
| 950 | Ga0207643_10103727 | |||
| 951 | Ga0207684_10000277 | |||
| 952 | Ga0207654_10035467 | |||
| 953 | Ga0207707_10029920 | |||
| 954 | Ga0207693_10038622 | |||
| 955 | Ga0207693_10061460 | |||
| 956 | Ga0207693_10343326 | |||
| 957 | Ga0207663_10007434 | |||
| 958 | Ga0207663_10029418 | |||
| 959 | Ga0207660_10018767 | |||
| 960 | Ga0207660_10549844 | |||
| 961 | Ga0207662_10009513 | |||
| 962 | Ga0207657_10023629 | |||
| 963 | Ga0207657_10414084 | |||
| 964 | Ga0207649_10112750 | |||
| 965 | Ga0207652_10151402 | |||
| 966 | Ga0207681_10071447 | |||
| 967 | Ga0207694_10028304 | |||
| 968 | Ga0207694_10213303 | |||
| 969 | Ga0207650_10099801 | |||
| 970 | Ga0207650_10140514 | |||
| 971 | Ga0207659_10015468 | |||
| 972 | Ga0207659_10030819 | |||
| 973 | Ga0207659_10080850 | |||
| 974 | Ga0207687_10010202 | |||
| 975 | Ga0207687_10109387 | |||
| 976 | Ga0207687_10130251 | |||
| 977 | Ga0207687_10206414 | |||
| 978 | Ga0207687_10257179 | |||
| 979 | Ga0207700_10000291 | |||
| 980 | Ga0207700_10004416 | |||
| 981 | Ga0207700_10014266 | |||
| 982 | Ga0207700_10085395 | |||
| 983 | Ga0207700_10114600 | |||
| 984 | Ga0207700_10489975 | |||
| 985 | Ga0207700_10535690 | |||
| 986 | Ga0207664_10000163 | |||
| 987 | Ga0207664_10001490 | |||
| 988 | Ga0207664_10002073 | |||
| 989 | Ga0207664_10022162 | |||
| 990 | Ga0207664_10042160 | |||
| 991 | Ga0207664_10060660 | |||
| 992 | Ga0207664_10089294 | |||
| 993 | Ga0207664_10205139 | |||
| 994 | Ga0207644_10102464 | |||
| 995 | Ga0207690_10050805 | |||
| 996 | Ga0207690_10170916 | |||
| 997 | Ga0207706_10005899 | |||
| 998 | Ga0207706_10029243 | |||
| 999 | Ga0207706_10128715 | |||
| 1000 | Ga0207686_10016771 | |||
| 1001 | Ga0207709_10030391 | |||
| 1002 | Ga0207670_10510578 | |||
| 1003 | Ga0207669_10034498 | |||
| 1004 | Ga0207665_10002384 | |||
| 1005 | Ga0207665_10002492 | |||
| 1006 | Ga0207665_10020348 | |||
| 1007 | Ga0207665_10022374 | |||
| 1008 | Ga0207665_10043263 | |||
| 1009 | Ga0207691_10033146 | |||
| 1010 | Ga0207711_10537848 | |||
| 1011 | Ga0207689_10001317 | |||
| 1012 | Ga0207689_10034763 | |||
| 1013 | Ga0207689_10116399 | |||
| 1014 | Ga0207661_10002641 | |||
| 1015 | Ga0207661_10031208 | |||
| 1016 | Ga0207661_10032701 | |||
| 1017 | Ga0207661_10107734 | |||
| 1018 | Ga0207661_10262017 | |||
| 1019 | Ga0207679_10017890 | |||
| 1020 | Ga0207651_10209660 | |||
| 1021 | Ga0207712_10040819 | |||
| 1022 | Ga0207668_10002527 | |||
| 1023 | Ga0207640_10039825 | |||
| 1024 | Ga0207640_10211501 | |||
| 1025 | Ga0207658_10151172 | |||
| 1026 | Ga0207658_10415515 | |||
| 1027 | Ga0207677_10236080 | |||
| 1028 | Ga0207703_10020395 | |||
| 1029 | Ga0207703_10036897 | |||
| 1030 | Ga0207639_10034833 | |||
| 1031 | Ga0207678_10000358 | |||
| 1032 | Ga0207678_10008685 | |||
| 1033 | Ga0207678_10009934 | |||
| 1034 | Ga0207678_10031941 | |||
| 1035 | Ga0207708_10008132 | |||
| 1036 | Ga0207708_10013125 | |||
| 1037 | Ga0207702_10004745 | |||
| 1038 | Ga0207702_10044213 | |||
| 1039 | Ga0207702_10083479 | |||
| 1040 | Ga0207702_10501722 | |||
| 1041 | Ga0207641_10228648 | |||
| 1042 | Ga0207648_10011128 | |||
| 1043 | Ga0207676_10012531 | |||
| 1044 | Ga0207676_10030258 | |||
| 1045 | Ga0207676_10092903 | |||
| 1046 | Ga0207676_10256654 | |||
| 1047 | Ga0207674_10009714 | |||
| 1048 | Ga0207674_10031484 | |||
| 1049 | Ga0207674_10041825 | |||
| 1050 | Ga0207674_10074397 | |||
| 1051 | Ga0207674_10279878 | |||
| 1052 | Ga0207675_100038014 | |||
| 1053 | Ga0207683_10001089 | |||
| 1054 | Ga0207683_10008621 | |||
| 1055 | Ga0207683_10359591 | |||
| 1056 | Ga0207698_10365564 | |||
| 1057 | Ga0207698_10423016 | |||
| 1058 | Ga0207428_10202907 | |||
| 1059 | Ga0207428_10279088 | |||
| 1060 | Ga0268266_10035731 | |||
| 1061 | Ga0268265_10015028 | |||
| 1062 | Ga0268265_10108723 | |||
| 1063 | Ga0268265_10434399 | |||
| 1064 | Ga0268264_10250894 | |||
| 1065 | Ga0307517_10034777 | |||
| 1066 | Ga0307515_10007887 | |||
| 1067 | Ga0307515_10022147 | |||
| 1068 | Ga0307515_10036776 | |||
| 1069 | Ga0307515_10081912 | |||
| 1070 | Ga0307515_10150618 | |||
| 1071 | Ga0307512_10007480 | |||
| 1072 | Ga0265760_10004737 | |||
| 1073 | Ga0307513_10005045 | |||
| 1074 | Ga0307513_10006497 | |||
| 1075 | Ga0307509_10084698 | |||
| 1076 | Ga0307408_100007843 | |||
| 1077 | Ga0307508_10004754 | |||
| 1078 | Ga0307508_10042708 | |||
| 1079 | Ga0307508_10136760 | |||
| 1080 | Ga0307514_10221596 | |||
| 1081 | Ga0307413_10081593 | |||
| 1082 | Ga0307413_10152266 | |||
| 1083 | Ga0307410_10027752 | |||
| 1084 | Ga0307406_10037061 | |||
| 1085 | Ga0307407_10245123 | |||
| 1086 | Ga0307407_10254332 | |||
| 1087 | Ga0307412_10426405 | |||
| 1088 | Ga0307409_100431466 | |||
| 1089 | Ga0307416_100069288 | |||
| 1090 | Ga0307416_100202675 | |||
| 1091 | Ga0307416_100290375 | |||
| 1092 | Ga0307414_10227026 | |||
| 1093 | Ga0307415_100004146 | |||
| 1094 | Ga0307415_100137748 | |||
| 1095 | Ga0307415_100204076 | |||
| 1096 | Ga0307415_100379162 | |||
| 1097 | Ga0307510_10078582 | |||
| 1098 | Ga0307510_10092277 | |||
| 1099 | Ga0316214_1000810 | |||
| 1100 | Ga0373934_0133395 | |||
| 1101 | Ga0373951_0000078 | |||
| 1102 | Ga0373956_0133229 | |||
| 1103 | Ga0373957_0043275 | |||
| 1104 | Ga0373955_0128473 | |||
| 1105 | Ga0373955_0132207 | |||
| 1106 | Ga0373931_0021738 | |||
| 1107 | Ga0373935_0268574 | |||
| 1108 | Ga0373937_0152177 | |||
| 1109 | Ga0373937_0203681 | |||
| 1110 | Ga0373937_0207623 | |||
| 1111 | Ga0373937_0341311 | |||
| 1112 | Ga0373925_0000231 | |||
| 1113 | Ga0395900_0222733 | |||
| 1114 | Ga0395898_0108192 | |||
| 1115 | Ga0395905_0327037 | |||
| 1116 | Ga0395905_0472863 | |||
| 1117 | Ga0436364_0143437 | |||
| 1118 | Ga0436364_0229754 | |||
| 1119 | Ga0436364_1220186 | |||
| 1120 | Ga0395901_0208855 | |||
| 1121 | Ga0395901_0433488 | |||
| 1122 | Ga0436365_0240611 | |||
| 1123 | Ga0436365_0321896 | |||
| 1124 | Ga0436361_0305136 | |||
| 1125 | Ga0436363_0393857 | |||
| 1126 | Ga0436362_0526440 | |||
| 1127 | Ga0451833_0368536 | |||
| 1128 | Ga0451837_1620174 | |||
| 1129 | Ga0451843_1564856 | |||
| 1130 | Ga0451853_0346248 | |||
| 1131 | Ga0451853_0480461 | |||
| 1132 | Ga0439448_0020025 | |||
| 1133 | Ga0439450_047104 | |||
| 1134 | Ga0439455_0022564 | |||
| 1135 | Ga0439463_001418 | |||
| 1136 | Ga0439463_005247 | |||
| 1137 | Ga0439463_011585 | |||
| 1138 | Ga0439463_033769 | |||
| 1139 | Ga0450902_015058 | |||
| 1140 | Ga0450905_013198 | |||
| 1141 | Ga0439464_0037701 | |||
| 1142 | Ga0439460_0023652 | |||
| 1143 | Ga0439460_0031448 | |||
| 1144 | Ga0450916_000064 | |||
| 1145 | Ga0450916_005535 | |||
| 1146 | Ga0466967_0017594 | |||
| 1147 | Ga0466967_0116322 | |||
| 1148 | Ga0495638_0162016 | |||
| 1149 | Ga0495651_0028022 | |||
| 1150 | Ga0495653_0144857 | |||
| 1151 | Ga0495653_0285079 | |||
| 1152 | Ga0495580_0096817 | |||
| 1153 | Ga0495582_0037598 | |||
| 1154 | Ga0495639_0008150 | |||
| 1155 | Ga0495664_0033174 | |||
| 1156 | Ga0495594_0073842 | |||
| 1157 | Ga0495608_0047648 | |||
| 1158 | Ga0495608_0177787 | |||
| 1159 | Ga0495608_0191685 | |||
| 1160 | Ga0495618_0084632 | |||
| 1161 | Ga0495618_0094058 | |||
| 1162 | Ga0495618_0246984 | |||
| 1163 | Ga0495628_0063970 | |||
| 1164 | Ga0495628_0125845 | |||
| 1165 | Ga0495630_0166656 | |||
| 1166 | Ga0495632_0058282 | |||
| 1167 | Ga0495665_0022257 | |||
| 1168 | Ga0495640_0369397 | |||
| 1169 | Ga0495586_0010200 | |||
| 1170 | Ga0495587_0038694 | |||
| 1171 | Ga0495645_0057603 | |||
| 1172 | Ga0495645_0079339 | |||
| 1173 | Ga0495633_0077764 | |||
| 1174 | Ga0495667_0044153 | |||
| 1175 | Ga0495667_0044584 | |||
| 1176 | Ga0495667_0169615 | |||
| 1177 | Ga0495656_0032689 | |||
| 1178 | Ga0495635_0218202 | |||
| 1179 | Ga0495635_0345284 | |||
| 1180 | Ga0495588_0014609 | |||
| 1181 | Ga0495588_0018483 | |||
| 1182 | Ga0495657_0086939 | |||
| 1183 | Ga0495599_0055514 | |||
| 1184 | Ga0495623_0035637 | |||
| 1185 | Ga0495647_0046421 | |||
| 1186 | Ga0495624_0494110 | |||
| 1187 | Ga0495600_0079593 | |||
| 1188 | Ga0495581_0011875 | |||
| 1189 | Ga0495636_0090715 | |||
| 1190 | Ga0495674_0025323 | |||
| 1191 | Ga0495674_0059161 | |||
| 1192 | Ga0495672_0009893 | |||
| 1193 | Ga0495680_0010512 | |||
| 1194 | Ga0495677_0072977 | |||
| 1195 | Ga0495684_0078933 | |||
| 1196 | Ga0495684_0312145 | |||
| 1197 | Ga0495602_0137226 | |||
| 1198 | Ga0495602_0216178 | |||
| 1199 | Ga0496100_0027053 | |||
| 1200 | Ga0496100_0035074 | |||
| 1201 | Ga0496100_0065742 | |||
| 1202 | Ga0496100_0166149 | |||
| 1203 | Ga0496100_0284555 | |||
| 1204 | Ga0496101_0036954 | |||
| 1205 | Ga0496101_0042810 | |||
| 1206 | Ga0496101_0061044 | |||
| 1207 | Ga0496101_0589316 | |||
| 1208 | Ga0496102_0028138 | |||
| 1209 | Ga0496102_0046379 | |||
| 1210 | Ga0496102_0111680 | |||
| 1211 | Ga0496102_0131213 | |||
| 1212 | Ga0496102_0185069 | |||
| 1213 | Ga0496102_0214854 | |||
| 1214 | Ga0496102_0303612 | |||
| 1215 | Ga0496102_0394511 | |||
| 1216 | Ga0496102_0439964 | |||
| 1217 | Ga0496103_0002948 | |||
| 1218 | Ga0496103_0018416 | |||
| 1219 | Ga0496103_0048356 | |||
| 1220 | Ga0496103_0138532 | |||
| 1221 | Ga0496104_0011401 | |||
| 1222 | Ga0496104_0014720 | |||
| 1223 | Ga0496104_0239871 | |||
| 1224 | Ga0496104_0272466 | |||
| 1225 | Ga0496104_0277598 | |||
| 1226 | Ga0496105_0003750 | |||
| 1227 | Ga0496105_0011989 | |||
| 1228 | Ga0496105_0014965 | |||
| 1229 | Ga0496105_0041384 | |||
| 1230 | Ga0496105_0075158 | |||
| 1231 | Ga0496106_0029050 | |||
| 1232 | Ga0496106_0032466 | |||
| 1233 | Ga0496106_0095253 | |||
| 1234 | Ga0496106_0109180 | |||
| 1235 | Ga0496106_0406935 | |||
| 1236 | Ga0496107_0007757 | |||
| 1237 | Ga0496107_0028715 | |||
| 1238 | Ga0496107_0149601 | |||
| 1239 | Ga0496107_0204579 | |||
| 1240 | Ga0496108_0000280 | |||
| 1241 | Ga0496108_0002187 | |||
| 1242 | Ga0496108_0013567 | |||
| 1243 | Ga0496108_0027313 | |||
| 1244 | Ga0496108_0031681 | |||
| 1245 | Ga0496108_0041398 | |||
| 1246 | Ga0496108_0187564 | |||
| 1247 | Ga0496109_0004717 | |||
| 1248 | Ga0496109_0023972 | |||
| 1249 | Ga0496109_0028864 | |||
| 1250 | Ga0496109_0060434 | |||
| 1251 | Ga0496109_0102528 | |||
| 1252 | Ga0496109_0267187 | |||
| 1253 | Ga0496109_0323528 | |||
| 1254 | Ga0496110_0018244 | |||
| 1255 | Ga0496110_0078936 | |||
| 1256 | Ga0496110_0099042 | |||
| 1257 | Ga0496110_0156799 | |||
| 1258 | Ga0496110_0166115 | |||
| 1259 | Ga0496111_0006961 | |||
| 1260 | Ga0496111_0011997 | |||
| 1261 | Ga0496111_0021774 | |||
| 1262 | Ga0496111_0099193 | |||
| 1263 | Ga0496111_0159308 | |||
| 1264 | Ga0496111_0220647 | |||
| 1265 | Ga0496112_0008587 | |||
| 1266 | Ga0496112_0038256 | |||
| 1267 | Ga0496112_0124515 | |||
| 1268 | Ga0496112_0134172 | |||
| 1269 | Ga0496112_0210580 | |||
| 1270 | Ga0496112_0257661 | |||
| 1271 | Ga0496112_0269957 | |||
| 1272 | Ga0496112_0316714 | |||
| 1273 | Ga0496112_0482802 | |||
| 1274 | Ga0496112_0530489 | |||
| 1275 | Ga0496113_0010111 | |||
| 1276 | Ga0496113_0017952 | |||
| 1277 | Ga0496113_0062117 | |||
| 1278 | Ga0496113_0070924 | |||
| 1279 | Ga0496113_0079609 | |||
| 1280 | Ga0496113_0081278 | |||
| 1281 | Ga0496113_0242720 | |||
| 1282 | Ga0496113_0291134 | |||
| 1283 | Ga0496114_0138602 | |||
| 1284 | Ga0496114_0195378 | |||
| 1285 | Ga0496114_0205871 | |||
| 1286 | Ga0496115_0010920 | |||
| 1287 | Ga0496115_0023718 | |||
| 1288 | Ga0496115_0054640 | |||
| 1289 | Ga0496115_0133752 | |||
| 1290 | Ga0496115_0192255 | |||
| 1291 | Ga0496115_0349536 | |||
| 1292 | Ga0496116_0078041 | |||
| 1293 | Ga0496118_0008202 | |||
| 1294 | Ga0496119_0023805 | |||
| 1295 | Ga0496120_0139969 | |||
| 1296 | Ga0496124_0034524 | |||
| 1297 | Ga0496124_0042171 | |||
| 1298 | Ga0496126_0001669 | |||
| 1299 | Ga0501031_0001074 | |||
| 1300 | Ga0501031_0020539 | |||
| 1301 | Ga0501032_0062003 | |||
| 1302 | Ga0501033_0011795 | |||
| 1303 | Ga0501033_0043089 | |||
| 1304 | Ga0501036_0000458 | |||
| 1305 | Ga0501036_0000879 | |||
| 1306 | Ga0501037_0010141 | |||
| 1307 | Ga0501037_0016319 | |||
| 1308 | Ga0501038_0002045 | |||
| 1309 | Ga0501038_0011266 | |||
| 1310 | Ga0501039_0002275 | |||
| 1311 | Ga0501040_0000165 | |||
| 1312 | Ga0501040_0001288 | |||
| 1313 | Ga0501040_0343092 | |||
| 1314 | Ga0501041_0000036 | |||
| 1315 | Ga0501041_0000751 | |||
| 1316 | Ga0501041_0346076 | |||
| 1317 | Ga0501042_0000114 | |||
| 1318 | Ga0501042_0000773 | |||
| 1319 | Ga0501042_0000870 | |||
| 1320 | Ga0501042_0010184 | |||
| 1321 | Ga0501043_0007544 | |||
| 1322 | Ga0501043_0065696 | |||
| 1323 | Ga0501046_0000353 | |||
| 1324 | Ga0501046_0006512 | |||
| 1325 | Ga0501047_0119805 | |||
| 1326 | Ga0501048_0000036 | |||
| 1327 | Ga0501048_0001504 | |||
| 1328 | Ga0501068_0019621 | |||
| 1329 | Ga0501069_0004934 | |||
| 1330 | Ga0501069_0029945 | |||
| 1331 | Ga0501070_0114033 | |||
| 1332 | Ga0501071_0000198 | |||
| 1333 | Ga0501071_0032381 | |||
| 1334 | Ga0501072_0000540 | |||
| 1335 | Ga0501072_0007301 | |||
| 1336 | Ga0501073_0287740 | |||
| 1337 | Ga0501074_0001709 | |||
| 1338 | Ga0501074_0002235 | |||
| 1339 | Ga0501075_0000081 | |||
| 1340 | Ga0501075_0001803 | |||
| 1341 | Ga0501076_0000318 | |||
| 1342 | Ga0501076_0000620 | |||
| 1343 | Ga0501077_0001186 | |||
| 1344 | Ga0501077_0012987 | |||
| 1345 | Ga0501079_0007867 | |||
| 1346 | Ga0501079_0013533 | |||
| 1347 | Ga0501080_0019483 | |||
| 1348 | Ga0501080_0084498 | |||
| 1349 | Ga0501081_0000200 | |||
| 1350 | Ga0501081_0001725 | |||
| 1351 | Ga0501083_0130084 | |||
| 1352 | Ga0501035_0005748 | |||
| 1353 | Ga0501035_0027940 | |||
| 1354 | Ga0501044_0389257 | |||
| 1355 | Ga0501045_0000509 | |||
| 1356 | Ga0501045_0001062 | |||
| 1357 | nmdc:mga03n38_8624_c1 | |||
| 1358 | nmdc:mga00v17_18633_c1 | |||
| 1359 | nmdc:mga0yw44_6817_c1 | |||
| 1360 | nmdc:mga06z11_17081_c1 | |||
| 1361 | nmdc:mga05p37_20126_c1 | |||
| 1362 | nmdc:mga05p37_359658_c1 | |||
| 1363 | nmdc:mga05p37_563656_c1 | |||
| 1364 | nmdc:mga09592_121710_c1 | |||
| 1365 | nmdc:mga09592_418705_c1 | |||
| 1366 | nmdc:mga0qj67_115089_c1 | |||
| 1367 | nmdc:mga0qj67_372573_c1 | |||
| 1368 | nmdc:mga0qj67_636123_c1 | |||
| 1369 | nmdc:mga0qj67_70792_c1 | |||
| 1370 | nmdc:mga06r32_306624_c1 | |||
| 1371 | nmdc:mga06r32_36033_c1 | |||
| 1372 | nmdc:mga08y16_190700_c1 | |||
| 1373 | nmdc:mga08y16_227487_c1 | |||
| 1374 | nmdc:mga08y16_242846_c1 | |||
| 1375 | nmdc:mga08y16_248793_c1 | |||
| 1376 | nmdc:mga08y16_46839_c1 | |||
| 1377 | nmdc:mga0n895_455288_c1 | |||
| 1378 | nmdc:mga0n895_590122_c1 | |||
| 1379 | nmdc:mga0n895_75224_c1 | |||
| 1380 | nmdc:mga0rr50_18097_c1 | |||
| 1381 | nmdc:mga0rr50_232399_c1 | |||
| 1382 | nmdc:mga08x19_209780_c1 | |||
| 1383 | nmdc:mga0a205_251960_c1 | |||
| 1384 | nmdc:mga0a205_687480_c1 | |||
| 1385 | nmdc:mga0sz30_31984_c1 | |||
| 1386 | Ga0495612_0048563 | |||
| 1387 | Ga0495612_0101341 | |||
| 1388 | Ga0495595_0036515 | |||
| 1389 | Ga0500646_0032872 | |||
| 1390 | Ga0500651_0114083 | |||
| 1391 | Ga0500556_0101835 | |||
| 1392 | Ga0500594_0013130 | |||
| 1393 | Ga0500573_0000014 | |||
| 1394 | Ga0501084_0001726 | |||
| 1395 | Ga0501084_0075782 | |||
| 1396 | Ga0501084_0275289 | |||
| 1397 | Ga0590071_030606 | |||
| 1398 | Ga0501082_0000746 | |||
| 1399 | Ga0501082_0002688 | |||
| 1400 | Ga0530510_0000421 | |||
| 1401 | Ga0530510_0002045 | |||
| 1402 | 2643875295 | |||
| 1403 | 2644382351 | |||
| 1404 | 2676483638 | |||
| 1405 | 2753076351 | |||
| 1406 | 2791912420 | |||
| 1407 | 2867314809 | |||
| 1408 | 2867322177 | |||
| 1409 | 2870623232 | |||
| 1410 | 2873319826 | |||
| 1411 | 2891397179 | |||
| 1412 | 2895436997 | |||
| 1413 | 2895661384 | |||
| 1414 | 2905927972 | |||
| 1415 | 8055066357 | |||
| 1416 | 8055180468 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7l0b-assembly4.cif.gz_D | crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme | 0.785 | 2 | 222 |
| 4bp0-assembly1.cif.gz_A | crystal structure of the closed form of pseudomonas aeruginosa spm-1 | 0.7824 | 2 | 224 |
| 8d2z-assembly2.cif.gz_B | crystal structure of a metallo-beta-lactamase superfamily protein from burkholderia cenocepacia | 0.7801 | 1 | 236 |
| 7l0b-assembly1.cif.gz_A | crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme | 0.7762 | 1 | 222 |
| 2zzi-assembly1.cif.gz_A | crystal structure of ttha1623 in a di-iron-bound form | 0.7761 | 11 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69728_4_359_3.60.15.30 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Metallo-beta-lactamase domain | 0.7761 | 1 | 235 | 3.60.15.30 |
| af_O07720_1_237_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7736 | 1 | 227 | 3.60.15.10 |
| af_I6XHY3_12_197_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.7626 | 1 | 214 | 3.60.15.10 |
| af_Q9UT36_7_256_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.756 | 11 | 209 | 3.60.15.10 |
| af_A0A1D6K1V4_1_276_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.753 | 9 | 209 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5NQ58-F1-model_v4 | MBL fold metallo-hydrolase | 0.9943 | 1 | 81 |
GO:0016787
|
| AF-A0A3N5NQ58-F1-model_v4 | MBL fold metallo-hydrolase | 0.9705 | 1 | 81 |
GO:0016787
|
| AF-A0A7Y9U1Q6-F1-model_v4 | deleted | 0.9606 | 1 | 265 |
|
| AF-A0A1M4EBC1-F1-model_v4 | Metallo-beta-lactamase superfamily domain protein | 0.9549 | 1 | 268 |
GO:0016787
GO:0017001 GO:0042597 GO:0046677 GO:0046872 |
| AF-A0A7W7SKN6-F1-model_v4 | Glyoxylase-like metal-dependent hydrolase (Beta-lactamase superfamily II) | 0.9539 | 2 | 266 |
GO:0016787
GO:0017001 GO:0042597 GO:0046677 GO:0046872 |