F476447

General Info

Members Datasets Scaffolds Average Seq Length
706 328 1412 109

Family's Representative Sequence

Representative Sequence 3300003579|Ga0007429J51699_1019794|Ga0007429J51699_10197941
Length 133
Sequence VFTVQSRTRNDRDLLPSPTEKKEHLVAEMQAITDADFDTSVLKSDKPVLVDFWAEWCGPCRQVDPILKEIAAEHGEKLTFVKMNVDENPVTPATYRVTGIPTLNVFQNGELVKQIVGAKPKAALLGELQDFIG

Samples

Sample ID Description Type Environment
1 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002866 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_15 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
160 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
185 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
189 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
190 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
262 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
271 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
289 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
290 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.7
Metatranscriptomes 31.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.05
Nodule 0
Rhizoplane 3.26
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007429J51699_1019794 3300003579 Bacteria 565
2 JGI24746J21847_1009616 3300001977 Bacteria 1441
3 JGI24739J22299_10097504 3300001989 Bacteria 890
4 JGI24743J22301_10001400 3300001991 Bacteria 3321
5 JGI24745J21846_1036155 3300002073 Bacteria 604
6 JGI24749J21850_1022144 3300002076 Bacteria 901
7 JGI24744J21845_10015041 3300002077 Bacteria 1549
8 JGI24742J22300_10028344 3300002244 Bacteria 972
9 Ga0006772J43183_102204 3300002866 Bacteria 507
10 Ga0006762J43184_103041 3300002872 Bacteria 534
11 Ga0006779J45831_100903 3300003160 Bacteria 971
12 Ga0006778J45830_1007436 3300003162 Bacteria 1587
13 Ga0006778J45830_1009882 3300003162 Bacteria 1076
14 Ga0006759J45824_1001904 3300003163 Bacteria 2660
15 Ga0006759J45824_1004271 3300003163 Bacteria 1034
16 Ga0006759J45824_1005795 3300003163 Bacteria 1583
17 Ga0006759J45824_1007636 3300003163 Bacteria 502
18 Ga0006758J48902_1004928 3300003300 Bacteria 730
19 Ga0006758J48902_1008851 3300003300 Bacteria 528
20 Ga0006770J48903_1005475 3300003305 Bacteria 545
21 Ga0006777J48905_1002308 3300003308 Bacteria 2301
22 Ga0006777J48905_1004409 3300003308 Bacteria 1503
23 Ga0006777J48905_1006164 3300003308 Bacteria 551
24 Ga0007417J51691_1005883 3300003544 Bacteria 591
25 Ga0007417J51691_1008755 3300003544 Bacteria 1156
26 Ga0007427J51700_102324 3300003559 Bacteria 1723
27 Ga0007427J51700_107198 3300003559 Bacteria 1585
28 Ga0006781J51513_1001674 3300003568 Bacteria 2238
29 Ga0006781J51513_1002209 3300003568 Bacteria 638
30 Ga0006781J51513_1002746 3300003568 Bacteria 559
31 Ga0007410J51695_1002649 3300003574 Bacteria 1624
32 Ga0007410J51695_1009494 3300003574 Bacteria 517
33 Ga0007410J51695_1015236 3300003574 Bacteria 507
34 Ga0007410J51695_1016414 3300003574 Bacteria 694
35 Ga0007410J51695_1018728 3300003574 Bacteria 506
36 Ga0007409J51694_1006294 3300003575 Bacteria 525
37 Ga0007409J51694_1007675 3300003575 Bacteria 1567
38 Ga0007416J51690_1003502 3300003577 Bacteria 1697
39 Ga0007416J51690_1006986 3300003577 Bacteria 757
40 Ga0007429J51699_1002663 3300003579 Bacteria 711
41 Ga0007429J51699_1003068 3300003579 Bacteria 1240
42 Ga0007429J51699_1006124 3300003579 Bacteria 1183
43 Ga0007429J51699_1006160 3300003579 Bacteria 1910
44 Ga0007429J51699_1007780 3300003579 Bacteria 601
45 Ga0007429J51699_1018308 3300003579 Bacteria 708
46 Ga0007411J51799_101708 3300003611 Bacteria 2178
47 Ga0007411J51799_102589 3300003611 Bacteria 569
48 Ga0007411J51799_102961 3300003611 Bacteria 595
49 Ga0007411J51799_106181 3300003611 Bacteria 1575
50 Ga0007415J51800_103035 3300003613 Bacteria 1985
51 Ga0032354_1006717 3300003693 Bacteria 1190
52 Ga0032354_1015477 3300003693 Bacteria 1720
53 Ga0032354_1020920 3300003693 Bacteria 738
54 Ga0006780_1001792 3300003735 Bacteria 1959
55 Ga0006780_1009738 3300003735 Bacteria 1029
56 Ga0058858_1009502 3300004785 Bacteria 888
57 Ga0058859_10038219 3300004798 Bacteria 712
58 Ga0058859_11695703 3300004798 Bacteria 570
59 Ga0058861_12054472 3300004800 Bacteria 656
60 Ga0058860_10054766 3300004801 Bacteria 515
61 Ga0058860_10054900 3300004801 Bacteria 785
62 Ga0058860_10093393 3300004801 Bacteria 590
63 Ga0070683_100075407 3300005329 Bacteria 3151
64 Ga0070683_101118642 3300005329 Bacteria 757
65 Ga0070683_101877379 3300005329 Bacteria 576
66 Ga0070670_100209201 3300005331 Bacteria 1696
67 Ga0070670_101244994 3300005331 Bacteria 681
68 Ga0070680_100938550 3300005336 Bacteria 747
69 Ga0070682_100025449 3300005337 Bacteria 3532
70 Ga0070682_100123310 3300005337 Bacteria 1743
71 Ga0070682_100276632 3300005337 Bacteria 1222
72 Ga0068868_101429471 3300005338 Bacteria 646
73 Ga0070660_100200936 3300005339 Bacteria 1617
74 Ga0070660_101798575 3300005339 Bacteria 522
75 Ga0070689_100096501 3300005340 Bacteria 2337
76 Ga0070687_100418806 3300005343 Bacteria 883
77 Ga0070687_100441799 3300005343 Bacteria 863
78 Ga0070661_100392577 3300005344 Bacteria 1096
79 Ga0070661_100645437 3300005344 Bacteria 859
80 Ga0070661_101472549 3300005344 Bacteria 574
81 Ga0070692_10002265 3300005345 Bacteria 7387
82 Ga0070692_10353461 3300005345 Bacteria 914
83 Ga0070692_10471192 3300005345 Bacteria 808
84 Ga0070692_10864021 3300005345 Bacteria 623
85 Ga0070669_100166285 3300005353 Bacteria 1717
86 Ga0070675_100020141 3300005354 Bacteria 5322
87 Ga0070675_100576403 3300005354 Bacteria 1019
88 Ga0070671_101672093 3300005355 Bacteria 565
89 Ga0070674_100013454 3300005356 Bacteria 5060
90 Ga0070688_100177132 3300005365 Bacteria 1476
91 Ga0070659_100069983 3300005366 Bacteria 2786
92 Ga0070667_100148244 3300005367 Bacteria 2059
93 Ga0070667_100198689 3300005367 Bacteria 1779
94 Ga0070703_10385186 3300005406 Bacteria 607
95 Ga0070701_10013100 3300005438 Bacteria 3762
96 Ga0070700_100003127 3300005441 Bacteria 8503
97 Ga0070700_101028756 3300005441 Bacteria 679
98 Ga0070700_101157685 3300005441 Bacteria 644
99 Ga0070700_102000779 3300005441 Bacteria 503
100 Ga0070663_100218896 3300005455 Bacteria 1494
101 Ga0070663_100664251 3300005455 Bacteria 883
102 Ga0070663_101120403 3300005455 Bacteria 689
103 Ga0070662_100045578 3300005457 Bacteria 3147
104 Ga0070662_101328249 3300005457 Bacteria 619
105 Ga0070662_101718555 3300005457 Bacteria 542
106 Ga0068867_100007670 3300005459 Bacteria 7636
107 Ga0068867_100763786 3300005459 Bacteria 859
108 Ga0070699_100978708 3300005518 Bacteria 775
109 Ga0070679_101901753 3300005530 Bacteria 544
110 Ga0070684_101558227 3300005535 Bacteria 623
111 Ga0070684_102158714 3300005535 Bacteria 525
112 Ga0068853_100027901 3300005539 Bacteria 4747
113 Ga0070672_100011435 3300005543 Bacteria 6190
114 Ga0070672_100749956 3300005543 Bacteria 857
115 Ga0070686_100067847 3300005544 Bacteria 2325
116 Ga0070686_100266521 3300005544 Bacteria 1258
117 Ga0070693_100324171 3300005547 Bacteria 1046
118 Ga0070664_100354816 3300005564 Bacteria 1335
119 Ga0070664_101787996 3300005564 Bacteria 583
120 Ga0068857_100442816 3300005577 Bacteria 1214
121 Ga0068854_100010445 3300005578 Bacteria 6021
122 Ga0068854_100851561 3300005578 Bacteria 798
123 Ga0068856_100699705 3300005614 Bacteria 1034
124 Ga0068856_100725748 3300005614 Bacteria 1014
125 Ga0068856_101875301 3300005614 Bacteria 611
126 Ga0070702_100015671 3300005615 Bacteria 3875
127 Ga0070702_100443599 3300005615 Bacteria 940
128 Ga0070702_100740477 3300005615 Bacteria 754
129 Ga0068852_100004510 3300005616 Bacteria 9848
130 Ga0068852_100526624 3300005616 Bacteria 1180
131 Ga0068852_100650195 3300005616 Bacteria 1062
132 Ga0068852_101353374 3300005616 Bacteria 734
133 Ga0068864_100058007 3300005618 Bacteria 3345
134 Ga0068861_100003671 3300005719 Bacteria 10240
135 Ga0068851_10657888 3300005834 Bacteria 642
136 Ga0068870_10040543 3300005840 Bacteria 2415
137 Ga0068870_10188807 3300005840 Bacteria 1242
138 Ga0068870_10507503 3300005840 Bacteria 805
139 Ga0068858_101591226 3300005842 Bacteria 645
140 Ga0068862_100199880 3300005844 Bacteria 1802
141 Ga0068862_102281491 3300005844 Bacteria 553
142 Ga0075365_10010566 3300006038 Bacteria 5383
143 Ga0075365_10012524 3300006038 Bacteria 5042
144 Ga0075365_10022574 3300006038 Bacteria 3945
145 Ga0075365_10035274 3300006038 Bacteria 3235
146 Ga0075365_10077901 3300006038 Bacteria 2240
147 Ga0075365_10099635 3300006038 Bacteria 1988
148 Ga0075365_10147369 3300006038 Bacteria 1636
149 Ga0075365_10167614 3300006038 Bacteria 1532
150 Ga0075365_10203794 3300006038 Bacteria 1386
151 Ga0075365_10269597 3300006038 Bacteria 1197
152 Ga0075365_10276006 3300006038 Bacteria 1182
153 Ga0075365_10375715 3300006038 Bacteria 1002
154 Ga0075365_10484994 3300006038 Bacteria 873
155 Ga0075365_10536530 3300006038 Bacteria 827
156 Ga0075365_10741631 3300006038 Bacteria 693
157 Ga0075368_10003462 3300006042 Bacteria 5273
158 Ga0075368_10130571 3300006042 Bacteria 1044
159 Ga0075368_10462476 3300006042 Bacteria 563
160 Ga0075363_100007207 3300006048 Bacteria 5097
161 Ga0075363_100025355 3300006048 Bacteria 3023
162 Ga0075363_100274972 3300006048 Bacteria 973
163 Ga0075363_100463665 3300006048 Bacteria 749
164 Ga0075364_10053098 3300006051 Bacteria 2649
165 Ga0075364_10080423 3300006051 Bacteria 2154
166 Ga0075364_10177387 3300006051 Bacteria 1441
167 Ga0075364_10195145 3300006051 Bacteria 1371
168 Ga0075364_10598275 3300006051 Bacteria 753
169 Ga0075364_10619116 3300006051 Bacteria 740
170 Ga0075364_10948274 3300006051 Bacteria 585
171 Ga0075362_10001982 3300006177 Bacteria 6735
172 Ga0075362_10145186 3300006177 Bacteria 1136
173 Ga0075367_10008489 3300006178 Bacteria 5324
174 Ga0075367_10041256 3300006178 Bacteria 2697
175 Ga0075367_10079899 3300006178 Bacteria 1977
176 Ga0075367_10486526 3300006178 Bacteria 782
177 Ga0075367_10573805 3300006178 Bacteria 717
178 Ga0075370_10010626 3300006353 Bacteria 4823
179 Ga0075370_10022183 3300006353 Bacteria 3484
180 Ga0075370_10031160 3300006353 Bacteria 2977
181 Ga0075370_10032926 3300006353 Bacteria 2900
182 Ga0075370_10092564 3300006353 Bacteria 1745
183 Ga0075370_10241040 3300006353 Bacteria 1071
184 Ga0075370_10242016 3300006353 Bacteria 1068
185 Ga0068871_102126996 3300006358 Bacteria 535
186 Ga0075428_100103855 3300006844 Bacteria 3099
187 Ga0068865_100008871 3300006881 Bacteria 6219
188 Ga0068865_101615447 3300006881 Bacteria 583
189 Ga0111539_10043868 3300009094 Bacteria 5359
190 Ga0105245_10011376 3300009098 Bacteria 7749
191 Ga0105245_11393902 3300009098 Bacteria 751
192 Ga0114129_11463673 3300009147 Bacteria 840
193 Ga0105243_10001673 3300009148 Bacteria 19178
194 Ga0105243_10866767 3300009148 Bacteria 896
195 Ga0105243_10922639 3300009148 Bacteria 870
196 Ga0105243_12551359 3300009148 Bacteria 550
197 Ga0105241_12099449 3300009174 Bacteria 558
198 Ga0105248_10082129 3300009177 Bacteria 3623
199 Ga0105238_10422600 3300009551 Bacteria 1328
200 Ga0105238_10902510 3300009551 Bacteria 902
201 Ga0105238_11514826 3300009551 Bacteria 700
202 Ga0105249_10013394 3300009553 Bacteria 7242
203 Ga0105239_10192715 3300010375 Bacteria 2281
204 Ga0105239_10695587 3300010375 Bacteria 1162
205 Ga0105246_10062699 3300011119 Bacteria 2591
206 Ga0105246_10298650 3300011119 Bacteria 1299
207 Ga0105246_10851574 3300011119 Bacteria 813
208 Ga0157371_10251325 3300013102 Bacteria 1273
209 Ga0157370_11755229 3300013104 Bacteria 557
210 Ga0157369_12557264 3300013105 Bacteria 517
211 Ga0157374_10398536 3300013296 Bacteria 1373
212 Ga0157374_10739205 3300013296 Bacteria 998
213 Ga0157378_11271178 3300013297 Bacteria 777
214 Ga0157372_10066507 3300013307 Bacteria 4049
215 Ga0157372_11294225 3300013307 Bacteria 841
216 Ga0157375_10156972 3300013308 Bacteria 2415
217 Ga0157375_10618071 3300013308 Bacteria 1242
218 Ga0157375_11682659 3300013308 Bacteria 751
219 Ga0163163_10935310 3300014325 Bacteria 930
220 Ga0163163_10969402 3300014325 Bacteria 914
221 Ga0163163_11455401 3300014325 Bacteria 747
222 Ga0163163_12377462 3300014325 Bacteria 588
223 Ga0157380_10007376 3300014326 Bacteria 7807
224 Ga0157380_10333371 3300014326 Bacteria 1412
225 Ga0157380_10957408 3300014326 Bacteria 886
226 Ga0157380_11471047 3300014326 Bacteria 733
227 Ga0157377_10074838 3300014745 Bacteria 1965
228 Ga0157377_10376249 3300014745 Bacteria 960
229 Ga0157376_11365260 3300014969 Bacteria 740
230 Ga0163161_10269882 3300017792 Bacteria 1331
231 Ga0163161_10340268 3300017792 Bacteria 1190
232 Ga0197907_10452887 3300020069 Bacteria 561
233 Ga0197907_10905443 3300020069 Bacteria 1267
234 Ga0197907_11199106 3300020069 Bacteria 2146
235 Ga0197907_11330210 3300020069 Bacteria 903
236 Ga0206356_11714103 3300020070 Bacteria 1003
237 Ga0206349_1171247 3300020075 Bacteria 617
238 Ga0206349_1503519 3300020075 Bacteria 611
239 Ga0206349_1713601 3300020075 Bacteria 1009
240 Ga0206355_1022157 3300020076 Bacteria 574
241 Ga0206355_1496161 3300020076 Bacteria 1525
242 Ga0206351_10031167 3300020077 Bacteria 1170
243 Ga0206351_10074860 3300020077 Bacteria 687
244 Ga0206352_10571357 3300020078 Bacteria 680
245 Ga0206352_11226993 3300020078 Bacteria 581
246 Ga0206350_11328671 3300020080 Bacteria 565
247 Ga0206350_11441905 3300020080 Bacteria 748
248 Ga0206350_11479100 3300020080 Bacteria 1111
249 Ga0206354_10221161 3300020081 Bacteria 2388
250 Ga0206354_11390140 3300020081 Bacteria 1090
251 Ga0206354_11516430 3300020081 Bacteria 1202
252 Ga0206354_11620488 3300020081 Bacteria 1201
253 Ga0206353_10150450 3300020082 Bacteria 554
254 Ga0206353_10168293 3300020082 Bacteria 856
255 Ga0206353_11732002 3300020082 Bacteria 699
256 Ga0206353_11905654 3300020082 Bacteria 1365
257 Ga0154015_1240846 3300020610 Bacteria 582
258 Ga0154015_1561856 3300020610 Bacteria 1557
259 Ga0213875_10412815 3300021388 Bacteria 644
260 Ga0224712_10012833 3300022467 Bacteria 2651
261 Ga0207697_10182577 3300025315 Bacteria 920
262 Ga0207688_10013512 3300025901 Bacteria 4437
263 Ga0207688_10400848 3300025901 Bacteria 851
264 Ga0207643_10023437 3300025908 Bacteria 3403
265 Ga0207643_10156638 3300025908 Bacteria 1368
266 Ga0207657_10204633 3300025919 Bacteria 1586
267 Ga0207657_10256009 3300025919 Bacteria 1394
268 Ga0207649_10442567 3300025920 Bacteria 979
269 Ga0207681_10167751 3300025923 Bacteria 1661
270 Ga0207681_11552784 3300025923 Bacteria 555
271 Ga0207694_10229436 3300025924 Bacteria 1516
272 Ga0207694_10589042 3300025924 Bacteria 935
273 Ga0207694_10723724 3300025924 Bacteria 840
274 Ga0207694_10736444 3300025924 Bacteria 832
275 Ga0207650_10922993 3300025925 Bacteria 741
276 Ga0207659_10032018 3300025926 Bacteria 3605
277 Ga0207687_10126312 3300025927 Bacteria 1921
278 Ga0207687_10162395 3300025927 Bacteria 1716
279 Ga0207664_10003771 3300025929 Bacteria 10183
280 Ga0207690_10081895 3300025932 Bacteria 2256
281 Ga0207690_10138263 3300025932 Bacteria 1792
282 Ga0207706_10035400 3300025933 Bacteria 4439
283 Ga0207706_10434275 3300025933 Bacteria 1137
284 Ga0207706_11222644 3300025933 Bacteria 624
285 Ga0207709_10013249 3300025935 Bacteria 4548
286 Ga0207709_10149094 3300025935 Bacteria 1618
287 Ga0207709_10541484 3300025935 Bacteria 914
288 Ga0207670_10055858 3300025936 Bacteria 2670
289 Ga0207669_10004166 3300025937 Bacteria 6338
290 Ga0207704_10054152 3300025938 Bacteria 2444
291 Ga0207704_10915069 3300025938 Bacteria 738
292 Ga0207704_11478846 3300025938 Bacteria 583
293 Ga0207691_10061679 3300025940 Bacteria 3405
294 Ga0207691_10241376 3300025940 Bacteria 1562
295 Ga0207691_11236854 3300025940 Bacteria 618
296 Ga0207711_10214019 3300025941 Bacteria 1761
297 Ga0207661_10032421 3300025944 Bacteria 4047
298 Ga0207661_10297913 3300025944 Bacteria 1445
299 Ga0207661_10464484 3300025944 Bacteria 1154
300 Ga0207661_10837693 3300025944 Bacteria 847
301 Ga0207661_11285383 3300025944 Bacteria 672
302 Ga0207661_11335858 3300025944 Bacteria 658
303 Ga0207679_10188206 3300025945 Bacteria 1714
304 Ga0207679_10251895 3300025945 Bacteria 1502
305 Ga0207679_11037745 3300025945 Bacteria 752
306 Ga0207679_11222030 3300025945 Bacteria 690
307 Ga0207679_11642900 3300025945 Bacteria 588
308 Ga0207651_10073530 3300025960 Bacteria 2431
309 Ga0207651_11212229 3300025960 Bacteria 678
310 Ga0207712_10017189 3300025961 Bacteria 4694
311 Ga0207668_10021435 3300025972 Bacteria 4121
312 Ga0207640_10024174 3300025981 Bacteria 3662
313 Ga0207658_10204414 3300025986 Bacteria 1651
314 Ga0207658_10281419 3300025986 Bacteria 1426
315 Ga0207677_10697748 3300026023 Bacteria 900
316 Ga0207703_11448690 3300026035 Bacteria 661
317 Ga0207639_10224281 3300026041 Bacteria 1625
318 Ga0207678_10238120 3300026067 Bacteria 1559
319 Ga0207678_10527780 3300026067 Bacteria 1031
320 Ga0207678_10537431 3300026067 Bacteria 1021
321 Ga0207708_10000836 3300026075 Bacteria 23216
322 Ga0207708_10265440 3300026075 Bacteria 1387
323 Ga0207708_10739169 3300026075 Bacteria 844
324 Ga0207708_10931314 3300026075 Bacteria 753
325 Ga0207702_10451435 3300026078 Bacteria 1247
326 Ga0207702_10770362 3300026078 Bacteria 950
327 Ga0207641_12274091 3300026088 Bacteria 542
328 Ga0207648_10000921 3300026089 Bacteria 33155
329 Ga0207648_10823360 3300026089 Bacteria 865
330 Ga0207648_10880207 3300026089 Bacteria 836
331 Ga0207676_10045822 3300026095 Bacteria 3381
332 Ga0207674_10269806 3300026116 Bacteria 1649
333 Ga0207674_10517924 3300026116 Bacteria 1152
334 Ga0207675_100002314 3300026118 Bacteria 18926
335 Ga0207683_10520764 3300026121 Bacteria 1099
336 Ga0207683_10815153 3300026121 Bacteria 866
337 Ga0207698_10434301 3300026142 Bacteria 1263
338 Ga0209813_10018787 3300027866 Bacteria 1914
339 Ga0209813_10332379 3300027866 Bacteria 598
340 Ga0207428_10172973 3300027907 Bacteria 1635
341 Ga0268265_10050523 3300028380 Bacteria 3134
342 Ga0316177_1080917 3300030731 Bacteria 862
343 Ga0314311_1020573 3300030733 Bacteria 517
344 Ga0314311_1068941 3300030733 Bacteria 724
345 Ga0316183_1119379 3300030742 Bacteria 690
346 Ga0316182_1039819 3300030745 Bacteria 660
347 Ga0316182_1223568 3300030745 Bacteria 574
348 Ga0265320_10202654 3300031240 Bacteria 886
349 Ga0307405_10336815 3300031731 Bacteria 1158
350 Ga0307413_10618771 3300031824 Bacteria 889
351 Ga0307413_11294209 3300031824 Bacteria 637
352 Ga0307410_10059534 3300031852 Bacteria 2607
353 Ga0307410_10131313 3300031852 Bacteria 1840
354 Ga0307410_11979766 3300031852 Bacteria 520
355 Ga0307406_10290033 3300031901 Bacteria 1252
356 Ga0307406_10502391 3300031901 Bacteria 983
357 Ga0307406_11100052 3300031901 Bacteria 686
358 Ga0307407_10043658 3300031903 Bacteria 2521
359 Ga0307407_10050299 3300031903 Bacteria 2383
360 Ga0307407_10263023 3300031903 Bacteria 1187
361 Ga0307407_10927350 3300031903 Bacteria 669
362 Ga0307407_11716114 3300031903 Bacteria 500
363 Ga0307412_10077833 3300031911 Bacteria 2282
364 Ga0307412_10775262 3300031911 Bacteria 830
365 Ga0307412_11098072 3300031911 Bacteria 708
366 Ga0307409_100001523 3300031995 Bacteria 11477
367 Ga0307409_100069451 3300031995 Bacteria 2791
368 Ga0307409_100086335 3300031995 Bacteria 2554
369 Ga0307409_100157671 3300031995 Bacteria 1980
370 Ga0307409_100161358 3300031995 Bacteria 1961
371 Ga0307409_100192898 3300031995 Bacteria 1815
372 Ga0307409_100595420 3300031995 Bacteria 1092
373 Ga0307409_101664210 3300031995 Bacteria 667
374 Ga0307416_100000317 3300032002 Bacteria 24951
375 Ga0307416_100142291 3300032002 Bacteria 2182
376 Ga0307416_101251483 3300032002 Bacteria 848
377 Ga0307416_101864645 3300032002 Bacteria 705
378 Ga0307414_11433050 3300032004 Bacteria 642
379 Ga0307414_11764571 3300032004 Bacteria 577
380 Ga0307411_10033155 3300032005 Bacteria 3201
381 Ga0307411_11262505 3300032005 Bacteria 672
382 Ga0307415_100000352 3300032126 Bacteria 19736
383 Ga0307415_100120319 3300032126 Bacteria 1967
384 Ga0307415_100173688 3300032126 Bacteria 1683
385 Ga0307415_100201173 3300032126 Bacteria 1581
386 Ga0307415_101095218 3300032126 Bacteria 745
387 Ga0373941_0106278 3300035115 Bacteria 984
388 Ga0373960_0183201 3300035121 Bacteria 732
389 Ga0373962_0250417 3300035242 Bacteria 615
390 Ga0395900_0049501 3300037418 Bacteria 4330
391 Ga0395900_0123688 3300037418 Bacteria 2653
392 Ga0395900_0191959 3300037418 Bacteria 2071
393 Ga0395898_0030642 3300037466 Bacteria 5382
394 Ga0395898_1042489 3300037466 Bacteria 753
395 Ga0436364_0904730 3300037853 Bacteria 928
396 Ga0436364_1265199 3300037853 Bacteria 1940
397 Ga0395901_0247520 3300038443 Bacteria 1858
398 Ga0395901_0630595 3300038443 Bacteria 1078
399 Ga0395901_1563688 3300038443 Bacteria 614
400 Ga0436365_0394095 3300039437 Bacteria 1378
401 Ga0451793_1014300 3300041452 Bacteria 650
402 Ga0451797_1292487 3300041453 Bacteria 574
403 Ga0451798_0090801 3300041458 Bacteria 693
404 Ga0451802_1092931 3300041460 Bacteria 716
405 Ga0451833_0073924 3300041491 Bacteria 539
406 Ga0451845_0248573 3300041501 Bacteria 590
407 Ga0451849_0507776 3300041505 Bacteria 831
408 Ga0451849_0843851 3300041505 Bacteria 687
409 Ga0451855_0841227 3300041511 Bacteria 781
410 Ga0451853_0803469 3300041512 Bacteria 752
411 Ga0439434_0250993 3300042435 Bacteria 605
412 Ga0439464_0032062 3300042439 Bacteria 1476
413 Ga0466969_0139918 3300044656 Bacteria 1119
414 Ga0466972_0187525 3300044658 Bacteria 969
415 Ga0466965_0304443 3300044683 Bacteria 865
416 Ga0466965_0468559 3300044683 Bacteria 703
417 Ga0466966_0122970 3300044684 Bacteria 1593
418 Ga0466966_0124590 3300044684 Bacteria 1581
419 Ga0466961_0074429 3300044693 Bacteria 2154
420 Ga0466961_0416768 3300044693 Bacteria 814
421 Ga0466963_0105324 3300044694 Bacteria 1933
422 Ga0466963_1336317 3300044694 Bacteria 503
423 Ga0466971_0294606 3300044719 Bacteria 778
424 Ga0466970_0004511 3300044765 Bacteria 6868
425 Ga0466970_0093416 3300044765 Bacteria 1634
426 Ga0466970_0175001 3300044765 Bacteria 1190
427 Ga0466970_0516891 3300044765 Bacteria 688
428 Ga0466957_0368731 3300044842 Bacteria 977
429 Ga0466960_0016854 3300044901 Bacteria 3176
430 Ga0466960_0017689 3300044901 Bacteria 3113
431 Ga0466960_0200134 3300044901 Bacteria 1091
432 Ga0466960_0247031 3300044901 Bacteria 990
433 Ga0466959_0352543 3300045049 Bacteria 1003
434 Ga0466958_0262394 3300045836 Bacteria 1106
435 Ga0466967_0064272 3300045976 Bacteria 3263
436 Ga0466967_0442771 3300045976 Bacteria 1269
437 Ga0466967_0962216 3300045976 Bacteria 850
438 Ga0466967_1576671 3300045976 Bacteria 654
439 Ga0495603_0558902 3300046455 Bacteria 655
440 Ga0495628_0928041 3300046516 Bacteria 603
441 Ga0495676_0784726 3300047321 Bacteria 614
442 Ga0496101_0218976 3300048904 Bacteria 1477
443 Ga0496101_1003872 3300048904 Bacteria 656
444 Ga0496102_0351372 3300048905 Bacteria 1388
445 Ga0496103_0312448 3300048906 Bacteria 1011
446 Ga0496104_1405796 3300048907 Bacteria 601
447 Ga0496105_0346087 3300048908 Bacteria 1188
448 Ga0496106_0110782 3300048909 Bacteria 2137
449 Ga0496107_0430319 3300048910 Bacteria 981
450 Ga0496107_0845177 3300048910 Bacteria 669
451 Ga0496108_0428651 3300048911 Bacteria 1155
452 Ga0496108_1052580 3300048911 Bacteria 693
453 Ga0496109_0312891 3300048912 Bacteria 1481
454 Ga0496109_0364956 3300048912 Bacteria 1364
455 Ga0496109_1014210 3300048912 Bacteria 767
456 Ga0496110_0083068 3300048913 Bacteria 2857
457 Ga0496110_0766594 3300048913 Bacteria 868
458 Ga0496110_0988069 3300048913 Bacteria 749
459 Ga0496114_0022717 3300048917 Bacteria 5113
460 Ga0496114_0069594 3300048917 Bacteria 2955
461 Ga0501306_023126 3300049127 Bacteria 881
462 Ga0501306_024390 3300049127 Bacteria 864
463 Ga0501306_093462 3300049127 Bacteria 531
464 Ga0501308_003819 3300049128 Bacteria 1419
465 Ga0501308_004480 3300049128 Bacteria 1349
466 Ga0501308_006100 3300049128 Bacteria 1225
467 Ga0501308_016801 3300049128 Bacteria 880
468 Ga0501308_085646 3300049128 Bacteria 507
469 Ga0501309_005703 3300049129 Bacteria 1494
470 Ga0501309_013514 3300049129 Bacteria 1087
471 Ga0501309_074511 3300049129 Bacteria 562
472 Ga0501310_005087 3300049130 Bacteria 1342
473 Ga0501310_007560 3300049130 Bacteria 1163
474 Ga0501310_052513 3300049130 Bacteria 592
475 Ga0501304_006324 3300049160 Bacteria 953
476 Ga0501304_007735 3300049160 Bacteria 893
477 Ga0501304_040774 3300049160 Bacteria 518
478 Ga0501305_024047 3300049161 Bacteria 915
479 Ga0501305_031174 3300049161 Bacteria 832
480 Ga0501305_063859 3300049161 Bacteria 638
481 Ga0501305_065637 3300049161 Bacteria 631
482 Ga0501307_006621 3300049162 Bacteria 1257
483 Ga0501307_011222 3300049162 Bacteria 1050
484 Ga0501307_031411 3300049162 Bacteria 738
485 Ga0501307_045128 3300049162 Bacteria 650
486 Ga0501311_002446 3300049527 Bacteria 1782
487 Ga0501311_005250 3300049527 Bacteria 1413
488 Ga0501311_005351 3300049527 Bacteria 1405
489 Ga0501311_010589 3300049527 Bacteria 1122
490 Ga0501311_022300 3300049527 Bacteria 869
491 Ga0501312_037437 3300049528 Bacteria 782
492 Ga0501312_071746 3300049528 Bacteria 615
493 Ga0501312_105058 3300049528 Bacteria 533
494 Ga0501313_042729 3300049529 Bacteria 613
495 Ga0501313_046442 3300049529 Bacteria 593
496 Ga0501314_003780 3300049530 Bacteria 1233
497 Ga0501314_041995 3300049530 Bacteria 535
498 Ga0501315_009649 3300049531 Bacteria 1145
499 Ga0501315_025868 3300049531 Bacteria 819
500 Ga0501315_077675 3300049531 Bacteria 559
501 Ga0501316_005380 3300049532 Bacteria 1325
502 Ga0501316_005844 3300049532 Bacteria 1290
503 Ga0501316_024591 3300049532 Bacteria 779
504 Ga0501317_003312 3300049533 Bacteria 1597
505 Ga0501317_004777 3300049533 Bacteria 1425
506 Ga0501317_008940 3300049533 Bacteria 1166
507 Ga0501317_025052 3300049533 Bacteria 833
508 Ga0501317_026183 3300049533 Bacteria 821
509 Ga0501317_062857 3300049533 Bacteria 613
510 Ga0501317_078562 3300049533 Bacteria 568
511 Ga0501318_001409 3300049534 Bacteria 1884
512 Ga0501318_001632 3300049534 Bacteria 1807
513 Ga0501318_001981 3300049534 Bacteria 1711
514 Ga0501318_006681 3300049534 Bacteria 1184
515 Ga0501318_017224 3300049534 Bacteria 881
516 Ga0501318_091777 3300049534 Bacteria 504
517 Ga0501319_006371 3300049535 Bacteria 869
518 Ga0501319_006469 3300049535 Bacteria 865
519 Ga0501320_006181 3300049536 Bacteria 1114
520 Ga0501320_007935 3300049536 Bacteria 1033
521 Ga0501320_025726 3300049536 Bacteria 707
522 Ga0501321_001788 3300049537 Bacteria 1777
523 Ga0501321_002215 3300049537 Bacteria 1658
524 Ga0501321_009596 3300049537 Bacteria 1048
525 Ga0501321_014621 3300049537 Bacteria 916
526 Ga0501322_012282 3300049538 Bacteria 679
527 Ga0501322_012935 3300049538 Bacteria 668
528 Ga0501322_023692 3300049538 Bacteria 551
529 Ga0501323_004585 3300049539 Bacteria 1470
530 Ga0501323_012413 3300049539 Bacteria 1041
531 Ga0501324_005615 3300049540 Bacteria 1034
532 Ga0501324_016002 3300049540 Bacteria 732
533 Ga0501324_016555 3300049540 Bacteria 724
534 Ga0501324_017556 3300049540 Bacteria 710
535 Ga0501324_045863 3300049540 Bacteria 508
536 Ga0501325_006989 3300049541 Bacteria 944
537 Ga0501325_012384 3300049541 Bacteria 802
538 Ga0501325_015949 3300049541 Bacteria 746
539 Ga0501325_034006 3300049541 Bacteria 596
540 Ga0501325_056218 3300049541 Bacteria 511
541 Ga0501327_08654 3300049543 Bacteria 650
542 Ga0501329_05042 3300049545 Bacteria 721
543 Ga0501330_008278 3300049546 Bacteria 711
544 Ga0501031_0059073 3300049568 Bacteria 2499
545 Ga0501031_0620993 3300049568 Bacteria 695
546 Ga0501032_0003302 3300049569 Bacteria 12402
547 Ga0501033_0001990 3300049570 Bacteria 17817
548 Ga0501034_0024934 3300049571 Bacteria 6084
549 Ga0501034_0086664 3300049571 Bacteria 3132
550 Ga0501036_0008097 3300049572 Bacteria 8612
551 Ga0501036_0742881 3300049572 Bacteria 810
552 Ga0501037_0002887 3300049573 Bacteria 12464
553 Ga0501037_1099270 3300049573 Bacteria 515
554 Ga0501038_0047397 3300049574 Bacteria 3722
555 Ga0501039_0008326 3300049575 Bacteria 7901
556 Ga0501039_0056304 3300049575 Bacteria 3046
557 Ga0501039_0498862 3300049575 Bacteria 956
558 Ga0501040_0037342 3300049576 Bacteria 3300
559 Ga0501040_0051996 3300049576 Bacteria 2804
560 Ga0501040_0056318 3300049576 Bacteria 2698
561 Ga0501040_0204061 3300049576 Bacteria 1404
562 Ga0501041_0357129 3300049577 Bacteria 924
563 Ga0501041_0449633 3300049577 Bacteria 818
564 Ga0501042_0114340 3300049578 Bacteria 1943
565 Ga0501042_0818974 3300049578 Bacteria 678
566 Ga0501043_0026720 3300049579 Bacteria 4528
567 Ga0501046_0001726 3300049580 Bacteria 20847
568 Ga0501047_0071103 3300049581 Bacteria 3349
569 Ga0501048_0008727 3300049582 Bacteria 7641
570 Ga0501048_0133336 3300049582 Bacteria 1755
571 Ga0501048_0288064 3300049582 Bacteria 1168
572 Ga0501067_0046416 3300049583 Bacteria 2411
573 Ga0501067_0247833 3300049583 Bacteria 991
574 Ga0501068_0107535 3300049584 Bacteria 1732
575 Ga0501068_0690873 3300049584 Bacteria 667
576 Ga0501069_0155701 3300049585 Bacteria 1314
577 Ga0501069_0639074 3300049585 Bacteria 640
578 Ga0501069_0734853 3300049585 Bacteria 596
579 Ga0501070_0005670 3300049586 Bacteria 10647
580 Ga0501070_0023133 3300049586 Bacteria 5205
581 Ga0501070_0454553 3300049586 Bacteria 1032
582 Ga0501070_0983857 3300049586 Bacteria 655
583 Ga0501072_0045850 3300049588 Bacteria 3439
584 Ga0501072_0306085 3300049588 Bacteria 1263
585 Ga0501072_0980321 3300049588 Bacteria 659
586 Ga0501072_1494945 3300049588 Bacteria 521
587 Ga0501073_0048796 3300049589 Bacteria 2970
588 Ga0501074_0122829 3300049590 Bacteria 1857
589 Ga0501074_0226223 3300049590 Bacteria 1332
590 Ga0501075_0506726 3300049591 Bacteria 921
591 Ga0501076_0404090 3300049592 Bacteria 1123
592 Ga0501076_0682181 3300049592 Bacteria 848
593 Ga0501259_171388 3300049688 Bacteria 546
594 Ga0501245_058110 3300049708 Bacteria 701
595 Ga0501079_0157087 3300049741 Bacteria 1773
596 Ga0501079_1279573 3300049741 Bacteria 577
597 Ga0501080_0201677 3300049742 Bacteria 1826
598 Ga0501080_1374074 3300049742 Bacteria 603
599 Ga0501080_1417172 3300049742 Bacteria 592
600 Ga0501083_1122755 3300049744 Bacteria 512
601 Ga0501035_0152488 3300049822 Bacteria 2004
602 Ga0501035_0608370 3300049822 Bacteria 890
603 Ga0501044_0321027 3300049823 Bacteria 1473
604 Ga0501044_0620713 3300049823 Bacteria 972
605 Ga0501045_0314745 3300049824 Bacteria 1165
606 Ga0501045_0555141 3300049824 Bacteria 852
607 nmdc:mga03n38_617874_c1 3300050490 Bacteria 619
608 nmdc:mga00v17_119735_c1 3300050491 Bacteria 1675
609 nmdc:mga00v17_376774_c1 3300050491 Bacteria 923
610 nmdc:mga00v17_53588_c1 3300050491 Bacteria 2459
611 nmdc:mga00v17_639114_c1 3300050491 Bacteria 685
612 nmdc:mga00v17_86923_c1 3300050491 Bacteria 1960
613 nmdc:mga0yw44_1184073_c1 3300050492 Bacteria 516
614 nmdc:mga0yw44_22756_c1 3300050492 Bacteria 3519
615 nmdc:mga0yw44_25149_c1 3300050492 Bacteria 3380
616 nmdc:mga0yw44_319919_c1 3300050492 Bacteria 1042
617 nmdc:mga0yw44_390891_c1 3300050492 Bacteria 940
618 nmdc:mga0yw44_466933_c1 3300050492 Bacteria 856
619 nmdc:mga0yw44_509507_c1 3300050492 Bacteria 817
620 nmdc:mga0yw44_550349_c1 3300050492 Bacteria 784
621 nmdc:mga0yw44_583486_c1 3300050492 Bacteria 759
622 nmdc:mga0yw44_59247_c1 3300050492 Bacteria 1022
623 nmdc:mga0yw44_626608_c1 3300050492 Bacteria 731
624 nmdc:mga0yw44_65525_c1 3300050492 Bacteria 2239
625 nmdc:mga0yw44_679_c1 3300050492 Bacteria 12420
626 nmdc:mga0yw44_8926_c1 3300050492 Bacteria 5029
627 nmdc:mga06z11_68454_c1 3300050494 Bacteria 1871
628 nmdc:mga04h51_333641_c1 3300050495 Bacteria 624
629 nmdc:mga04h51_63628_c1 3300050495 Bacteria 1271
630 nmdc:mga07m45_36831_c1 3300050496 Bacteria 2727
631 nmdc:mga07m45_39054_c1 3300050496 Bacteria 2651
632 nmdc:mga07m45_41364_c1 3300050496 Bacteria 2581
633 nmdc:mga08y16_68442_c1 3300050511 Bacteria 3702
634 Ga0495655_0245929 3300053083 Bacteria 600
635 Ga0495619_0715913 3300053085 Bacteria 680
636 Ga0500641_0006188 3300053096 Bacteria 4243
637 Ga0500554_014480 3300053102 Bacteria 2036
638 Ga0500593_000024 3300053117 Bacteria 52015
639 Ga0500628_173759 3300053129 Bacteria 612
640 Ga0500628_181093 3300053129 Bacteria 602
641 Ga0500568_0147844 3300053139 Bacteria 870
642 Ga0500573_0090102 3300053140 Bacteria 1733
643 Ga0501084_0284476 3300054114 Bacteria 1396
644 Ga0501084_0709991 3300054114 Bacteria 848
645 Ga0587084_124269 3300059477 Bacteria 546
646 Ga0587066_149691 3300059490 Bacteria 577
647 Ga0587070_054409 3300059491 Bacteria 809
648 Ga0587070_144001 3300059491 Bacteria 591
649 Ga0587070_172723 3300059491 Bacteria 557
650 Ga0587073_0116474 3300059492 Bacteria 716
651 Ga0587073_0168353 3300059492 Bacteria 634
652 Ga0587073_0312875 3300059492 Bacteria 515
653 Ga0587077_115326 3300059493 Bacteria 663
654 Ga0587077_140127 3300059493 Bacteria 622
655 Ga0587077_143746 3300059493 Bacteria 617
656 Ga0587080_110252 3300059503 Bacteria 599
657 Ga0587082_054118 3300059504 Bacteria 774
658 Ga0587082_072599 3300059504 Bacteria 702
659 Ga0587083_0256462 3300059505 Bacteria 523
660 Ga0587085_174657 3300059506 Bacteria 511
661 Ga0587086_116516 3300059507 Bacteria 507
662 Ga0587088_033518 3300059508 Bacteria 931
663 Ga0587089_072707 3300059509 Bacteria 587
664 Ga0587090_070956 3300059510 Bacteria 680
665 Ga0587090_104984 3300059510 Bacteria 596
666 Ga0587090_129006 3300059510 Bacteria 555
667 Ga0587091_194722 3300059511 Bacteria 541
668 Ga0587091_236279 3300059511 Bacteria 506
669 Ga0587094_095008 3300059513 Bacteria 569
670 Ga0587098_062791 3300059604 Bacteria 587
671 Ga0587098_088348 3300059604 Bacteria 525
672 Ga0587106_046563 3300059605 Bacteria 755
673 Ga0587106_061011 3300059605 Bacteria 692
674 Ga0587101_130902 3300059623 Bacteria 528
675 Ga0587109_207290 3300059624 Bacteria 513
676 Ga0587113_017247 3300059625 Bacteria 731
677 Ga0587113_047871 3300059625 Bacteria 527
678 Ga0587117_131289 3300059627 Bacteria 505
679 Ga0587128_023962 3300059630 Bacteria 961
680 Ga0587128_143645 3300059630 Bacteria 538
681 Ga0587128_147511 3300059630 Bacteria 533
682 Ga0587067_088992 3300059640 Bacteria 696
683 Ga0587067_222960 3300059640 Bacteria 512
684 Ga0587067_234089 3300059640 Bacteria 503
685 Ga0587068_160746 3300059641 Bacteria 514
686 Ga0587076_039242 3300059645 Bacteria 878
687 Ga0587076_127348 3300059645 Bacteria 596
688 Ga0587078_036653 3300059646 Bacteria 680
689 Ga0587079_164500 3300059647 Bacteria 583
690 Ga0587079_174875 3300059647 Bacteria 571
691 Ga0587079_189005 3300059647 Bacteria 556
692 Ga0587102_047390 3300059649 Bacteria 571
693 Ga0587107_018458 3300059652 Bacteria 945
694 Ga0587107_100088 3300059652 Bacteria 572
695 Ga0587114_061720 3300059655 Bacteria 659
696 Ga0587120_032326 3300059659 Bacteria 538
697 Ga0587071_188254 3300060344 Bacteria 533
698 Ga0587111_0084117 3300060346 Bacteria 766
699 Ga0587111_0105782 3300060346 Bacteria 707
700 Ga0501082_0312716 3300060353 Bacteria 1368
701 Ga0501082_0378120 3300060353 Bacteria 1236
702 Ga0501082_0965338 3300060353 Bacteria 745
703 Ga0530510_0208373 3300061734 Bacteria 1452
704 Ga0530510_0247651 3300061734 Bacteria 1328
705 Ga0530510_0447563 3300061734 Bacteria 976
706 Ga0530510_1315350 3300061734 Bacteria 554
707 Ga0007429J51699_1019794
708 JGI24746J21847_1009616
709 JGI24739J22299_10097504
710 JGI24743J22301_10001400
711 JGI24745J21846_1036155
712 JGI24749J21850_1022144
713 JGI24744J21845_10015041
714 JGI24742J22300_10028344
715 Ga0006772J43183_102204
716 Ga0006762J43184_103041
717 Ga0006779J45831_100903
718 Ga0006778J45830_1007436
719 Ga0006778J45830_1009882
720 Ga0006759J45824_1001904
721 Ga0006759J45824_1004271
722 Ga0006759J45824_1005795
723 Ga0006759J45824_1007636
724 Ga0006758J48902_1004928
725 Ga0006758J48902_1008851
726 Ga0006770J48903_1005475
727 Ga0006777J48905_1002308
728 Ga0006777J48905_1004409
729 Ga0006777J48905_1006164
730 Ga0007417J51691_1005883
731 Ga0007417J51691_1008755
732 Ga0007427J51700_102324
733 Ga0007427J51700_107198
734 Ga0006781J51513_1001674
735 Ga0006781J51513_1002209
736 Ga0006781J51513_1002746
737 Ga0007410J51695_1002649
738 Ga0007410J51695_1009494
739 Ga0007410J51695_1015236
740 Ga0007410J51695_1016414
741 Ga0007410J51695_1018728
742 Ga0007409J51694_1006294
743 Ga0007409J51694_1007675
744 Ga0007416J51690_1003502
745 Ga0007416J51690_1006986
746 Ga0007429J51699_1002663
747 Ga0007429J51699_1003068
748 Ga0007429J51699_1006124
749 Ga0007429J51699_1006160
750 Ga0007429J51699_1007780
751 Ga0007429J51699_1018308
752 Ga0007411J51799_101708
753 Ga0007411J51799_102589
754 Ga0007411J51799_102961
755 Ga0007411J51799_106181
756 Ga0007415J51800_103035
757 Ga0032354_1006717
758 Ga0032354_1015477
759 Ga0032354_1020920
760 Ga0006780_1001792
761 Ga0006780_1009738
762 Ga0058858_1009502
763 Ga0058859_10038219
764 Ga0058859_11695703
765 Ga0058861_12054472
766 Ga0058860_10054766
767 Ga0058860_10054900
768 Ga0058860_10093393
769 Ga0070683_100075407
770 Ga0070683_101118642
771 Ga0070683_101877379
772 Ga0070670_100209201
773 Ga0070670_101244994
774 Ga0070680_100938550
775 Ga0070682_100025449
776 Ga0070682_100123310
777 Ga0070682_100276632
778 Ga0068868_101429471
779 Ga0070660_100200936
780 Ga0070660_101798575
781 Ga0070689_100096501
782 Ga0070687_100418806
783 Ga0070687_100441799
784 Ga0070661_100392577
785 Ga0070661_100645437
786 Ga0070661_101472549
787 Ga0070692_10002265
788 Ga0070692_10353461
789 Ga0070692_10471192
790 Ga0070692_10864021
791 Ga0070669_100166285
792 Ga0070675_100020141
793 Ga0070675_100576403
794 Ga0070671_101672093
795 Ga0070674_100013454
796 Ga0070688_100177132
797 Ga0070659_100069983
798 Ga0070667_100148244
799 Ga0070667_100198689
800 Ga0070703_10385186
801 Ga0070701_10013100
802 Ga0070700_100003127
803 Ga0070700_101028756
804 Ga0070700_101157685
805 Ga0070700_102000779
806 Ga0070663_100218896
807 Ga0070663_100664251
808 Ga0070663_101120403
809 Ga0070662_100045578
810 Ga0070662_101328249
811 Ga0070662_101718555
812 Ga0068867_100007670
813 Ga0068867_100763786
814 Ga0070699_100978708
815 Ga0070679_101901753
816 Ga0070684_101558227
817 Ga0070684_102158714
818 Ga0068853_100027901
819 Ga0070672_100011435
820 Ga0070672_100749956
821 Ga0070686_100067847
822 Ga0070686_100266521
823 Ga0070693_100324171
824 Ga0070664_100354816
825 Ga0070664_101787996
826 Ga0068857_100442816
827 Ga0068854_100010445
828 Ga0068854_100851561
829 Ga0068856_100699705
830 Ga0068856_100725748
831 Ga0068856_101875301
832 Ga0070702_100015671
833 Ga0070702_100443599
834 Ga0070702_100740477
835 Ga0068852_100004510
836 Ga0068852_100526624
837 Ga0068852_100650195
838 Ga0068852_101353374
839 Ga0068864_100058007
840 Ga0068861_100003671
841 Ga0068851_10657888
842 Ga0068870_10040543
843 Ga0068870_10188807
844 Ga0068870_10507503
845 Ga0068858_101591226
846 Ga0068862_100199880
847 Ga0068862_102281491
848 Ga0075365_10010566
849 Ga0075365_10012524
850 Ga0075365_10022574
851 Ga0075365_10035274
852 Ga0075365_10077901
853 Ga0075365_10099635
854 Ga0075365_10147369
855 Ga0075365_10167614
856 Ga0075365_10203794
857 Ga0075365_10269597
858 Ga0075365_10276006
859 Ga0075365_10375715
860 Ga0075365_10484994
861 Ga0075365_10536530
862 Ga0075365_10741631
863 Ga0075368_10003462
864 Ga0075368_10130571
865 Ga0075368_10462476
866 Ga0075363_100007207
867 Ga0075363_100025355
868 Ga0075363_100274972
869 Ga0075363_100463665
870 Ga0075364_10053098
871 Ga0075364_10080423
872 Ga0075364_10177387
873 Ga0075364_10195145
874 Ga0075364_10598275
875 Ga0075364_10619116
876 Ga0075364_10948274
877 Ga0075362_10001982
878 Ga0075362_10145186
879 Ga0075367_10008489
880 Ga0075367_10041256
881 Ga0075367_10079899
882 Ga0075367_10486526
883 Ga0075367_10573805
884 Ga0075370_10010626
885 Ga0075370_10022183
886 Ga0075370_10031160
887 Ga0075370_10032926
888 Ga0075370_10092564
889 Ga0075370_10241040
890 Ga0075370_10242016
891 Ga0068871_102126996
892 Ga0075428_100103855
893 Ga0068865_100008871
894 Ga0068865_101615447
895 Ga0111539_10043868
896 Ga0105245_10011376
897 Ga0105245_11393902
898 Ga0114129_11463673
899 Ga0105243_10001673
900 Ga0105243_10866767
901 Ga0105243_10922639
902 Ga0105243_12551359
903 Ga0105241_12099449
904 Ga0105248_10082129
905 Ga0105238_10422600
906 Ga0105238_10902510
907 Ga0105238_11514826
908 Ga0105249_10013394
909 Ga0105239_10192715
910 Ga0105239_10695587
911 Ga0105246_10062699
912 Ga0105246_10298650
913 Ga0105246_10851574
914 Ga0157371_10251325
915 Ga0157370_11755229
916 Ga0157369_12557264
917 Ga0157374_10398536
918 Ga0157374_10739205
919 Ga0157378_11271178
920 Ga0157372_10066507
921 Ga0157372_11294225
922 Ga0157375_10156972
923 Ga0157375_10618071
924 Ga0157375_11682659
925 Ga0163163_10935310
926 Ga0163163_10969402
927 Ga0163163_11455401
928 Ga0163163_12377462
929 Ga0157380_10007376
930 Ga0157380_10333371
931 Ga0157380_10957408
932 Ga0157380_11471047
933 Ga0157377_10074838
934 Ga0157377_10376249
935 Ga0157376_11365260
936 Ga0163161_10269882
937 Ga0163161_10340268
938 Ga0197907_10452887
939 Ga0197907_10905443
940 Ga0197907_11199106
941 Ga0197907_11330210
942 Ga0206356_11714103
943 Ga0206349_1171247
944 Ga0206349_1503519
945 Ga0206349_1713601
946 Ga0206355_1022157
947 Ga0206355_1496161
948 Ga0206351_10031167
949 Ga0206351_10074860
950 Ga0206352_10571357
951 Ga0206352_11226993
952 Ga0206350_11328671
953 Ga0206350_11441905
954 Ga0206350_11479100
955 Ga0206354_10221161
956 Ga0206354_11390140
957 Ga0206354_11516430
958 Ga0206354_11620488
959 Ga0206353_10150450
960 Ga0206353_10168293
961 Ga0206353_11732002
962 Ga0206353_11905654
963 Ga0154015_1240846
964 Ga0154015_1561856
965 Ga0213875_10412815
966 Ga0224712_10012833
967 Ga0207697_10182577
968 Ga0207688_10013512
969 Ga0207688_10400848
970 Ga0207643_10023437
971 Ga0207643_10156638
972 Ga0207657_10204633
973 Ga0207657_10256009
974 Ga0207649_10442567
975 Ga0207681_10167751
976 Ga0207681_11552784
977 Ga0207694_10229436
978 Ga0207694_10589042
979 Ga0207694_10723724
980 Ga0207694_10736444
981 Ga0207650_10922993
982 Ga0207659_10032018
983 Ga0207687_10126312
984 Ga0207687_10162395
985 Ga0207664_10003771
986 Ga0207690_10081895
987 Ga0207690_10138263
988 Ga0207706_10035400
989 Ga0207706_10434275
990 Ga0207706_11222644
991 Ga0207709_10013249
992 Ga0207709_10149094
993 Ga0207709_10541484
994 Ga0207670_10055858
995 Ga0207669_10004166
996 Ga0207704_10054152
997 Ga0207704_10915069
998 Ga0207704_11478846
999 Ga0207691_10061679
1000 Ga0207691_10241376
1001 Ga0207691_11236854
1002 Ga0207711_10214019
1003 Ga0207661_10032421
1004 Ga0207661_10297913
1005 Ga0207661_10464484
1006 Ga0207661_10837693
1007 Ga0207661_11285383
1008 Ga0207661_11335858
1009 Ga0207679_10188206
1010 Ga0207679_10251895
1011 Ga0207679_11037745
1012 Ga0207679_11222030
1013 Ga0207679_11642900
1014 Ga0207651_10073530
1015 Ga0207651_11212229
1016 Ga0207712_10017189
1017 Ga0207668_10021435
1018 Ga0207640_10024174
1019 Ga0207658_10204414
1020 Ga0207658_10281419
1021 Ga0207677_10697748
1022 Ga0207703_11448690
1023 Ga0207639_10224281
1024 Ga0207678_10238120
1025 Ga0207678_10527780
1026 Ga0207678_10537431
1027 Ga0207708_10000836
1028 Ga0207708_10265440
1029 Ga0207708_10739169
1030 Ga0207708_10931314
1031 Ga0207702_10451435
1032 Ga0207702_10770362
1033 Ga0207641_12274091
1034 Ga0207648_10000921
1035 Ga0207648_10823360
1036 Ga0207648_10880207
1037 Ga0207676_10045822
1038 Ga0207674_10269806
1039 Ga0207674_10517924
1040 Ga0207675_100002314
1041 Ga0207683_10520764
1042 Ga0207683_10815153
1043 Ga0207698_10434301
1044 Ga0209813_10018787
1045 Ga0209813_10332379
1046 Ga0207428_10172973
1047 Ga0268265_10050523
1048 Ga0316177_1080917
1049 Ga0314311_1020573
1050 Ga0314311_1068941
1051 Ga0316183_1119379
1052 Ga0316182_1039819
1053 Ga0316182_1223568
1054 Ga0265320_10202654
1055 Ga0307405_10336815
1056 Ga0307413_10618771
1057 Ga0307413_11294209
1058 Ga0307410_10059534
1059 Ga0307410_10131313
1060 Ga0307410_11979766
1061 Ga0307406_10290033
1062 Ga0307406_10502391
1063 Ga0307406_11100052
1064 Ga0307407_10043658
1065 Ga0307407_10050299
1066 Ga0307407_10263023
1067 Ga0307407_10927350
1068 Ga0307407_11716114
1069 Ga0307412_10077833
1070 Ga0307412_10775262
1071 Ga0307412_11098072
1072 Ga0307409_100001523
1073 Ga0307409_100069451
1074 Ga0307409_100086335
1075 Ga0307409_100157671
1076 Ga0307409_100161358
1077 Ga0307409_100192898
1078 Ga0307409_100595420
1079 Ga0307409_101664210
1080 Ga0307416_100000317
1081 Ga0307416_100142291
1082 Ga0307416_101251483
1083 Ga0307416_101864645
1084 Ga0307414_11433050
1085 Ga0307414_11764571
1086 Ga0307411_10033155
1087 Ga0307411_11262505
1088 Ga0307415_100000352
1089 Ga0307415_100120319
1090 Ga0307415_100173688
1091 Ga0307415_100201173
1092 Ga0307415_101095218
1093 Ga0373941_0106278
1094 Ga0373960_0183201
1095 Ga0373962_0250417
1096 Ga0395900_0049501
1097 Ga0395900_0123688
1098 Ga0395900_0191959
1099 Ga0395898_0030642
1100 Ga0395898_1042489
1101 Ga0436364_0904730
1102 Ga0436364_1265199
1103 Ga0395901_0247520
1104 Ga0395901_0630595
1105 Ga0395901_1563688
1106 Ga0436365_0394095
1107 Ga0451793_1014300
1108 Ga0451797_1292487
1109 Ga0451798_0090801
1110 Ga0451802_1092931
1111 Ga0451833_0073924
1112 Ga0451845_0248573
1113 Ga0451849_0507776
1114 Ga0451849_0843851
1115 Ga0451855_0841227
1116 Ga0451853_0803469
1117 Ga0439434_0250993
1118 Ga0439464_0032062
1119 Ga0466969_0139918
1120 Ga0466972_0187525
1121 Ga0466965_0304443
1122 Ga0466965_0468559
1123 Ga0466966_0122970
1124 Ga0466966_0124590
1125 Ga0466961_0074429
1126 Ga0466961_0416768
1127 Ga0466963_0105324
1128 Ga0466963_1336317
1129 Ga0466971_0294606
1130 Ga0466970_0004511
1131 Ga0466970_0093416
1132 Ga0466970_0175001
1133 Ga0466970_0516891
1134 Ga0466957_0368731
1135 Ga0466960_0016854
1136 Ga0466960_0017689
1137 Ga0466960_0200134
1138 Ga0466960_0247031
1139 Ga0466959_0352543
1140 Ga0466958_0262394
1141 Ga0466967_0064272
1142 Ga0466967_0442771
1143 Ga0466967_0962216
1144 Ga0466967_1576671
1145 Ga0495603_0558902
1146 Ga0495628_0928041
1147 Ga0495676_0784726
1148 Ga0496101_0218976
1149 Ga0496101_1003872
1150 Ga0496102_0351372
1151 Ga0496103_0312448
1152 Ga0496104_1405796
1153 Ga0496105_0346087
1154 Ga0496106_0110782
1155 Ga0496107_0430319
1156 Ga0496107_0845177
1157 Ga0496108_0428651
1158 Ga0496108_1052580
1159 Ga0496109_0312891
1160 Ga0496109_0364956
1161 Ga0496109_1014210
1162 Ga0496110_0083068
1163 Ga0496110_0766594
1164 Ga0496110_0988069
1165 Ga0496114_0022717
1166 Ga0496114_0069594
1167 Ga0501306_023126
1168 Ga0501306_024390
1169 Ga0501306_093462
1170 Ga0501308_003819
1171 Ga0501308_004480
1172 Ga0501308_006100
1173 Ga0501308_016801
1174 Ga0501308_085646
1175 Ga0501309_005703
1176 Ga0501309_013514
1177 Ga0501309_074511
1178 Ga0501310_005087
1179 Ga0501310_007560
1180 Ga0501310_052513
1181 Ga0501304_006324
1182 Ga0501304_007735
1183 Ga0501304_040774
1184 Ga0501305_024047
1185 Ga0501305_031174
1186 Ga0501305_063859
1187 Ga0501305_065637
1188 Ga0501307_006621
1189 Ga0501307_011222
1190 Ga0501307_031411
1191 Ga0501307_045128
1192 Ga0501311_002446
1193 Ga0501311_005250
1194 Ga0501311_005351
1195 Ga0501311_010589
1196 Ga0501311_022300
1197 Ga0501312_037437
1198 Ga0501312_071746
1199 Ga0501312_105058
1200 Ga0501313_042729
1201 Ga0501313_046442
1202 Ga0501314_003780
1203 Ga0501314_041995
1204 Ga0501315_009649
1205 Ga0501315_025868
1206 Ga0501315_077675
1207 Ga0501316_005380
1208 Ga0501316_005844
1209 Ga0501316_024591
1210 Ga0501317_003312
1211 Ga0501317_004777
1212 Ga0501317_008940
1213 Ga0501317_025052
1214 Ga0501317_026183
1215 Ga0501317_062857
1216 Ga0501317_078562
1217 Ga0501318_001409
1218 Ga0501318_001632
1219 Ga0501318_001981
1220 Ga0501318_006681
1221 Ga0501318_017224
1222 Ga0501318_091777
1223 Ga0501319_006371
1224 Ga0501319_006469
1225 Ga0501320_006181
1226 Ga0501320_007935
1227 Ga0501320_025726
1228 Ga0501321_001788
1229 Ga0501321_002215
1230 Ga0501321_009596
1231 Ga0501321_014621
1232 Ga0501322_012282
1233 Ga0501322_012935
1234 Ga0501322_023692
1235 Ga0501323_004585
1236 Ga0501323_012413
1237 Ga0501324_005615
1238 Ga0501324_016002
1239 Ga0501324_016555
1240 Ga0501324_017556
1241 Ga0501324_045863
1242 Ga0501325_006989
1243 Ga0501325_012384
1244 Ga0501325_015949
1245 Ga0501325_034006
1246 Ga0501325_056218
1247 Ga0501327_08654
1248 Ga0501329_05042
1249 Ga0501330_008278
1250 Ga0501031_0059073
1251 Ga0501031_0620993
1252 Ga0501032_0003302
1253 Ga0501033_0001990
1254 Ga0501034_0024934
1255 Ga0501034_0086664
1256 Ga0501036_0008097
1257 Ga0501036_0742881
1258 Ga0501037_0002887
1259 Ga0501037_1099270
1260 Ga0501038_0047397
1261 Ga0501039_0008326
1262 Ga0501039_0056304
1263 Ga0501039_0498862
1264 Ga0501040_0037342
1265 Ga0501040_0051996
1266 Ga0501040_0056318
1267 Ga0501040_0204061
1268 Ga0501041_0357129
1269 Ga0501041_0449633
1270 Ga0501042_0114340
1271 Ga0501042_0818974
1272 Ga0501043_0026720
1273 Ga0501046_0001726
1274 Ga0501047_0071103
1275 Ga0501048_0008727
1276 Ga0501048_0133336
1277 Ga0501048_0288064
1278 Ga0501067_0046416
1279 Ga0501067_0247833
1280 Ga0501068_0107535
1281 Ga0501068_0690873
1282 Ga0501069_0155701
1283 Ga0501069_0639074
1284 Ga0501069_0734853
1285 Ga0501070_0005670
1286 Ga0501070_0023133
1287 Ga0501070_0454553
1288 Ga0501070_0983857
1289 Ga0501072_0045850
1290 Ga0501072_0306085
1291 Ga0501072_0980321
1292 Ga0501072_1494945
1293 Ga0501073_0048796
1294 Ga0501074_0122829
1295 Ga0501074_0226223
1296 Ga0501075_0506726
1297 Ga0501076_0404090
1298 Ga0501076_0682181
1299 Ga0501259_171388
1300 Ga0501245_058110
1301 Ga0501079_0157087
1302 Ga0501079_1279573
1303 Ga0501080_0201677
1304 Ga0501080_1374074
1305 Ga0501080_1417172
1306 Ga0501083_1122755
1307 Ga0501035_0152488
1308 Ga0501035_0608370
1309 Ga0501044_0321027
1310 Ga0501044_0620713
1311 Ga0501045_0314745
1312 Ga0501045_0555141
1313 nmdc:mga03n38_617874_c1
1314 nmdc:mga00v17_119735_c1
1315 nmdc:mga00v17_376774_c1
1316 nmdc:mga00v17_53588_c1
1317 nmdc:mga00v17_639114_c1
1318 nmdc:mga00v17_86923_c1
1319 nmdc:mga0yw44_1184073_c1
1320 nmdc:mga0yw44_22756_c1
1321 nmdc:mga0yw44_25149_c1
1322 nmdc:mga0yw44_319919_c1
1323 nmdc:mga0yw44_390891_c1
1324 nmdc:mga0yw44_466933_c1
1325 nmdc:mga0yw44_509507_c1
1326 nmdc:mga0yw44_550349_c1
1327 nmdc:mga0yw44_583486_c1
1328 nmdc:mga0yw44_59247_c1
1329 nmdc:mga0yw44_626608_c1
1330 nmdc:mga0yw44_65525_c1
1331 nmdc:mga0yw44_679_c1
1332 nmdc:mga0yw44_8926_c1
1333 nmdc:mga06z11_68454_c1
1334 nmdc:mga04h51_333641_c1
1335 nmdc:mga04h51_63628_c1
1336 nmdc:mga07m45_36831_c1
1337 nmdc:mga07m45_39054_c1
1338 nmdc:mga07m45_41364_c1
1339 nmdc:mga08y16_68442_c1
1340 Ga0495655_0245929
1341 Ga0495619_0715913
1342 Ga0500641_0006188
1343 Ga0500554_014480
1344 Ga0500593_000024
1345 Ga0500628_173759
1346 Ga0500628_181093
1347 Ga0500568_0147844
1348 Ga0500573_0090102
1349 Ga0501084_0284476
1350 Ga0501084_0709991
1351 Ga0587084_124269
1352 Ga0587066_149691
1353 Ga0587070_054409
1354 Ga0587070_144001
1355 Ga0587070_172723
1356 Ga0587073_0116474
1357 Ga0587073_0168353
1358 Ga0587073_0312875
1359 Ga0587077_115326
1360 Ga0587077_140127
1361 Ga0587077_143746
1362 Ga0587080_110252
1363 Ga0587082_054118
1364 Ga0587082_072599
1365 Ga0587083_0256462
1366 Ga0587085_174657
1367 Ga0587086_116516
1368 Ga0587088_033518
1369 Ga0587089_072707
1370 Ga0587090_070956
1371 Ga0587090_104984
1372 Ga0587090_129006
1373 Ga0587091_194722
1374 Ga0587091_236279
1375 Ga0587094_095008
1376 Ga0587098_062791
1377 Ga0587098_088348
1378 Ga0587106_046563
1379 Ga0587106_061011
1380 Ga0587101_130902
1381 Ga0587109_207290
1382 Ga0587113_017247
1383 Ga0587113_047871
1384 Ga0587117_131289
1385 Ga0587128_023962
1386 Ga0587128_143645
1387 Ga0587128_147511
1388 Ga0587067_088992
1389 Ga0587067_222960
1390 Ga0587067_234089
1391 Ga0587068_160746
1392 Ga0587076_039242
1393 Ga0587076_127348
1394 Ga0587078_036653
1395 Ga0587079_164500
1396 Ga0587079_174875
1397 Ga0587079_189005
1398 Ga0587102_047390
1399 Ga0587107_018458
1400 Ga0587107_100088
1401 Ga0587114_061720
1402 Ga0587120_032326
1403 Ga0587071_188254
1404 Ga0587111_0084117
1405 Ga0587111_0105782
1406 Ga0501082_0312716
1407 Ga0501082_0378120
1408 Ga0501082_0965338
1409 Ga0530510_0208373
1410 Ga0530510_0247651
1411 Ga0530510_0447563
1412 Ga0530510_1315350

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

28

130

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

41

128

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nof-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c c40s mutant 0.9381 4 105
7c65-assembly1.cif.gz_A crystal structure of thioredoxin m1 0.9343 4 106
4pob-assembly1.cif.gz_B crystal structure of a thioredoxin rv1471 ortholog from mycobacterium abscessus 0.9325 4 107
4ba7-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last bacteria common ancestor (lbca) from the precambrian period 0.9323 4 105
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9322 4 106
ID Description Score Start End Superfamily
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9221 6 107 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9213 4 106 3.40.30.10
af_Q8LD49_56_177_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9155 4 108 3.40.30.10
1thxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.914 4 108 3.40.30.10
3hz4B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9083 4 106 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A838LLK2-F1-model_v4 Thioredoxin 0.9515 4 108 GO:0005829
GO:0015035
GO:0045454
AF-A0A7L5Z3B4-F1-model_v4 Thioredoxin 0.9514 4 107 GO:0005829
GO:0015035
GO:0045454
AF-L7VQR2-F1-model_v4 Thioredoxin 0.9504 1 107 GO:0005829
GO:0015035
GO:0045454
AF-A0A7J9VMT4-F1-model_v4 Thioredoxin 0.9491 4 108 GO:0005829
GO:0015035
GO:0045454
AF-A0A6A8N2C7-F1-model_v4 Thioredoxin 0.9484 4 107 GO:0005829
GO:0015035
GO:0045454

Map