F476380
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 321 | 687 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0392407|Ga0501033_0392407_213_800 |
| Length | 195 |
| Sequence | MPSPARARHPDPFRTAVFTGTFDPISLGHLDVIRRGRLLFDHLVVGIGVHPSKTSLFAIDERLSLARRVVEPFPNVSVESFEELTVQYVRRIGARVILRGLRTLTDMEYEFGMTLTNQRLDPEIETVFLMADSQYSHVSSSLIRQVARFGGRESLKPFVPELVIDPILAKLSVNRSADTAVDYDKRSVAVKLPEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 5 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 6 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 7 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 8 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 9 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 10 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 11 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 12 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 13 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 14 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 15 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 16 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 17 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 18 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 19 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 20 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 21 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 22 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 23 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 24 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 25 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 26 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 27 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 28 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 29 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 129 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 263 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 273 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 287 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 294 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 295 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 296 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 297 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 299 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 300 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 301 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 302 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 303 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 307 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 308 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 309 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 310 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 313 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 314 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 316 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 319 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.59 |
| Metatranscriptomes | 0 |
| Isolates | 2.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.71 |
| Bulb | 0 |
| Endosphere | 7.24 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 84.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_158587 | 2162886007 | Bacteria | 2633 |
| 2 | SwRhRL2b_contig_3731301 | 2162886007 | Bacteria | 1169 |
| 3 | JGI24736J21556_1035193 | 3300001904 | Bacteria | 773 |
| 4 | JGI24741J21665_1019720 | 3300001915 | Bacteria | 1066 |
| 5 | JGI24752J21851_1001534 | 3300001976 | Bacteria | 3108 |
| 6 | JGI24740J21852_10000581 | 3300001979 | Bacteria | 15714 |
| 7 | JGI24740J21852_10040944 | 3300001979 | Bacteria | 1400 |
| 8 | JGI24740J21852_10082444 | 3300001979 | Bacteria | 840 |
| 9 | JGI24739J22299_10000556 | 3300001989 | Bacteria | 13387 |
| 10 | JGI24739J22299_10085242 | 3300001989 | Bacteria | 966 |
| 11 | JGI24737J22298_10004950 | 3300001990 | Bacteria | 4616 |
| 12 | JGI24737J22298_10018373 | 3300001990 | Bacteria | 2244 |
| 13 | JGI24737J22298_10073671 | 3300001990 | Bacteria | 1018 |
| 14 | JGI24735J21928_10000676 | 3300002067 | Bacteria | 12079 |
| 15 | JGI24735J21928_10007951 | 3300002067 | Bacteria | 3444 |
| 16 | JGI24735J21928_10010773 | 3300002067 | Bacteria | 2906 |
| 17 | JGI24738J21930_10002503 | 3300002075 | Bacteria | 4786 |
| 18 | JGI24749J21850_1022072 | 3300002076 | Bacteria | 902 |
| 19 | JGI24034J26672_10009458 | 3300002239 | Bacteria | 1438 |
| 20 | JGI25150J39212_1000711 | 3300002774 | Bacteria | 11968 |
| 21 | JGI25151J46595_10023430 | 3300003187 | Bacteria | 2544 |
| 22 | JGI25165J46597_1000024 | 3300003214 | Bacteria | 335150 |
| 23 | JGI25153J46596_10000186 | 3300003215 | Bacteria | 60427 |
| 24 | Ga0055526_1000503 | 3300003771 | Bacteria | 31087 |
| 25 | Ga0055536_1026934 | 3300003781 | Bacteria | 1602 |
| 26 | Ga0055540_1003332 | 3300003792 | Bacteria | 7820 |
| 27 | Ga0055540_1006395 | 3300003792 | Bacteria | 4685 |
| 28 | Ga0055543_1035427 | 3300004625 | Bacteria | 857 |
| 29 | Ga0065704_10001990 | 3300005289 | Bacteria | 8995 |
| 30 | Ga0065704_10004250 | 3300005289 | Bacteria | 5531 |
| 31 | Ga0065704_10190368 | 3300005289 | Bacteria | 1192 |
| 32 | Ga0065715_10000724 | 3300005293 | Bacteria | 9238 |
| 33 | Ga0070658_10022607 | 3300005327 | Bacteria | 5045 |
| 34 | Ga0070658_10135521 | 3300005327 | Bacteria | 2054 |
| 35 | Ga0070658_10138794 | 3300005327 | Bacteria | 2030 |
| 36 | Ga0070658_10295647 | 3300005327 | Bacteria | 1380 |
| 37 | Ga0070658_10528128 | 3300005327 | Bacteria | 1020 |
| 38 | Ga0070658_10779209 | 3300005327 | Bacteria | 831 |
| 39 | Ga0070683_100836122 | 3300005329 | Bacteria | 883 |
| 40 | Ga0070690_100026517 | 3300005330 | Bacteria | 3575 |
| 41 | Ga0070670_100000964 | 3300005331 | Bacteria | 22587 |
| 42 | Ga0070670_100001075 | 3300005331 | Bacteria | 21713 |
| 43 | Ga0070670_100003439 | 3300005331 | Bacteria | 13136 |
| 44 | Ga0070670_100055005 | 3300005331 | Bacteria | 3416 |
| 45 | Ga0070670_100273307 | 3300005331 | Bacteria | 1475 |
| 46 | Ga0070677_10000705 | 3300005333 | Bacteria | 11228 |
| 47 | Ga0068869_100501048 | 3300005334 | Bacteria | 1014 |
| 48 | Ga0070666_10000089 | 3300005335 | Bacteria | 64147 |
| 49 | Ga0070666_10082589 | 3300005335 | Bacteria | 2197 |
| 50 | Ga0070666_10111826 | 3300005335 | Bacteria | 1889 |
| 51 | Ga0070680_100010145 | 3300005336 | Bacteria | 7262 |
| 52 | Ga0070680_100061186 | 3300005336 | Bacteria | 3082 |
| 53 | Ga0070680_100203329 | 3300005336 | Bacteria | 1671 |
| 54 | Ga0070680_100381810 | 3300005336 | Bacteria | 1199 |
| 55 | Ga0070680_100478403 | 3300005336 | Bacteria | 1064 |
| 56 | Ga0070682_100327637 | 3300005337 | Bacteria | 1134 |
| 57 | Ga0070682_100675763 | 3300005337 | Bacteria | 825 |
| 58 | Ga0068868_100088300 | 3300005338 | Bacteria | 2495 |
| 59 | Ga0070660_100051863 | 3300005339 | Bacteria | 3161 |
| 60 | Ga0070660_100067208 | 3300005339 | Bacteria | 2792 |
| 61 | Ga0070660_100285692 | 3300005339 | Bacteria | 1350 |
| 62 | Ga0070660_100635435 | 3300005339 | Bacteria | 894 |
| 63 | Ga0070660_100757531 | 3300005339 | Bacteria | 815 |
| 64 | Ga0070660_101062951 | 3300005339 | Bacteria | 685 |
| 65 | Ga0070660_101219995 | 3300005339 | Bacteria | 638 |
| 66 | Ga0070691_10454621 | 3300005341 | Bacteria | 732 |
| 67 | Ga0070661_100000014 | 3300005344 | Bacteria | 158652 |
| 68 | Ga0070661_100056132 | 3300005344 | Bacteria | 2885 |
| 69 | Ga0070661_100078489 | 3300005344 | Bacteria | 2435 |
| 70 | Ga0070692_10006130 | 3300005345 | Bacteria | 5195 |
| 71 | Ga0070668_100000014 | 3300005347 | Bacteria | 112374 |
| 72 | Ga0070668_100035049 | 3300005347 | Bacteria | 3825 |
| 73 | Ga0070668_100050210 | 3300005347 | Bacteria | 3211 |
| 74 | Ga0070668_100078772 | 3300005347 | Bacteria | 2578 |
| 75 | Ga0070668_100137456 | 3300005347 | Bacteria | 1966 |
| 76 | Ga0070668_100576832 | 3300005347 | Bacteria | 982 |
| 77 | Ga0070669_100000024 | 3300005353 | Bacteria | 173107 |
| 78 | Ga0070669_100003409 | 3300005353 | Bacteria | 11441 |
| 79 | Ga0070669_100018244 | 3300005353 | Bacteria | 5013 |
| 80 | Ga0070669_100068114 | 3300005353 | Bacteria | 2627 |
| 81 | Ga0070669_100390569 | 3300005353 | Bacteria | 1136 |
| 82 | Ga0070669_100525624 | 3300005353 | Bacteria | 984 |
| 83 | Ga0070675_100006846 | 3300005354 | Bacteria | 8752 |
| 84 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 85 | Ga0070671_100031481 | 3300005355 | Bacteria | 4382 |
| 86 | Ga0070671_100051163 | 3300005355 | Bacteria | 3435 |
| 87 | Ga0070671_100462840 | 3300005355 | Bacteria | 1088 |
| 88 | Ga0070674_100010543 | 3300005356 | Bacteria | 5593 |
| 89 | Ga0070673_100034866 | 3300005364 | Bacteria | 3812 |
| 90 | Ga0070673_100038050 | 3300005364 | Bacteria | 3671 |
| 91 | Ga0070659_100059544 | 3300005366 | Bacteria | 3015 |
| 92 | Ga0070659_100060274 | 3300005366 | Bacteria | 2997 |
| 93 | Ga0070659_100544125 | 3300005366 | Bacteria | 993 |
| 94 | Ga0070659_100862008 | 3300005366 | Bacteria | 790 |
| 95 | Ga0070667_100000051 | 3300005367 | Bacteria | 155117 |
| 96 | Ga0070667_100056171 | 3300005367 | Bacteria | 3325 |
| 97 | Ga0070667_100137672 | 3300005367 | Bacteria | 2135 |
| 98 | Ga0070701_10088315 | 3300005438 | Bacteria | 1693 |
| 99 | Ga0070700_100055816 | 3300005441 | Bacteria | 2473 |
| 100 | Ga0070708_100039593 | 3300005445 | Bacteria | 4125 |
| 101 | Ga0070663_100013235 | 3300005455 | Bacteria | 5251 |
| 102 | Ga0070663_100095827 | 3300005455 | Bacteria | 2206 |
| 103 | Ga0070663_100340925 | 3300005455 | Bacteria | 1211 |
| 104 | Ga0070663_101366240 | 3300005455 | Bacteria | 626 |
| 105 | Ga0070678_100006580 | 3300005456 | Bacteria | 6830 |
| 106 | Ga0070662_100001528 | 3300005457 | Bacteria | 14251 |
| 107 | Ga0070662_100019126 | 3300005457 | Bacteria | 4645 |
| 108 | Ga0070662_100152991 | 3300005457 | Bacteria | 1798 |
| 109 | Ga0070662_100240976 | 3300005457 | Bacteria | 1450 |
| 110 | Ga0070662_100477549 | 3300005457 | Bacteria | 1037 |
| 111 | Ga0070681_10069647 | 3300005458 | Bacteria | 3484 |
| 112 | Ga0070681_10125533 | 3300005458 | Bacteria | 2499 |
| 113 | Ga0070681_10302567 | 3300005458 | Bacteria | 1509 |
| 114 | Ga0070681_10304875 | 3300005458 | Bacteria | 1502 |
| 115 | Ga0070681_10503411 | 3300005458 | Bacteria | 1124 |
| 116 | Ga0068867_100064156 | 3300005459 | Bacteria | 2731 |
| 117 | Ga0070706_100618422 | 3300005467 | Bacteria | 1006 |
| 118 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 119 | Ga0070679_100033561 | 3300005530 | Bacteria | 5082 |
| 120 | Ga0070679_100091875 | 3300005530 | Bacteria | 3023 |
| 121 | Ga0070679_100205183 | 3300005530 | Bacteria | 1935 |
| 122 | Ga0070679_100262730 | 3300005530 | Bacteria | 1681 |
| 123 | Ga0070679_101170360 | 3300005530 | Bacteria | 714 |
| 124 | Ga0070679_101188883 | 3300005530 | Bacteria | 708 |
| 125 | Ga0070684_100274879 | 3300005535 | Bacteria | 1543 |
| 126 | Ga0070684_101284704 | 3300005535 | Bacteria | 689 |
| 127 | Ga0068853_100005871 | 3300005539 | Bacteria | 9677 |
| 128 | Ga0068853_100024335 | 3300005539 | Bacteria | 5076 |
| 129 | Ga0068853_100124119 | 3300005539 | Bacteria | 2305 |
| 130 | Ga0068853_100235623 | 3300005539 | Bacteria | 1676 |
| 131 | Ga0068853_100383723 | 3300005539 | Bacteria | 1312 |
| 132 | Ga0070672_100005676 | 3300005543 | Bacteria | 8310 |
| 133 | Ga0070686_101055559 | 3300005544 | Bacteria | 669 |
| 134 | Ga0070665_100000471 | 3300005548 | Bacteria | 58097 |
| 135 | Ga0070665_100095368 | 3300005548 | Bacteria | 2980 |
| 136 | Ga0070665_100310719 | 3300005548 | Bacteria | 1580 |
| 137 | Ga0070665_100822401 | 3300005548 | Bacteria | 942 |
| 138 | Ga0070665_101837287 | 3300005548 | Bacteria | 612 |
| 139 | Ga0068855_100055176 | 3300005563 | Bacteria | 4668 |
| 140 | Ga0068855_100473645 | 3300005563 | Bacteria | 1364 |
| 141 | Ga0068855_101277420 | 3300005563 | Bacteria | 761 |
| 142 | Ga0070664_100061185 | 3300005564 | Bacteria | 3209 |
| 143 | Ga0070664_100119688 | 3300005564 | Bacteria | 2304 |
| 144 | Ga0070664_100194348 | 3300005564 | Bacteria | 1809 |
| 145 | Ga0070664_100560586 | 3300005564 | Bacteria | 1057 |
| 146 | Ga0068857_100005612 | 3300005577 | Bacteria | 10725 |
| 147 | Ga0068857_100067854 | 3300005577 | Bacteria | 3174 |
| 148 | Ga0068857_100102670 | 3300005577 | Bacteria | 2567 |
| 149 | Ga0068857_100160563 | 3300005577 | Bacteria | 2039 |
| 150 | Ga0068857_100693885 | 3300005577 | Bacteria | 967 |
| 151 | Ga0068857_101286437 | 3300005577 | Bacteria | 709 |
| 152 | Ga0068857_101286438 | 3300005577 | Bacteria | 709 |
| 153 | Ga0068854_100119433 | 3300005578 | Bacteria | 1999 |
| 154 | Ga0068854_100176768 | 3300005578 | Bacteria | 1665 |
| 155 | Ga0068854_100182268 | 3300005578 | Bacteria | 1641 |
| 156 | Ga0068854_100228496 | 3300005578 | Bacteria | 1476 |
| 157 | Ga0068854_100264883 | 3300005578 | Bacteria | 1377 |
| 158 | Ga0068854_100552740 | 3300005578 | Bacteria | 977 |
| 159 | Ga0068856_100011736 | 3300005614 | Bacteria | 8498 |
| 160 | Ga0068856_100290455 | 3300005614 | Bacteria | 1652 |
| 161 | Ga0068852_100013294 | 3300005616 | Bacteria | 6296 |
| 162 | Ga0068852_100051429 | 3300005616 | Bacteria | 3535 |
| 163 | Ga0068852_100364779 | 3300005616 | Bacteria | 1414 |
| 164 | Ga0068859_100000256 | 3300005617 | Bacteria | 52870 |
| 165 | Ga0068859_100014519 | 3300005617 | Bacteria | 7909 |
| 166 | Ga0068864_100001091 | 3300005618 | Bacteria | 22748 |
| 167 | Ga0068864_100001437 | 3300005618 | Bacteria | 19648 |
| 168 | Ga0068864_100012174 | 3300005618 | Bacteria | 7111 |
| 169 | Ga0068864_100012452 | 3300005618 | Bacteria | 7033 |
| 170 | Ga0068861_100000799 | 3300005719 | Bacteria | 18980 |
| 171 | Ga0068861_100004837 | 3300005719 | Bacteria | 9057 |
| 172 | Ga0068851_10019383 | 3300005834 | Bacteria | 3286 |
| 173 | Ga0068851_10159714 | 3300005834 | Bacteria | 1237 |
| 174 | Ga0068863_100000028 | 3300005841 | Bacteria | 181662 |
| 175 | Ga0068863_100005179 | 3300005841 | Bacteria | 12862 |
| 176 | Ga0068863_100009700 | 3300005841 | Bacteria | 9393 |
| 177 | Ga0068863_100203058 | 3300005841 | Bacteria | 1907 |
| 178 | Ga0068858_100000181 | 3300005842 | Bacteria | 66254 |
| 179 | Ga0068858_100004139 | 3300005842 | Bacteria | 14270 |
| 180 | Ga0068858_100047175 | 3300005842 | Bacteria | 3994 |
| 181 | Ga0068858_100869672 | 3300005842 | Bacteria | 881 |
| 182 | Ga0068860_100005743 | 3300005843 | Bacteria | 12515 |
| 183 | Ga0068860_100041662 | 3300005843 | Bacteria | 4386 |
| 184 | Ga0068860_100579424 | 3300005843 | Bacteria | 1126 |
| 185 | Ga0068862_100000310 | 3300005844 | Bacteria | 53315 |
| 186 | Ga0068862_100135043 | 3300005844 | Bacteria | 2186 |
| 187 | Ga0068862_100190712 | 3300005844 | Bacteria | 1844 |
| 188 | Ga0075368_10000166 | 3300006042 | Bacteria | 17785 |
| 189 | Ga0075363_100154936 | 3300006048 | Bacteria | 1295 |
| 190 | Ga0075367_10000165 | 3300006178 | Bacteria | 20961 |
| 191 | Ga0075366_10017242 | 3300006195 | Bacteria | 4154 |
| 192 | Ga0097621_100495776 | 3300006237 | Bacteria | 1106 |
| 193 | Ga0075370_10100655 | 3300006353 | Bacteria | 1672 |
| 194 | Ga0097620_100000256 | 3300006931 | Bacteria | 52870 |
| 195 | Ga0097620_100014519 | 3300006931 | Bacteria | 7909 |
| 196 | Ga0105251_10023016 | 3300009011 | Bacteria | 3223 |
| 197 | Ga0105251_10107027 | 3300009011 | Bacteria | 1276 |
| 198 | Ga0105250_10285979 | 3300009092 | Bacteria | 710 |
| 199 | Ga0105240_10023003 | 3300009093 | Bacteria | 8254 |
| 200 | Ga0111539_10267250 | 3300009094 | Bacteria | 1991 |
| 201 | Ga0105245_10000853 | 3300009098 | Bacteria | 27630 |
| 202 | Ga0105247_10000644 | 3300009101 | Bacteria | 27956 |
| 203 | Ga0105247_10618861 | 3300009101 | Bacteria | 805 |
| 204 | Ga0105243_10063765 | 3300009148 | Bacteria | 2954 |
| 205 | Ga0105243_10181415 | 3300009148 | Bacteria | 1831 |
| 206 | Ga0105243_10281670 | 3300009148 | Bacteria | 1498 |
| 207 | Ga0105241_10008572 | 3300009174 | Bacteria | 7510 |
| 208 | Ga0105241_10424314 | 3300009174 | Bacteria | 1171 |
| 209 | Ga0105242_10201400 | 3300009176 | Unclassified | 1768 |
| 210 | Ga0105248_10020230 | 3300009177 | Bacteria | 7372 |
| 211 | Ga0105248_10232476 | 3300009177 | Bacteria | 2075 |
| 212 | Ga0105237_10008645 | 3300009545 | Bacteria | 11003 |
| 213 | Ga0105238_10374635 | 3300009551 | Bacteria | 1414 |
| 214 | Ga0105238_11127583 | 3300009551 | Bacteria | 807 |
| 215 | Ga0105249_10004911 | 3300009553 | Bacteria | 11538 |
| 216 | Ga0105249_10157827 | 3300009553 | Bacteria | 2189 |
| 217 | Ga0105249_11754747 | 3300009553 | Bacteria | 693 |
| 218 | Ga0105148_100460 | 3300009978 | Bacteria | 3824 |
| 219 | Ga0157373_10003521 | 3300013100 | Bacteria | 11836 |
| 220 | Ga0157373_10004059 | 3300013100 | Bacteria | 11028 |
| 221 | Ga0157373_10081951 | 3300013100 | Bacteria | 2274 |
| 222 | Ga0157373_10162755 | 3300013100 | Bacteria | 1570 |
| 223 | Ga0157373_10164707 | 3300013100 | Bacteria | 1560 |
| 224 | Ga0157373_10340048 | 3300013100 | Bacteria | 1070 |
| 225 | Ga0157371_10065105 | 3300013102 | Bacteria | 2581 |
| 226 | Ga0157371_10097703 | 3300013102 | Bacteria | 2082 |
| 227 | Ga0157371_10102209 | 3300013102 | Bacteria | 2033 |
| 228 | Ga0157371_10175356 | 3300013102 | Bacteria | 1533 |
| 229 | Ga0157371_10236991 | 3300013102 | Bacteria | 1312 |
| 230 | Ga0157371_10416884 | 3300013102 | Bacteria | 984 |
| 231 | Ga0157370_10053517 | 3300013104 | Bacteria | 3849 |
| 232 | Ga0157370_10261661 | 3300013104 | Bacteria | 1599 |
| 233 | Ga0157370_10393871 | 3300013104 | Bacteria | 1275 |
| 234 | Ga0157369_10005483 | 3300013105 | Bacteria | 14744 |
| 235 | Ga0157369_10008669 | 3300013105 | Bacteria | 11658 |
| 236 | Ga0157369_10020246 | 3300013105 | Bacteria | 7437 |
| 237 | Ga0157369_10068610 | 3300013105 | Bacteria | 3810 |
| 238 | Ga0157369_10102893 | 3300013105 | Bacteria | 3042 |
| 239 | Ga0157369_10217589 | 3300013105 | Bacteria | 2000 |
| 240 | Ga0157374_10113648 | 3300013296 | Bacteria | 2606 |
| 241 | Ga0157374_10538032 | 3300013296 | Bacteria | 1175 |
| 242 | Ga0157378_10040072 | 3300013297 | Bacteria | 4154 |
| 243 | Ga0157378_10081723 | 3300013297 | Bacteria | 2920 |
| 244 | Ga0157378_10837975 | 3300013297 | Bacteria | 947 |
| 245 | Ga0163162_10035439 | 3300013306 | Bacteria | 4971 |
| 246 | Ga0163162_10041138 | 3300013306 | Bacteria | 4623 |
| 247 | Ga0163162_10363831 | 3300013306 | Bacteria | 1579 |
| 248 | Ga0163162_10383996 | 3300013306 | Bacteria | 1538 |
| 249 | Ga0157372_10182330 | 3300013307 | Bacteria | 2431 |
| 250 | Ga0157372_10202554 | 3300013307 | Bacteria | 2299 |
| 251 | Ga0157372_11846898 | 3300013307 | Bacteria | 695 |
| 252 | Ga0157372_12518700 | 3300013307 | Bacteria | 591 |
| 253 | Ga0163163_10080992 | 3300014325 | Bacteria | 3248 |
| 254 | Ga0163163_10082591 | 3300014325 | Bacteria | 3217 |
| 255 | Ga0163163_10151215 | 3300014325 | Bacteria | 2365 |
| 256 | Ga0157380_10001163 | 3300014326 | Bacteria | 17048 |
| 257 | Ga0157380_10104065 | 3300014326 | Bacteria | 2370 |
| 258 | Ga0182008_10288782 | 3300014497 | Bacteria | 855 |
| 259 | Ga0157379_10081986 | 3300014968 | Bacteria | 2890 |
| 260 | Ga0157379_10308399 | 3300014968 | Bacteria | 1443 |
| 261 | Ga0183363_1007 | 3300015690 | Bacteria | 315687 |
| 262 | Ga0163161_10009743 | 3300017792 | Bacteria | 6657 |
| 263 | Ga0163161_10034019 | 3300017792 | Bacteria | 3644 |
| 264 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 265 | Ga0213873_10027588 | 3300021358 | Bacteria | 1386 |
| 266 | Ga0213872_10126432 | 3300021361 | Bacteria | 1128 |
| 267 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 268 | Ga0213871_10003839 | 3300021441 | Bacteria | 2946 |
| 269 | Ga0207672_1005086 | 3300025223 | Bacteria | 746 |
| 270 | Ga0209437_101961 | 3300025233 | Bacteria | 4266 |
| 271 | Ga0207425_1000049 | 3300025245 | Bacteria | 180735 |
| 272 | Ga0209148_1026487 | 3300025254 | Bacteria | 899 |
| 273 | Ga0209129_1004041 | 3300025258 | Bacteria | 5987 |
| 274 | Ga0209233_1000084 | 3300025261 | Bacteria | 335222 |
| 275 | Ga0209565_1000170 | 3300025263 | Bacteria | 84580 |
| 276 | Ga0209673_1006861 | 3300025273 | Bacteria | 5398 |
| 277 | Ga0209676_1004023 | 3300025292 | Bacteria | 8468 |
| 278 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 279 | Ga0209564_1000733 | 3300025295 | Bacteria | 46758 |
| 280 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 281 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 282 | Ga0209050_1000108 | 3300025298 | Bacteria | 222534 |
| 283 | Ga0209050_1034129 | 3300025298 | Bacteria | 1529 |
| 284 | Ga0209051_1000239 | 3300025303 | Bacteria | 92575 |
| 285 | Ga0209257_1001303 | 3300025304 | Bacteria | 30370 |
| 286 | Ga0209257_1001609 | 3300025304 | Bacteria | 25860 |
| 287 | Ga0207697_10000419 | 3300025315 | Bacteria | 24002 |
| 288 | Ga0207697_10008882 | 3300025315 | Bacteria | 4369 |
| 289 | Ga0207697_10066668 | 3300025315 | Bacteria | 1504 |
| 290 | Ga0207656_10014744 | 3300025321 | Bacteria | 3018 |
| 291 | Ga0207713_1078990 | 3300025735 | Bacteria | 1189 |
| 292 | Ga0207682_10003154 | 3300025893 | Bacteria | 7222 |
| 293 | Ga0207682_10329151 | 3300025893 | Bacteria | 718 |
| 294 | Ga0207710_10000700 | 3300025900 | Bacteria | 18794 |
| 295 | Ga0207688_10117503 | 3300025901 | Bacteria | 1549 |
| 296 | Ga0207680_10000481 | 3300025903 | Bacteria | 18900 |
| 297 | Ga0207680_10052317 | 3300025903 | Bacteria | 2446 |
| 298 | Ga0207647_10000848 | 3300025904 | Bacteria | 23724 |
| 299 | Ga0207647_10002965 | 3300025904 | Bacteria | 12768 |
| 300 | Ga0207647_10019937 | 3300025904 | Bacteria | 4503 |
| 301 | Ga0207647_10351267 | 3300025904 | Bacteria | 835 |
| 302 | Ga0207705_10057951 | 3300025909 | Bacteria | 2795 |
| 303 | Ga0207705_10092403 | 3300025909 | Bacteria | 2217 |
| 304 | Ga0207705_10103351 | 3300025909 | Bacteria | 2099 |
| 305 | Ga0207705_10131355 | 3300025909 | Bacteria | 1864 |
| 306 | Ga0207705_10140325 | 3300025909 | Bacteria | 1804 |
| 307 | Ga0207705_10185314 | 3300025909 | Bacteria | 1572 |
| 308 | Ga0207705_10246306 | 3300025909 | Bacteria | 1362 |
| 309 | Ga0207705_10372644 | 3300025909 | Bacteria | 1102 |
| 310 | Ga0207705_11095867 | 3300025909 | Bacteria | 613 |
| 311 | Ga0207684_10215440 | 3300025910 | Bacteria | 1657 |
| 312 | Ga0207654_10055457 | 3300025911 | Bacteria | 2295 |
| 313 | Ga0207654_10155086 | 3300025911 | Bacteria | 1474 |
| 314 | Ga0207707_10106419 | 3300025912 | Bacteria | 2452 |
| 315 | Ga0207707_10173424 | 3300025912 | Bacteria | 1884 |
| 316 | Ga0207707_10246896 | 3300025912 | Bacteria | 1551 |
| 317 | Ga0207707_10401112 | 3300025912 | Bacteria | 1177 |
| 318 | Ga0207695_10018286 | 3300025913 | Bacteria | 8108 |
| 319 | Ga0207695_10029118 | 3300025913 | Bacteria | 6110 |
| 320 | Ga0207671_10012474 | 3300025914 | Bacteria | 6828 |
| 321 | Ga0207660_10002430 | 3300025917 | Bacteria | 12233 |
| 322 | Ga0207660_10492475 | 3300025917 | Bacteria | 994 |
| 323 | Ga0207660_10617513 | 3300025917 | Bacteria | 883 |
| 324 | Ga0207657_10008341 | 3300025919 | Bacteria | 10530 |
| 325 | Ga0207657_10013974 | 3300025919 | Bacteria | 7855 |
| 326 | Ga0207657_10031828 | 3300025919 | Bacteria | 4771 |
| 327 | Ga0207657_10073222 | 3300025919 | Bacteria | 2896 |
| 328 | Ga0207657_10085802 | 3300025919 | Bacteria | 2636 |
| 329 | Ga0207657_10225535 | 3300025919 | Bacteria | 1500 |
| 330 | Ga0207657_10240989 | 3300025919 | Bacteria | 1444 |
| 331 | Ga0207657_11206075 | 3300025919 | Bacteria | 575 |
| 332 | Ga0207649_10000393 | 3300025920 | Bacteria | 32808 |
| 333 | Ga0207649_10388117 | 3300025920 | Bacteria | 1042 |
| 334 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 335 | Ga0207652_10064277 | 3300025921 | Bacteria | 3175 |
| 336 | Ga0207652_10144292 | 3300025921 | Bacteria | 2130 |
| 337 | Ga0207652_10473307 | 3300025921 | Bacteria | 1128 |
| 338 | Ga0207652_10578512 | 3300025921 | Bacteria | 1008 |
| 339 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 340 | Ga0207681_10003633 | 3300025923 | Bacteria | 9591 |
| 341 | Ga0207681_10057830 | 3300025923 | Bacteria | 2652 |
| 342 | Ga0207681_10067961 | 3300025923 | Bacteria | 2473 |
| 343 | Ga0207681_10127025 | 3300025923 | Bacteria | 1879 |
| 344 | Ga0207681_10330869 | 3300025923 | Bacteria | 1214 |
| 345 | Ga0207694_10003601 | 3300025924 | Bacteria | 12274 |
| 346 | Ga0207694_10141633 | 3300025924 | Bacteria | 1934 |
| 347 | Ga0207694_10365311 | 3300025924 | Bacteria | 1196 |
| 348 | Ga0207650_10002357 | 3300025925 | Bacteria | 13129 |
| 349 | Ga0207650_10003090 | 3300025925 | Bacteria | 11462 |
| 350 | Ga0207650_10049939 | 3300025925 | Bacteria | 3091 |
| 351 | Ga0207650_10230002 | 3300025925 | Bacteria | 1495 |
| 352 | Ga0207659_10002277 | 3300025926 | Bacteria | 11433 |
| 353 | Ga0207687_10003237 | 3300025927 | Bacteria | 11034 |
| 354 | Ga0207644_10000009 | 3300025931 | Bacteria | 251643 |
| 355 | Ga0207644_10141096 | 3300025931 | Bacteria | 1855 |
| 356 | Ga0207690_10067960 | 3300025932 | Bacteria | 2446 |
| 357 | Ga0207690_10102309 | 3300025932 | Bacteria | 2048 |
| 358 | Ga0207690_10174708 | 3300025932 | Bacteria | 1612 |
| 359 | Ga0207690_10479921 | 3300025932 | Bacteria | 1003 |
| 360 | Ga0207690_10756158 | 3300025932 | Bacteria | 801 |
| 361 | Ga0207706_10001776 | 3300025933 | Bacteria | 21179 |
| 362 | Ga0207706_10002422 | 3300025933 | Bacteria | 18208 |
| 363 | Ga0207706_10009419 | 3300025933 | Bacteria | 8966 |
| 364 | Ga0207706_10053926 | 3300025933 | Bacteria | 3549 |
| 365 | Ga0207706_10111158 | 3300025933 | Bacteria | 2410 |
| 366 | Ga0207686_10738817 | 3300025934 | Unclassified | 785 |
| 367 | Ga0207709_10045384 | 3300025935 | Bacteria | 2661 |
| 368 | Ga0207709_10097896 | 3300025935 | Bacteria | 1933 |
| 369 | Ga0207691_10024273 | 3300025940 | Bacteria | 5702 |
| 370 | Ga0207711_10011481 | 3300025941 | Bacteria | 7363 |
| 371 | Ga0207661_10311270 | 3300025944 | Bacteria | 1414 |
| 372 | Ga0207679_10102831 | 3300025945 | Bacteria | 2238 |
| 373 | Ga0207679_10155985 | 3300025945 | Bacteria | 1864 |
| 374 | Ga0207667_10087995 | 3300025949 | Bacteria | 3212 |
| 375 | Ga0207667_10181620 | 3300025949 | Bacteria | 2160 |
| 376 | Ga0207667_10467109 | 3300025949 | Bacteria | 1281 |
| 377 | Ga0207667_10713898 | 3300025949 | Bacteria | 1004 |
| 378 | Ga0207651_10017718 | 3300025960 | Bacteria | 4215 |
| 379 | Ga0207712_10019312 | 3300025961 | Bacteria | 4449 |
| 380 | Ga0207712_10041519 | 3300025961 | Bacteria | 3162 |
| 381 | Ga0207668_10000047 | 3300025972 | Bacteria | 101453 |
| 382 | Ga0207668_10001399 | 3300025972 | Bacteria | 14213 |
| 383 | Ga0207668_10062258 | 3300025972 | Bacteria | 2627 |
| 384 | Ga0207668_10110957 | 3300025972 | Bacteria | 2058 |
| 385 | Ga0207668_10154373 | 3300025972 | Bacteria | 1781 |
| 386 | Ga0207668_10326348 | 3300025972 | Bacteria | 1275 |
| 387 | Ga0207640_10003418 | 3300025981 | Bacteria | 8550 |
| 388 | Ga0207640_10015151 | 3300025981 | Bacteria | 4456 |
| 389 | Ga0207640_10053669 | 3300025981 | Bacteria | 2632 |
| 390 | Ga0207658_10000057 | 3300025986 | Bacteria | 124003 |
| 391 | Ga0207658_10002888 | 3300025986 | Bacteria | 12319 |
| 392 | Ga0207703_10000135 | 3300026035 | Bacteria | 89779 |
| 393 | Ga0207703_10006420 | 3300026035 | Bacteria | 9398 |
| 394 | Ga0207639_10000323 | 3300026041 | Bacteria | 33257 |
| 395 | Ga0207639_10017444 | 3300026041 | Bacteria | 5090 |
| 396 | Ga0207639_10057207 | 3300026041 | Bacteria | 2993 |
| 397 | Ga0207639_10070294 | 3300026041 | Bacteria | 2734 |
| 398 | Ga0207639_10445859 | 3300026041 | Bacteria | 1174 |
| 399 | Ga0207639_10908420 | 3300026041 | Bacteria | 823 |
| 400 | Ga0207678_10000068 | 3300026067 | Bacteria | 81610 |
| 401 | Ga0207678_10008727 | 3300026067 | Bacteria | 8925 |
| 402 | Ga0207678_10076194 | 3300026067 | Bacteria | 2873 |
| 403 | Ga0207678_10181976 | 3300026067 | Bacteria | 1795 |
| 404 | Ga0207678_10801019 | 3300026067 | Bacteria | 832 |
| 405 | Ga0207708_10111841 | 3300026075 | Bacteria | 2121 |
| 406 | Ga0207702_10008576 | 3300026078 | Bacteria | 8617 |
| 407 | Ga0207702_10658268 | 3300026078 | Bacteria | 1030 |
| 408 | Ga0207702_11833888 | 3300026078 | Bacteria | 598 |
| 409 | Ga0207641_10000014 | 3300026088 | Bacteria | 336170 |
| 410 | Ga0207641_10000277 | 3300026088 | Bacteria | 64441 |
| 411 | Ga0207641_10016289 | 3300026088 | Bacteria | 6087 |
| 412 | Ga0207648_10072221 | 3300026089 | Bacteria | 3008 |
| 413 | Ga0207648_10197422 | 3300026089 | Bacteria | 1784 |
| 414 | Ga0207676_10000532 | 3300026095 | Bacteria | 31972 |
| 415 | Ga0207676_10000600 | 3300026095 | Bacteria | 29522 |
| 416 | Ga0207676_10001074 | 3300026095 | Bacteria | 20774 |
| 417 | Ga0207676_10467989 | 3300026095 | Bacteria | 1191 |
| 418 | Ga0207674_10022118 | 3300026116 | Bacteria | 6834 |
| 419 | Ga0207674_10048226 | 3300026116 | Bacteria | 4360 |
| 420 | Ga0207674_10063538 | 3300026116 | Bacteria | 3727 |
| 421 | Ga0207674_10295080 | 3300026116 | Bacteria | 1570 |
| 422 | Ga0207674_11407119 | 3300026116 | Bacteria | 667 |
| 423 | Ga0207674_11407120 | 3300026116 | Bacteria | 667 |
| 424 | Ga0207675_100000740 | 3300026118 | Bacteria | 32427 |
| 425 | Ga0207675_100003945 | 3300026118 | Bacteria | 14400 |
| 426 | Ga0207675_100423211 | 3300026118 | Bacteria | 1316 |
| 427 | Ga0207683_10008377 | 3300026121 | Bacteria | 8843 |
| 428 | Ga0207698_10016480 | 3300026142 | Bacteria | 4982 |
| 429 | Ga0207698_10051137 | 3300026142 | Bacteria | 3157 |
| 430 | Ga0207698_10083226 | 3300026142 | Bacteria | 2589 |
| 431 | Ga0207698_10176048 | 3300026142 | Bacteria | 1889 |
| 432 | Ga0207698_10398497 | 3300026142 | Bacteria | 1315 |
| 433 | Ga0209813_10000062 | 3300027866 | Bacteria | 43852 |
| 434 | Ga0209974_10030433 | 3300027876 | Bacteria | 1789 |
| 435 | Ga0207428_10487573 | 3300027907 | Bacteria | 896 |
| 436 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 437 | Ga0268266_10193219 | 3300028379 | Bacteria | 1859 |
| 438 | Ga0268266_10226630 | 3300028379 | Bacteria | 1720 |
| 439 | Ga0268266_10415806 | 3300028379 | Bacteria | 1274 |
| 440 | Ga0268266_10632788 | 3300028379 | Bacteria | 1029 |
| 441 | Ga0268265_10001269 | 3300028380 | Bacteria | 21775 |
| 442 | Ga0268265_10008180 | 3300028380 | Bacteria | 7066 |
| 443 | Ga0268265_10160681 | 3300028380 | Bacteria | 1908 |
| 444 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 445 | Ga0268264_10004744 | 3300028381 | Bacteria | 11545 |
| 446 | Ga0268264_10516537 | 3300028381 | Bacteria | 1167 |
| 447 | Ga0307513_10030103 | 3300031456 | Bacteria | 6172 |
| 448 | Ga0307408_100001959 | 3300031548 | Bacteria | 14887 |
| 449 | Ga0307408_100008912 | 3300031548 | Bacteria | 6630 |
| 450 | Ga0307408_100018443 | 3300031548 | Bacteria | 4684 |
| 451 | Ga0307508_10001350 | 3300031616 | Bacteria | 27688 |
| 452 | Ga0307405_10005480 | 3300031731 | Bacteria | 6125 |
| 453 | Ga0307405_10346769 | 3300031731 | Bacteria | 1144 |
| 454 | Ga0307405_10942180 | 3300031731 | Bacteria | 733 |
| 455 | Ga0307413_10018804 | 3300031824 | Bacteria | 3634 |
| 456 | Ga0307413_10058402 | 3300031824 | Bacteria | 2364 |
| 457 | Ga0307413_10158299 | 3300031824 | Bacteria | 1588 |
| 458 | Ga0307410_10002493 | 3300031852 | Bacteria | 8895 |
| 459 | Ga0307410_10006448 | 3300031852 | Bacteria | 6334 |
| 460 | Ga0307410_10014471 | 3300031852 | Bacteria | 4643 |
| 461 | Ga0307406_10281262 | 3300031901 | Bacteria | 1269 |
| 462 | Ga0307406_10412255 | 3300031901 | Bacteria | 1074 |
| 463 | Ga0307406_10663458 | 3300031901 | Bacteria | 867 |
| 464 | Ga0307407_10011510 | 3300031903 | Bacteria | 4214 |
| 465 | Ga0307407_10084793 | 3300031903 | Bacteria | 1926 |
| 466 | Ga0307407_10321260 | 3300031903 | Bacteria | 1086 |
| 467 | Ga0307412_10054477 | 3300031911 | Bacteria | 2655 |
| 468 | Ga0307412_10057889 | 3300031911 | Bacteria | 2589 |
| 469 | Ga0307412_10612831 | 3300031911 | Bacteria | 923 |
| 470 | Ga0307412_10979349 | 3300031911 | Bacteria | 746 |
| 471 | Ga0307412_11213228 | 3300031911 | Bacteria | 676 |
| 472 | Ga0307409_100001956 | 3300031995 | Bacteria | 10535 |
| 473 | Ga0307409_100134104 | 3300031995 | Bacteria | 2121 |
| 474 | Ga0307409_100737894 | 3300031995 | Bacteria | 987 |
| 475 | Ga0307416_100006877 | 3300032002 | Bacteria | 7160 |
| 476 | Ga0307416_100067191 | 3300032002 | Bacteria | 2955 |
| 477 | Ga0307416_100126467 | 3300032002 | Bacteria | 2290 |
| 478 | Ga0307416_100163788 | 3300032002 | Bacteria | 2059 |
| 479 | Ga0307416_100283559 | 3300032002 | Bacteria | 1635 |
| 480 | Ga0307416_102348288 | 3300032002 | Bacteria | 633 |
| 481 | Ga0307414_10005096 | 3300032004 | Bacteria | 7204 |
| 482 | Ga0307414_10022674 | 3300032004 | Bacteria | 3966 |
| 483 | Ga0307414_10130704 | 3300032004 | Bacteria | 1949 |
| 484 | Ga0307414_10182960 | 3300032004 | Bacteria | 1687 |
| 485 | Ga0307414_10268528 | 3300032004 | Bacteria | 1427 |
| 486 | Ga0307414_10361270 | 3300032004 | Bacteria | 1249 |
| 487 | Ga0307414_10369404 | 3300032004 | Bacteria | 1237 |
| 488 | Ga0307414_11249543 | 3300032004 | Bacteria | 688 |
| 489 | Ga0307411_10003049 | 3300032005 | Bacteria | 7653 |
| 490 | Ga0307411_10033420 | 3300032005 | Bacteria | 3190 |
| 491 | Ga0307411_10033422 | 3300032005 | Bacteria | 3190 |
| 492 | Ga0307415_100031294 | 3300032126 | Bacteria | 3426 |
| 493 | Ga0307415_100058462 | 3300032126 | Bacteria | 2655 |
| 494 | Ga0307415_100160374 | 3300032126 | Bacteria | 1742 |
| 495 | Ga0373923_0264169 | 3300035111 | Bacteria | 808 |
| 496 | Ga0373935_0011883 | 3300035692 | Bacteria | 5231 |
| 497 | Ga0373927_0618172 | 3300035695 | Bacteria | 716 |
| 498 | Ga0373937_0300059 | 3300036401 | Bacteria | 1518 |
| 499 | Ga0395899_0018782 | 3300037312 | Bacteria | 5252 |
| 500 | Ga0395899_0158379 | 3300037312 | Bacteria | 1601 |
| 501 | Ga0395899_0250521 | 3300037312 | Bacteria | 1215 |
| 502 | Ga0395899_0401583 | 3300037312 | Bacteria | 907 |
| 503 | Ga0395900_0000764 | 3300037418 | Bacteria | 42836 |
| 504 | Ga0395900_0019021 | 3300037418 | Bacteria | 7004 |
| 505 | Ga0395900_0020505 | 3300037418 | Bacteria | 6748 |
| 506 | Ga0395900_0237976 | 3300037418 | Bacteria | 1827 |
| 507 | Ga0395900_0525565 | 3300037418 | Bacteria | 1130 |
| 508 | Ga0395900_0782442 | 3300037418 | Bacteria | 883 |
| 509 | Ga0395898_0056692 | 3300037466 | Bacteria | 3819 |
| 510 | Ga0395898_0081863 | 3300037466 | Bacteria | 3112 |
| 511 | Ga0395898_0728105 | 3300037466 | Bacteria | 933 |
| 512 | Ga0395898_1833019 | 3300037466 | Bacteria | 527 |
| 513 | Ga0395905_0003045 | 3300037471 | Bacteria | 18153 |
| 514 | Ga0395905_0021583 | 3300037471 | Bacteria | 6088 |
| 515 | Ga0395905_0026680 | 3300037471 | Bacteria | 5447 |
| 516 | Ga0395905_0026966 | 3300037471 | Bacteria | 5418 |
| 517 | Ga0395905_0061435 | 3300037471 | Bacteria | 3515 |
| 518 | Ga0395905_0119628 | 3300037471 | Bacteria | 2475 |
| 519 | Ga0395905_0151993 | 3300037471 | Bacteria | 2178 |
| 520 | Ga0395905_0201402 | 3300037471 | Bacteria | 1866 |
| 521 | Ga0395905_0228802 | 3300037471 | Bacteria | 1739 |
| 522 | Ga0395905_0422179 | 3300037471 | Bacteria | 1230 |
| 523 | Ga0395905_0893439 | 3300037471 | Bacteria | 791 |
| 524 | Ga0395905_1430114 | 3300037471 | Bacteria | 596 |
| 525 | Ga0436364_0783469 | 3300037853 | Bacteria | 845 |
| 526 | Ga0436364_1376076 | 3300037853 | Bacteria | 696 |
| 527 | Ga0436364_1549875 | 3300037853 | Bacteria | 1560 |
| 528 | Ga0395901_0008085 | 3300038443 | Bacteria | 10626 |
| 529 | Ga0395901_0009829 | 3300038443 | Bacteria | 9698 |
| 530 | Ga0395901_0011906 | 3300038443 | Bacteria | 8821 |
| 531 | Ga0395901_0167230 | 3300038443 | Bacteria | 2308 |
| 532 | Ga0395901_0180614 | 3300038443 | Bacteria | 2213 |
| 533 | Ga0395901_0557676 | 3300038443 | Bacteria | 1160 |
| 534 | Ga0395901_0573348 | 3300038443 | Bacteria | 1141 |
| 535 | Ga0436365_0176211 | 3300039437 | Bacteria | 57194 |
| 536 | Ga0436365_0862951 | 3300039437 | Bacteria | 1103 |
| 537 | Ga0436365_1643344 | 3300039437 | Bacteria | 707 |
| 538 | Ga0436360_1357732 | 3300039438 | Bacteria | 2661 |
| 539 | Ga0436361_0580849 | 3300039447 | Bacteria | 1018 |
| 540 | Ga0436361_1102360 | 3300039447 | Bacteria | 3934 |
| 541 | Ga0436363_0689652 | 3300039450 | Bacteria | 689 |
| 542 | Ga0436363_1450113 | 3300039450 | Bacteria | 858 |
| 543 | Ga0436362_0386479 | 3300039453 | Bacteria | 885 |
| 544 | Ga0436362_0945445 | 3300039453 | Bacteria | 4337 |
| 545 | Ga0436362_0976836 | 3300039453 | Bacteria | 135942 |
| 546 | Ga0439448_0002960 | 3300042005 | Bacteria | 4660 |
| 547 | Ga0466966_0001337 | 3300044684 | Bacteria | 15828 |
| 548 | Ga0466963_0277001 | 3300044694 | Bacteria | 1179 |
| 549 | Ga0495617_041834 | 3300046452 | Bacteria | 1531 |
| 550 | Ga0495627_000584 | 3300046453 | Bacteria | 29144 |
| 551 | Ga0495627_000871 | 3300046453 | Bacteria | 21374 |
| 552 | Ga0495627_062907 | 3300046453 | Bacteria | 1095 |
| 553 | Ga0495627_088423 | 3300046453 | Bacteria | 892 |
| 554 | Ga0495638_0055240 | 3300046460 | Bacteria | 2466 |
| 555 | Ga0495638_0247843 | 3300046460 | Bacteria | 983 |
| 556 | Ga0495584_0322376 | 3300046491 | Bacteria | 785 |
| 557 | Ga0495585_0182581 | 3300046492 | Bacteria | 1078 |
| 558 | Ga0495585_0280224 | 3300046492 | Bacteria | 824 |
| 559 | Ga0495596_0045487 | 3300046500 | Bacteria | 1726 |
| 560 | Ga0495610_0000186 | 3300046512 | Bacteria | 69408 |
| 561 | Ga0495610_0017207 | 3300046512 | Bacteria | 4127 |
| 562 | Ga0495616_0000182 | 3300046513 | Bacteria | 53346 |
| 563 | Ga0495632_0001056 | 3300046519 | Bacteria | 23635 |
| 564 | Ga0495637_0018088 | 3300046520 | Bacteria | 3272 |
| 565 | Ga0495637_0020325 | 3300046520 | Bacteria | 3057 |
| 566 | Ga0495643_0000146 | 3300046522 | Bacteria | 114508 |
| 567 | Ga0495648_0004271 | 3300046524 | Bacteria | 12254 |
| 568 | Ga0495648_0113632 | 3300046524 | Bacteria | 1468 |
| 569 | Ga0495648_0217601 | 3300046524 | Bacteria | 944 |
| 570 | Ga0495663_0000006 | 3300046525 | Bacteria | 306938 |
| 571 | Ga0495663_0083488 | 3300046525 | Bacteria | 1032 |
| 572 | Ga0495598_0013638 | 3300046537 | Bacteria | 2019 |
| 573 | Ga0495621_0001565 | 3300046539 | Bacteria | 5962 |
| 574 | Ga0495633_0000192 | 3300046558 | Bacteria | 78563 |
| 575 | Ga0495633_0001161 | 3300046558 | Bacteria | 21140 |
| 576 | Ga0495633_0020434 | 3300046558 | Bacteria | 3330 |
| 577 | Ga0495633_0039310 | 3300046558 | Bacteria | 2258 |
| 578 | Ga0495668_0016769 | 3300046616 | Bacteria | 4257 |
| 579 | Ga0495625_0000107 | 3300046660 | Bacteria | 125777 |
| 580 | Ga0495625_0377657 | 3300046660 | Bacteria | 890 |
| 581 | Ga0495659_0010552 | 3300046664 | Bacteria | 2967 |
| 582 | Ga0495670_0007711 | 3300046691 | Bacteria | 5293 |
| 583 | Ga0495671_0000100 | 3300046692 | Bacteria | 78876 |
| 584 | Ga0495677_0046050 | 3300047445 | Bacteria | 1601 |
| 585 | Ga0495681_0001332 | 3300047470 | Bacteria | 18673 |
| 586 | Ga0495681_0034366 | 3300047470 | Bacteria | 2527 |
| 587 | Ga0495686_0000513 | 3300047472 | Bacteria | 56005 |
| 588 | Ga0495686_0032568 | 3300047472 | Bacteria | 3373 |
| 589 | Ga0495686_0047524 | 3300047472 | Bacteria | 2709 |
| 590 | Ga0495686_0087793 | 3300047472 | Bacteria | 1891 |
| 591 | Ga0496102_0562859 | 3300048905 | Bacteria | 1063 |
| 592 | Ga0496102_0631815 | 3300048905 | Bacteria | 994 |
| 593 | Ga0496102_0702575 | 3300048905 | Bacteria | 934 |
| 594 | Ga0496102_1326051 | 3300048905 | Bacteria | 639 |
| 595 | Ga0496103_0504660 | 3300048906 | Bacteria | 774 |
| 596 | Ga0496105_0325649 | 3300048908 | Bacteria | 1231 |
| 597 | Ga0496107_0108645 | 3300048910 | Bacteria | 2037 |
| 598 | Ga0496108_0000914 | 3300048911 | Bacteria | 22971 |
| 599 | Ga0496109_0051693 | 3300048912 | Bacteria | 3743 |
| 600 | Ga0496110_0045756 | 3300048913 | Bacteria | 3826 |
| 601 | Ga0496110_0057006 | 3300048913 | Bacteria | 3438 |
| 602 | Ga0496110_0489587 | 3300048913 | Bacteria | 1120 |
| 603 | Ga0496111_0139718 | 3300048914 | Bacteria | 1795 |
| 604 | Ga0496113_0194112 | 3300048916 | Bacteria | 1612 |
| 605 | Ga0496114_0000206 | 3300048917 | Bacteria | 42865 |
| 606 | Ga0496115_0001013 | 3300048918 | Bacteria | 20385 |
| 607 | Ga0496115_0429820 | 3300048918 | Bacteria | 1069 |
| 608 | Ga0496116_0019717 | 3300048919 | Bacteria | 5155 |
| 609 | Ga0496116_0047570 | 3300048919 | Bacteria | 2886 |
| 610 | Ga0496117_0030704 | 3300048920 | Bacteria | 4117 |
| 611 | Ga0496119_0025551 | 3300048922 | Bacteria | 4121 |
| 612 | Ga0496120_0146262 | 3300048923 | Bacteria | 1193 |
| 613 | Ga0496121_0000189 | 3300048924 | Bacteria | 137827 |
| 614 | Ga0496121_0003303 | 3300048924 | Bacteria | 23154 |
| 615 | Ga0496121_0035146 | 3300048924 | Bacteria | 4495 |
| 616 | Ga0496122_0125665 | 3300048925 | Bacteria | 1642 |
| 617 | Ga0496123_0019732 | 3300048926 | Bacteria | 5303 |
| 618 | Ga0496123_0070113 | 3300048926 | Bacteria | 2196 |
| 619 | Ga0496124_0029380 | 3300048927 | Bacteria | 4899 |
| 620 | Ga0496124_0060805 | 3300048927 | Bacteria | 3168 |
| 621 | Ga0496124_0196213 | 3300048927 | Bacteria | 1540 |
| 622 | Ga0496124_0225022 | 3300048927 | Bacteria | 1407 |
| 623 | Ga0496125_0009585 | 3300048928 | Bacteria | 9911 |
| 624 | Ga0496125_0035550 | 3300048928 | Bacteria | 4367 |
| 625 | Ga0496125_0084265 | 3300048928 | Bacteria | 2414 |
| 626 | Ga0496126_0018985 | 3300048929 | Bacteria | 6789 |
| 627 | Ga0496126_0829352 | 3300048929 | Bacteria | 707 |
| 628 | Ga0495678_059497 | 3300049459 | Bacteria | 1440 |
| 629 | Ga0501290_006651 | 3300049513 | Bacteria | 1447 |
| 630 | Ga0501033_0157192 | 3300049570 | Bacteria | 1638 |
| 631 | Ga0501033_0392407 | 3300049570 | Bacteria | 969 |
| 632 | Ga0501034_0020877 | 3300049571 | Bacteria | 6685 |
| 633 | Ga0501034_0344439 | 3300049571 | Bacteria | 1420 |
| 634 | Ga0501037_0484270 | 3300049573 | Bacteria | 841 |
| 635 | Ga0501046_0106566 | 3300049580 | Bacteria | 2145 |
| 636 | Ga0501047_0235519 | 3300049581 | Bacteria | 1683 |
| 637 | Ga0501070_0152544 | 3300049586 | Bacteria | 1906 |
| 638 | Ga0501071_0239731 | 3300049587 | Bacteria | 1367 |
| 639 | Ga0501198_020873 | 3300049649 | Bacteria | 1040 |
| 640 | Ga0501211_013375 | 3300049658 | Bacteria | 816 |
| 641 | Ga0501223_000036 | 3300049663 | Bacteria | 46823 |
| 642 | Ga0501223_004150 | 3300049663 | Bacteria | 3121 |
| 643 | Ga0501223_006069 | 3300049663 | Bacteria | 2513 |
| 644 | Ga0501223_016865 | 3300049663 | Bacteria | 1442 |
| 645 | Ga0501224_000001 | 3300049664 | Bacteria | 308131 |
| 646 | Ga0501227_015092 | 3300049665 | Bacteria | 1724 |
| 647 | Ga0501233_024940 | 3300049668 | Bacteria | 1311 |
| 648 | Ga0501235_012396 | 3300049669 | Bacteria | 1875 |
| 649 | Ga0501243_040218 | 3300049675 | Bacteria | 820 |
| 650 | Ga0501247_006394 | 3300049677 | Bacteria | 1333 |
| 651 | Ga0501256_002042 | 3300049685 | Bacteria | 1572 |
| 652 | Ga0501257_000073 | 3300049686 | Bacteria | 25203 |
| 653 | Ga0501225_0000037 | 3300049705 | Bacteria | 46276 |
| 654 | Ga0501225_0001326 | 3300049705 | Bacteria | 7692 |
| 655 | Ga0501225_0022235 | 3300049705 | Bacteria | 1751 |
| 656 | Ga0501267_008201 | 3300049764 | Bacteria | 1028 |
| 657 | Ga0501268_008723 | 3300049765 | Bacteria | 1543 |
| 658 | Ga0501278_016981 | 3300049774 | Bacteria | 639 |
| 659 | Ga0501279_012735 | 3300049775 | Bacteria | 1146 |
| 660 | Ga0501280_005610 | 3300049776 | Bacteria | 1792 |
| 661 | Ga0501283_035633 | 3300049779 | Bacteria | 848 |
| 662 | Ga0501044_0225587 | 3300049823 | Bacteria | 1823 |
| 663 | Ga0501044_0267643 | 3300049823 | Bacteria | 1646 |
| 664 | Ga0501044_0484226 | 3300049823 | Bacteria | 1140 |
| 665 | Ga0501044_0653431 | 3300049823 | Bacteria | 940 |
| 666 | Ga0501044_1284043 | 3300049823 | Bacteria | 599 |
| 667 | Ga0501226_000047 | 3300049853 | Bacteria | 54518 |
| 668 | nmdc:mga03n38_326177_c1 | 3300050490 | Bacteria | 830 |
| 669 | nmdc:mga0k408_202812_c1 | 3300050493 | Bacteria | 1184 |
| 670 | nmdc:mga06z11_36_c1 | 3300050494 | Bacteria | 55905 |
| 671 | nmdc:mga04h51_475_c1 | 3300050495 | Bacteria | 9623 |
| 672 | nmdc:mga07m45_152791_c1 | 3300050496 | Bacteria | 1339 |
| 673 | nmdc:mga08y16_187000_c1 | 3300050511 | Bacteria | 2149 |
| 674 | Ga0500610_0418004 | 3300053079 | Bacteria | 538 |
| 675 | Ga0500643_000136 | 3300053087 | Bacteria | 74292 |
| 676 | Ga0500643_001250 | 3300053087 | Bacteria | 15061 |
| 677 | Ga0500643_037629 | 3300053087 | Bacteria | 1439 |
| 678 | Ga0500595_001051 | 3300053119 | Bacteria | 15380 |
| 679 | Ga0500573_0000021 | 3300053140 | Bacteria | 159093 |
| 680 | Ga0500573_0110159 | 3300053140 | Bacteria | 1541 |
| 681 | Ga0500604_0004006 | 3300053151 | Bacteria | 3933 |
| 682 | Ga0500616_0199798 | 3300053153 | Bacteria | 886 |
| 683 | Ga0500624_000015 | 3300053157 | Bacteria | 161928 |
| 684 | Ga0500624_000930 | 3300053157 | Bacteria | 6159 |
| 685 | Ga0500627_0000774 | 3300053158 | Bacteria | 8513 |
| 686 | Ga0500636_0102937 | 3300053177 | Bacteria | 1620 |
| 687 | Ga0500645_003386 | 3300053730 | Bacteria | 6510 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2993693658 | 2993696320 | 132 |
| 2 | 3300037471 | Ga0395905_0893439 | Ga0395905_0893439_360_761 | 133 |
| 3 | 3300037466 | Ga0395898_1833019 | Ga0395898_1833019_95_505 | 136 |
| 4 | 3300046453 | Ga0495627_062907 | Ga0495627_062907_609_1058 | 148 |
| 5 | 3300002067 | JGI24735J21928_10000676 | JGI24735J21928_1000067610 | 150 |
| 6 | 3300053079 | Ga0500610_0418004 | Ga0500610_0418004_70_525 | 151 |
| 7 | 3300046660 | Ga0495625_0377657 | Ga0495625_0377657_228_686 | 152 |
| 8 | 3300039437 | Ga0436365_1643344 | Ga0436365_1643344_105_638 | 156 |
| 9 | iso_pu_bacteria | 2920107658 | 2920114608 | 158 |
| 10 | 3300035111 | Ga0373923_0264169 | Ga0373923_0264169_123_605 | 159 |
| 11 | 3300009176 | Ga0105242_10201400 | Ga0105242_102014003 | 160 |
| 12 | 3300025934 | Ga0207686_10738817 | Ga0207686_107388172 | 160 |
| 13 | 3300005347 | Ga0070668_100078772 | Ga0070668_1000787722 | 161 |
| 14 | 3300005353 | Ga0070669_100525624 | Ga0070669_1005256242 | 161 |
| 15 | 3300005366 | Ga0070659_100862008 | Ga0070659_1008620082 | 161 |
| 16 | 3300005457 | Ga0070662_100001528 | Ga0070662_1000015288 | 161 |
| 17 | 3300005458 | Ga0070681_10304875 | Ga0070681_103048752 | 161 |
| 18 | 3300005530 | Ga0070679_100091875 | Ga0070679_1000918753 | 161 |
| 19 | 3300005548 | Ga0070665_100310719 | Ga0070665_1003107192 | 161 |
| 20 | 3300009093 | Ga0105240_10023003 | Ga0105240_100230033 | 161 |
| 21 | 3300009177 | Ga0105248_10232476 | Ga0105248_102324762 | 161 |
| 22 | 3300013100 | Ga0157373_10003521 | Ga0157373_1000352110 | 161 |
| 23 | 3300013105 | Ga0157369_10020246 | Ga0157369_100202466 | 161 |
| 24 | 3300014326 | Ga0157380_10104065 | Ga0157380_101040654 | 161 |
| 25 | 3300025893 | Ga0207682_10329151 | Ga0207682_103291512 | 161 |
| 26 | 3300025913 | Ga0207695_10018286 | Ga0207695_100182868 | 161 |
| 27 | 3300025921 | Ga0207652_10064277 | Ga0207652_100642773 | 161 |
| 28 | 3300025923 | Ga0207681_10330869 | Ga0207681_103308692 | 161 |
| 29 | 3300025932 | Ga0207690_10756158 | Ga0207690_107561582 | 161 |
| 30 | 3300025933 | Ga0207706_10002422 | Ga0207706_1000242212 | 161 |
| 31 | 3300025972 | Ga0207668_10110957 | Ga0207668_101109573 | 161 |
| 32 | 3300025981 | Ga0207640_10003418 | Ga0207640_100034186 | 161 |
| 33 | 3300026041 | Ga0207639_10070294 | Ga0207639_100702943 | 161 |
| 34 | 3300028379 | Ga0268266_10226630 | Ga0268266_102266302 | 161 |
| 35 | 3300031911 | Ga0307412_10979349 | Ga0307412_109793492 | 161 |
| 36 | 3300032002 | Ga0307416_100283559 | Ga0307416_1002835592 | 161 |
| 37 | 3300032126 | Ga0307415_100160374 | Ga0307415_1001603742 | 161 |
| 38 | 3300037466 | Ga0395898_0056692 | Ga0395898_0056692_747_1232 | 161 |
| 39 | 3300037471 | Ga0395905_0026680 | Ga0395905_0026680_1406_1891 | 161 |
| 40 | 3300038443 | Ga0395901_0011906 | Ga0395901_0011906_2664_3149 | 161 |
| 41 | 3300039447 | Ga0436361_0580849 | Ga0436361_0580849_327_869 | 161 |
| 42 | 3300044684 | Ga0466966_0001337 | Ga0466966_0001337_11721_12209 | 161 |
| 43 | 3300046500 | Ga0495596_0045487 | Ga0495596_0045487_103_591 | 161 |
| 44 | 3300046525 | Ga0495663_0083488 | Ga0495663_0083488_93_581 | 161 |
| 45 | 3300046537 | Ga0495598_0013638 | Ga0495598_0013638_544_1032 | 161 |
| 46 | 3300046539 | Ga0495621_0001565 | Ga0495621_0001565_1685_2173 | 161 |
| 47 | 3300046558 | Ga0495633_0039310 | Ga0495633_0039310_1416_1904 | 161 |
| 48 | 3300046664 | Ga0495659_0010552 | Ga0495659_0010552_1792_2280 | 161 |
| 49 | 3300046691 | Ga0495670_0007711 | Ga0495670_0007711_4495_4983 | 161 |
| 50 | 3300048918 | Ga0496115_0429820 | Ga0496115_0429820_493_1029 | 161 |
| 51 | 3300001904 | JGI24736J21556_1035193 | JGI24736J21556_10351931 | 162 |
| 52 | 3300001979 | JGI24740J21852_10082444 | JGI24740J21852_100824441 | 162 |
| 53 | 3300001990 | JGI24737J22298_10018373 | JGI24737J22298_100183732 | 162 |
| 54 | 3300002067 | JGI24735J21928_10007951 | JGI24735J21928_100079514 | 162 |
| 55 | 3300002076 | JGI24749J21850_1022072 | JGI24749J21850_10220722 | 162 |
| 56 | 3300002239 | JGI24034J26672_10009458 | JGI24034J26672_100094582 | 162 |
| 57 | 3300005293 | Ga0065715_10000724 | Ga0065715_100007249 | 162 |
| 58 | 3300005327 | Ga0070658_10135521 | Ga0070658_101355212 | 162 |
| 59 | 3300005327 | Ga0070658_10295647 | Ga0070658_102956471 | 162 |
| 60 | 3300005327 | Ga0070658_10528128 | Ga0070658_105281282 | 162 |
| 61 | 3300005329 | Ga0070683_100836122 | Ga0070683_1008361221 | 162 |
| 62 | 3300005331 | Ga0070670_100001075 | Ga0070670_10000107512 | 162 |
| 63 | 3300005331 | Ga0070670_100003439 | Ga0070670_1000034399 | 162 |
| 64 | 3300005331 | Ga0070670_100055005 | Ga0070670_1000550055 | 162 |
| 65 | 3300005333 | Ga0070677_10000705 | Ga0070677_100007054 | 162 |
| 66 | 3300005335 | Ga0070666_10082589 | Ga0070666_100825893 | 162 |
| 67 | 3300005336 | Ga0070680_100061186 | Ga0070680_1000611862 | 162 |
| 68 | 3300005336 | Ga0070680_100203329 | Ga0070680_1002033292 | 162 |
| 69 | 3300005336 | Ga0070680_100478403 | Ga0070680_1004784032 | 162 |
| 70 | 3300005339 | Ga0070660_100067208 | Ga0070660_1000672082 | 162 |
| 71 | 3300005339 | Ga0070660_100285692 | Ga0070660_1002856922 | 162 |
| 72 | 3300005339 | Ga0070660_100635435 | Ga0070660_1006354351 | 162 |
| 73 | 3300005339 | Ga0070660_101062951 | Ga0070660_1010629511 | 162 |
| 74 | 3300005344 | Ga0070661_100078489 | Ga0070661_1000784893 | 162 |
| 75 | 3300005345 | Ga0070692_10006130 | Ga0070692_100061302 | 162 |
| 76 | 3300005347 | Ga0070668_100035049 | Ga0070668_1000350493 | 162 |
| 77 | 3300005347 | Ga0070668_100576832 | Ga0070668_1005768322 | 162 |
| 78 | 3300005353 | Ga0070669_100003409 | Ga0070669_1000034095 | 162 |
| 79 | 3300005354 | Ga0070675_100006846 | Ga0070675_1000068462 | 162 |
| 80 | 3300005355 | Ga0070671_100051163 | Ga0070671_1000511632 | 162 |
| 81 | 3300005356 | Ga0070674_100010543 | Ga0070674_1000105438 | 162 |
| 82 | 3300005364 | Ga0070673_100034866 | Ga0070673_1000348662 | 162 |
| 83 | 3300005366 | Ga0070659_100060274 | Ga0070659_1000602741 | 162 |
| 84 | 3300005367 | Ga0070667_100137672 | Ga0070667_1001376722 | 162 |
| 85 | 3300005438 | Ga0070701_10088315 | Ga0070701_100883152 | 162 |
| 86 | 3300005441 | Ga0070700_100055816 | Ga0070700_1000558163 | 162 |
| 87 | 3300005455 | Ga0070663_100340925 | Ga0070663_1003409252 | 162 |
| 88 | 3300005455 | Ga0070663_101366240 | Ga0070663_1013662401 | 162 |
| 89 | 3300005456 | Ga0070678_100006580 | Ga0070678_1000065806 | 162 |
| 90 | 3300005457 | Ga0070662_100019126 | Ga0070662_1000191266 | 162 |
| 91 | 3300005457 | Ga0070662_100240976 | Ga0070662_1002409762 | 162 |
| 92 | 3300005458 | Ga0070681_10302567 | Ga0070681_103025672 | 162 |
| 93 | 3300005458 | Ga0070681_10503411 | Ga0070681_105034112 | 162 |
| 94 | 3300005459 | Ga0068867_100064156 | Ga0068867_1000641562 | 162 |
| 95 | 3300005530 | Ga0070679_100205183 | Ga0070679_1002051832 | 162 |
| 96 | 3300005530 | Ga0070679_100262730 | Ga0070679_1002627303 | 162 |
| 97 | 3300005539 | Ga0068853_100124119 | Ga0068853_1001241192 | 162 |
| 98 | 3300005543 | Ga0070672_100005676 | Ga0070672_1000056765 | 162 |
| 99 | 3300005548 | Ga0070665_100822401 | Ga0070665_1008224012 | 162 |
| 100 | 3300005548 | Ga0070665_101837287 | Ga0070665_1018372871 | 162 |
| 101 | 3300005563 | Ga0068855_100473645 | Ga0068855_1004736452 | 162 |
| 102 | 3300005564 | Ga0070664_100061185 | Ga0070664_1000611854 | 162 |
| 103 | 3300005578 | Ga0068854_100119433 | Ga0068854_1001194333 | 162 |
| 104 | 3300005578 | Ga0068854_100264883 | Ga0068854_1002648832 | 162 |
| 105 | 3300005616 | Ga0068852_100051429 | Ga0068852_1000514292 | 162 |
| 106 | 3300005617 | Ga0068859_100014519 | Ga0068859_1000145194 | 162 |
| 107 | 3300005719 | Ga0068861_100004837 | Ga0068861_1000048378 | 162 |
| 108 | 3300005841 | Ga0068863_100203058 | Ga0068863_1002030582 | 162 |
| 109 | 3300005842 | Ga0068858_100869672 | Ga0068858_1008696722 | 162 |
| 110 | 3300005844 | Ga0068862_100135043 | Ga0068862_1001350432 | 162 |
| 111 | 3300006931 | Ga0097620_100014519 | Ga0097620_1000145197 | 162 |
| 112 | 3300009094 | Ga0111539_10267250 | Ga0111539_102672504 | 162 |
| 113 | 3300009148 | Ga0105243_10281670 | Ga0105243_102816702 | 162 |
| 114 | 3300009553 | Ga0105249_10157827 | Ga0105249_101578273 | 162 |
| 115 | 3300013100 | Ga0157373_10340048 | Ga0157373_103400482 | 162 |
| 116 | 3300013102 | Ga0157371_10097703 | Ga0157371_100977032 | 162 |
| 117 | 3300013102 | Ga0157371_10416884 | Ga0157371_104168842 | 162 |
| 118 | 3300013105 | Ga0157369_10102893 | Ga0157369_101028933 | 162 |
| 119 | 3300013296 | Ga0157374_10538032 | Ga0157374_105380322 | 162 |
| 120 | 3300013306 | Ga0163162_10383996 | Ga0163162_103839962 | 162 |
| 121 | 3300013307 | Ga0157372_12518700 | Ga0157372_125187001 | 162 |
| 122 | 3300014325 | Ga0163163_10082591 | Ga0163163_100825914 | 162 |
| 123 | 3300014326 | Ga0157380_10001163 | Ga0157380_1000116320 | 162 |
| 124 | 3300017792 | Ga0163161_10009743 | Ga0163161_100097433 | 162 |
| 125 | 3300025315 | Ga0207697_10008882 | Ga0207697_100088822 | 162 |
| 126 | 3300025893 | Ga0207682_10003154 | Ga0207682_100031548 | 162 |
| 127 | 3300025901 | Ga0207688_10117503 | Ga0207688_101175032 | 162 |
| 128 | 3300025904 | Ga0207647_10000848 | Ga0207647_1000084828 | 162 |
| 129 | 3300025904 | Ga0207647_10351267 | Ga0207647_103512672 | 162 |
| 130 | 3300025909 | Ga0207705_10057951 | Ga0207705_100579512 | 162 |
| 131 | 3300025909 | Ga0207705_10140325 | Ga0207705_101403253 | 162 |
| 132 | 3300025912 | Ga0207707_10173424 | Ga0207707_101734243 | 162 |
| 133 | 3300025912 | Ga0207707_10246896 | Ga0207707_102468962 | 162 |
| 134 | 3300025917 | Ga0207660_10492475 | Ga0207660_104924751 | 162 |
| 135 | 3300025919 | Ga0207657_10013974 | Ga0207657_100139746 | 162 |
| 136 | 3300025919 | Ga0207657_10225535 | Ga0207657_102255353 | 162 |
| 137 | 3300025919 | Ga0207657_10240989 | Ga0207657_102409892 | 162 |
| 138 | 3300025921 | Ga0207652_10144292 | Ga0207652_101442922 | 162 |
| 139 | 3300025921 | Ga0207652_10473307 | Ga0207652_104733072 | 162 |
| 140 | 3300025923 | Ga0207681_10003633 | Ga0207681_100036339 | 162 |
| 141 | 3300025925 | Ga0207650_10002357 | Ga0207650_100023578 | 162 |
| 142 | 3300025925 | Ga0207650_10049939 | Ga0207650_100499393 | 162 |
| 143 | 3300025925 | Ga0207650_10230002 | Ga0207650_102300022 | 162 |
| 144 | 3300025926 | Ga0207659_10002277 | Ga0207659_100022779 | 162 |
| 145 | 3300025931 | Ga0207644_10141096 | Ga0207644_101410962 | 162 |
| 146 | 3300025932 | Ga0207690_10102309 | Ga0207690_101023093 | 162 |
| 147 | 3300025932 | Ga0207690_10174708 | Ga0207690_101747083 | 162 |
| 148 | 3300025933 | Ga0207706_10001776 | Ga0207706_1000177614 | 162 |
| 149 | 3300025933 | Ga0207706_10009419 | Ga0207706_100094196 | 162 |
| 150 | 3300025935 | Ga0207709_10097896 | Ga0207709_100978963 | 162 |
| 151 | 3300025940 | Ga0207691_10024273 | Ga0207691_100242732 | 162 |
| 152 | 3300025944 | Ga0207661_10311270 | Ga0207661_103112702 | 162 |
| 153 | 3300025945 | Ga0207679_10102831 | Ga0207679_101028314 | 162 |
| 154 | 3300025949 | Ga0207667_10467109 | Ga0207667_104671092 | 162 |
| 155 | 3300025960 | Ga0207651_10017718 | Ga0207651_100177182 | 162 |
| 156 | 3300025961 | Ga0207712_10041519 | Ga0207712_100415192 | 162 |
| 157 | 3300025972 | Ga0207668_10001399 | Ga0207668_100013998 | 162 |
| 158 | 3300025972 | Ga0207668_10326348 | Ga0207668_103263482 | 162 |
| 159 | 3300025981 | Ga0207640_10053669 | Ga0207640_100536692 | 162 |
| 160 | 3300026067 | Ga0207678_10008727 | Ga0207678_100087275 | 162 |
| 161 | 3300026067 | Ga0207678_10181976 | Ga0207678_101819763 | 162 |
| 162 | 3300026067 | Ga0207678_10801019 | Ga0207678_108010191 | 162 |
| 163 | 3300026075 | Ga0207708_10111841 | Ga0207708_101118412 | 162 |
| 164 | 3300026089 | Ga0207648_10072221 | Ga0207648_100722212 | 162 |
| 165 | 3300026089 | Ga0207648_10197422 | Ga0207648_101974223 | 162 |
| 166 | 3300026095 | Ga0207676_10467989 | Ga0207676_104679891 | 162 |
| 167 | 3300026116 | Ga0207674_10295080 | Ga0207674_102950802 | 162 |
| 168 | 3300026118 | Ga0207675_100003945 | Ga0207675_10000394512 | 162 |
| 169 | 3300026121 | Ga0207683_10008377 | Ga0207683_100083777 | 162 |
| 170 | 3300026142 | Ga0207698_10016480 | Ga0207698_100164803 | 162 |
| 171 | 3300026142 | Ga0207698_10398497 | Ga0207698_103984972 | 162 |
| 172 | 3300027907 | Ga0207428_10487573 | Ga0207428_104875731 | 162 |
| 173 | 3300028379 | Ga0268266_10415806 | Ga0268266_104158062 | 162 |
| 174 | 3300028379 | Ga0268266_10632788 | Ga0268266_106327881 | 162 |
| 175 | 3300028380 | Ga0268265_10008180 | Ga0268265_100081808 | 162 |
| 176 | 3300031731 | Ga0307405_10346769 | Ga0307405_103467692 | 162 |
| 177 | 3300031824 | Ga0307413_10058402 | Ga0307413_100584024 | 162 |
| 178 | 3300031911 | Ga0307412_11213228 | Ga0307412_112132281 | 162 |
| 179 | 3300031995 | Ga0307409_100737894 | Ga0307409_1007378942 | 162 |
| 180 | 3300032002 | Ga0307416_100126467 | Ga0307416_1001264672 | 162 |
| 181 | 3300032004 | Ga0307414_10022674 | Ga0307414_100226742 | 162 |
| 182 | 3300032004 | Ga0307414_10130704 | Ga0307414_101307043 | 162 |
| 183 | 3300032005 | Ga0307411_10033422 | Ga0307411_100334225 | 162 |
| 184 | 3300032126 | Ga0307415_100058462 | Ga0307415_1000584623 | 162 |
| 185 | 3300037312 | Ga0395899_0018782 | Ga0395899_0018782_3779_4267 | 162 |
| 186 | 3300037312 | Ga0395899_0250521 | Ga0395899_0250521_567_1055 | 162 |
| 187 | 3300037418 | Ga0395900_0525565 | Ga0395900_0525565_276_764 | 162 |
| 188 | 3300037418 | Ga0395900_0782442 | Ga0395900_0782442_63_551 | 162 |
| 189 | 3300037466 | Ga0395898_0728105 | Ga0395898_0728105_208_696 | 162 |
| 190 | 3300037471 | Ga0395905_0151993 | Ga0395905_0151993_599_1090 | 162 |
| 191 | 3300038443 | Ga0395901_0180614 | Ga0395901_0180614_971_1459 | 162 |
| 192 | 3300047445 | Ga0495677_0046050 | Ga0495677_0046050_412_903 | 162 |
| 193 | 3300048910 | Ga0496107_0108645 | Ga0496107_0108645_1509_1997 | 162 |
| 194 | 3300049570 | Ga0501033_0157192 | Ga0501033_0157192_480_977 | 162 |
| 195 | 3300050511 | nmdc:mga08y16_187000_c1 | nmdc:mga08y16_187000_c1_224_715 | 162 |
| 196 | 3300001915 | JGI24741J21665_1019720 | JGI24741J21665_10197202 | 163 |
| 197 | 3300001979 | JGI24740J21852_10040944 | JGI24740J21852_100409442 | 163 |
| 198 | 3300001989 | JGI24739J22299_10085242 | JGI24739J22299_100852422 | 163 |
| 199 | 3300001990 | JGI24737J22298_10073671 | JGI24737J22298_100736712 | 163 |
| 200 | 3300002067 | JGI24735J21928_10010773 | JGI24735J21928_100107732 | 163 |
| 201 | 3300005327 | Ga0070658_10138794 | Ga0070658_101387942 | 163 |
| 202 | 3300005336 | Ga0070680_100010145 | Ga0070680_1000101453 | 163 |
| 203 | 3300005336 | Ga0070680_100381810 | Ga0070680_1003818102 | 163 |
| 204 | 3300005337 | Ga0070682_100327637 | Ga0070682_1003276372 | 163 |
| 205 | 3300005338 | Ga0068868_100088300 | Ga0068868_1000883001 | 163 |
| 206 | 3300005339 | Ga0070660_100051863 | Ga0070660_1000518632 | 163 |
| 207 | 3300005339 | Ga0070660_101219995 | Ga0070660_1012199951 | 163 |
| 208 | 3300005341 | Ga0070691_10454621 | Ga0070691_104546211 | 163 |
| 209 | 3300005344 | Ga0070661_100056132 | Ga0070661_1000561323 | 163 |
| 210 | 3300005364 | Ga0070673_100038050 | Ga0070673_1000380505 | 163 |
| 211 | 3300005366 | Ga0070659_100059544 | Ga0070659_1000595442 | 163 |
| 212 | 3300005455 | Ga0070663_100095827 | Ga0070663_1000958273 | 163 |
| 213 | 3300005457 | Ga0070662_100152991 | Ga0070662_1001529913 | 163 |
| 214 | 3300005457 | Ga0070662_100477549 | Ga0070662_1004775491 | 163 |
| 215 | 3300005458 | Ga0070681_10069647 | Ga0070681_100696473 | 163 |
| 216 | 3300005530 | Ga0070679_100033561 | Ga0070679_1000335616 | 163 |
| 217 | 3300005535 | Ga0070684_100274879 | Ga0070684_1002748792 | 163 |
| 218 | 3300005535 | Ga0070684_101284704 | Ga0070684_1012847041 | 163 |
| 219 | 3300005539 | Ga0068853_100235623 | Ga0068853_1002356233 | 163 |
| 220 | 3300005539 | Ga0068853_100383723 | Ga0068853_1003837232 | 163 |
| 221 | 3300005563 | Ga0068855_101277420 | Ga0068855_1012774202 | 163 |
| 222 | 3300005564 | Ga0070664_100119688 | Ga0070664_1001196883 | 163 |
| 223 | 3300005564 | Ga0070664_100194348 | Ga0070664_1001943483 | 163 |
| 224 | 3300005564 | Ga0070664_100560586 | Ga0070664_1005605862 | 163 |
| 225 | 3300005577 | Ga0068857_100160563 | Ga0068857_1001605631 | 163 |
| 226 | 3300005578 | Ga0068854_100176768 | Ga0068854_1001767682 | 163 |
| 227 | 3300005578 | Ga0068854_100552740 | Ga0068854_1005527402 | 163 |
| 228 | 3300005614 | Ga0068856_100290455 | Ga0068856_1002904551 | 163 |
| 229 | 3300005616 | Ga0068852_100013294 | Ga0068852_1000132948 | 163 |
| 230 | 3300005834 | Ga0068851_10159714 | Ga0068851_101597142 | 163 |
| 231 | 3300006237 | Ga0097621_100495776 | Ga0097621_1004957762 | 163 |
| 232 | 3300009174 | Ga0105241_10424314 | Ga0105241_104243142 | 163 |
| 233 | 3300009551 | Ga0105238_10374635 | Ga0105238_103746353 | 163 |
| 234 | 3300013100 | Ga0157373_10081951 | Ga0157373_100819512 | 163 |
| 235 | 3300013100 | Ga0157373_10162755 | Ga0157373_101627552 | 163 |
| 236 | 3300013102 | Ga0157371_10065105 | Ga0157371_100651053 | 163 |
| 237 | 3300013102 | Ga0157371_10236991 | Ga0157371_102369912 | 163 |
| 238 | 3300013104 | Ga0157370_10261661 | Ga0157370_102616613 | 163 |
| 239 | 3300013104 | Ga0157370_10393871 | Ga0157370_103938712 | 163 |
| 240 | 3300013105 | Ga0157369_10005483 | Ga0157369_100054834 | 163 |
| 241 | 3300013105 | Ga0157369_10068610 | Ga0157369_100686103 | 163 |
| 242 | 3300013105 | Ga0157369_10217589 | Ga0157369_102175892 | 163 |
| 243 | 3300013297 | Ga0157378_10837975 | Ga0157378_108379752 | 163 |
| 244 | 3300013307 | Ga0157372_10182330 | Ga0157372_101823302 | 163 |
| 245 | 3300013307 | Ga0157372_10202554 | Ga0157372_102025544 | 163 |
| 246 | 3300025904 | Ga0207647_10019937 | Ga0207647_100199374 | 163 |
| 247 | 3300025909 | Ga0207705_10092403 | Ga0207705_100924033 | 163 |
| 248 | 3300025909 | Ga0207705_10185314 | Ga0207705_101853142 | 163 |
| 249 | 3300025909 | Ga0207705_11095867 | Ga0207705_110958671 | 163 |
| 250 | 3300025911 | Ga0207654_10155086 | Ga0207654_101550862 | 163 |
| 251 | 3300025912 | Ga0207707_10401112 | Ga0207707_104011122 | 163 |
| 252 | 3300025917 | Ga0207660_10617513 | Ga0207660_106175132 | 163 |
| 253 | 3300025919 | Ga0207657_10008341 | Ga0207657_100083412 | 163 |
| 254 | 3300025919 | Ga0207657_10073222 | Ga0207657_100732223 | 163 |
| 255 | 3300025919 | Ga0207657_10085802 | Ga0207657_100858023 | 163 |
| 256 | 3300025919 | Ga0207657_11206075 | Ga0207657_112060751 | 163 |
| 257 | 3300025920 | Ga0207649_10388117 | Ga0207649_103881172 | 163 |
| 258 | 3300025921 | Ga0207652_10578512 | Ga0207652_105785122 | 163 |
| 259 | 3300025924 | Ga0207694_10365311 | Ga0207694_103653112 | 163 |
| 260 | 3300025932 | Ga0207690_10067960 | Ga0207690_100679603 | 163 |
| 261 | 3300025932 | Ga0207690_10479921 | Ga0207690_104799212 | 163 |
| 262 | 3300025933 | Ga0207706_10111158 | Ga0207706_101111582 | 163 |
| 263 | 3300025949 | Ga0207667_10713898 | Ga0207667_107138982 | 163 |
| 264 | 3300026041 | Ga0207639_10445859 | Ga0207639_104458592 | 163 |
| 265 | 3300026067 | Ga0207678_10076194 | Ga0207678_100761945 | 163 |
| 266 | 3300026078 | Ga0207702_11833888 | Ga0207702_118338882 | 163 |
| 267 | 3300026116 | Ga0207674_10063538 | Ga0207674_100635384 | 163 |
| 268 | 3300026142 | Ga0207698_10083226 | Ga0207698_100832263 | 163 |
| 269 | 3300027876 | Ga0209974_10030433 | Ga0209974_100304332 | 163 |
| 270 | 3300031548 | Ga0307408_100018443 | Ga0307408_1000184432 | 163 |
| 271 | 3300031824 | Ga0307413_10158299 | Ga0307413_101582992 | 163 |
| 272 | 3300031852 | Ga0307410_10014471 | Ga0307410_100144714 | 163 |
| 273 | 3300031903 | Ga0307407_10011510 | Ga0307407_100115105 | 163 |
| 274 | 3300031911 | Ga0307412_10612831 | Ga0307412_106128312 | 163 |
| 275 | 3300032002 | Ga0307416_100006877 | Ga0307416_1000068776 | 163 |
| 276 | 3300032002 | Ga0307416_102348288 | Ga0307416_1023482882 | 163 |
| 277 | 3300032004 | Ga0307414_10361270 | Ga0307414_103612702 | 163 |
| 278 | 3300032126 | Ga0307415_100031294 | Ga0307415_1000312942 | 163 |
| 279 | 3300035692 | Ga0373935_0011883 | Ga0373935_0011883_2720_3211 | 163 |
| 280 | 3300035695 | Ga0373927_0618172 | Ga0373927_0618172_102_593 | 163 |
| 281 | 3300037312 | Ga0395899_0158379 | Ga0395899_0158379_452_949 | 163 |
| 282 | 3300037312 | Ga0395899_0401583 | Ga0395899_0401583_74_565 | 163 |
| 283 | 3300037418 | Ga0395900_0000764 | Ga0395900_0000764_33010_33507 | 163 |
| 284 | 3300037418 | Ga0395900_0020505 | Ga0395900_0020505_1020_1511 | 163 |
| 285 | 3300037418 | Ga0395900_0237976 | Ga0395900_0237976_212_703 | 163 |
| 286 | 3300037466 | Ga0395898_0081863 | Ga0395898_0081863_1699_2196 | 163 |
| 287 | 3300037471 | Ga0395905_0003045 | Ga0395905_0003045_9759_10256 | 163 |
| 288 | 3300037471 | Ga0395905_0021583 | Ga0395905_0021583_15_506 | 163 |
| 289 | 3300037471 | Ga0395905_0026966 | Ga0395905_0026966_4604_5095 | 163 |
| 290 | 3300037471 | Ga0395905_0119628 | Ga0395905_0119628_43_534 | 163 |
| 291 | 3300037471 | Ga0395905_0201402 | Ga0395905_0201402_1256_1747 | 163 |
| 292 | 3300037471 | Ga0395905_0228802 | Ga0395905_0228802_111_605 | 163 |
| 293 | 3300037471 | Ga0395905_0422179 | Ga0395905_0422179_445_936 | 163 |
| 294 | 3300038443 | Ga0395901_0009829 | Ga0395901_0009829_1617_2114 | 163 |
| 295 | 3300038443 | Ga0395901_0167230 | Ga0395901_0167230_1731_2222 | 163 |
| 296 | 3300038443 | Ga0395901_0557676 | Ga0395901_0557676_146_637 | 163 |
| 297 | 3300042005 | Ga0439448_0002960 | Ga0439448_0002960_2299_2790 | 163 |
| 298 | 3300044694 | Ga0466963_0277001 | Ga0466963_0277001_362_853 | 163 |
| 299 | 3300048913 | Ga0496110_0489587 | Ga0496110_0489587_163_654 | 163 |
| 300 | 3300048917 | Ga0496114_0000206 | Ga0496114_0000206_36252_36743 | 163 |
| 301 | 3300049663 | Ga0501223_004150 | Ga0501223_004150_190_684 | 163 |
| 302 | 3300049668 | Ga0501233_024940 | Ga0501233_024940_146_640 | 163 |
| 303 | 3300049677 | Ga0501247_006394 | Ga0501247_006394_180_674 | 163 |
| 304 | 3300049705 | Ga0501225_0022235 | Ga0501225_0022235_765_1259 | 163 |
| 305 | 3300049764 | Ga0501267_008201 | Ga0501267_008201_144_638 | 163 |
| 306 | 3300049765 | Ga0501268_008723 | Ga0501268_008723_729_1223 | 163 |
| 307 | 3300049775 | Ga0501279_012735 | Ga0501279_012735_641_1132 | 163 |
| 308 | 3300049779 | Ga0501283_035633 | Ga0501283_035633_224_715 | 163 |
| 309 | iso_pu_bacteria | 2928027323 | 2928028486 | 163 |
| 310 | iso_pu_bacteria | 2984555340 | 2984555938 | 163 |
| 311 | iso_pu_bacteria | 2984564862 | 2984565956 | 163 |
| 312 | iso_pu_bacteria | 2993356040 | 2993356965 | 163 |
| 313 | 3300005330 | Ga0070690_100026517 | Ga0070690_1000265174 | 164 |
| 314 | 3300009148 | Ga0105243_10181415 | Ga0105243_101814153 | 164 |
| 315 | 3300037418 | Ga0395900_0019021 | Ga0395900_0019021_18_575 | 164 |
| 316 | 3300037471 | Ga0395905_1430114 | Ga0395905_1430114_21_527 | 164 |
| 317 | 3300037853 | Ga0436364_0783469 | Ga0436364_0783469_13_525 | 164 |
| 318 | 3300037853 | Ga0436364_1376076 | Ga0436364_1376076_90_668 | 164 |
| 319 | 3300039453 | Ga0436362_0386479 | Ga0436362_0386479_67_579 | 164 |
| 320 | iso_pu_bacteria | 2599185354 | 2600202973 | 164 |
| 321 | iso_pu_bacteria | 2990265787 | 2990265889 | 164 |
| 322 | 3300005331 | Ga0070670_100273307 | Ga0070670_1002733073 | 165 |
| 323 | 3300005337 | Ga0070682_100675763 | Ga0070682_1006757631 | 165 |
| 324 | 3300005339 | Ga0070660_100757531 | Ga0070660_1007575311 | 165 |
| 325 | 3300009174 | Ga0105241_10008572 | Ga0105241_100085726 | 165 |
| 326 | 3300031852 | Ga0307410_10002493 | Ga0307410_100024935 | 165 |
| 327 | 3300031901 | Ga0307406_10281262 | Ga0307406_102812622 | 165 |
| 328 | 3300031903 | Ga0307407_10084793 | Ga0307407_100847932 | 165 |
| 329 | 3300031995 | Ga0307409_100001956 | Ga0307409_1000019566 | 165 |
| 330 | 3300032002 | Ga0307416_100067191 | Ga0307416_1000671914 | 165 |
| 331 | 3300032004 | Ga0307414_10005096 | Ga0307414_100050965 | 165 |
| 332 | 3300032005 | Ga0307411_10003049 | Ga0307411_100030497 | 165 |
| 333 | 3300049587 | Ga0501071_0239731 | Ga0501071_0239731_805_1302 | 165 |
| 334 | iso_pu_bacteria | 2687453257 | 2688066608 | 165 |
| 335 | iso_pu_bacteria | 2889415604 | 2889416005 | 165 |
| 336 | 3300005327 | Ga0070658_10779209 | Ga0070658_107792092 | 166 |
| 337 | 3300005344 | Ga0070661_100000014 | Ga0070661_10000001491 | 166 |
| 338 | 3300005353 | Ga0070669_100390569 | Ga0070669_1003905691 | 166 |
| 339 | 3300005355 | Ga0070671_100462840 | Ga0070671_1004628401 | 166 |
| 340 | 3300005458 | Ga0070681_10125533 | Ga0070681_101255333 | 166 |
| 341 | 3300005467 | Ga0070706_100618422 | Ga0070706_1006184222 | 166 |
| 342 | 3300005530 | Ga0070679_100000003 | Ga0070679_100000003264 | 166 |
| 343 | 3300005530 | Ga0070679_101170360 | Ga0070679_1011703601 | 166 |
| 344 | 3300005530 | Ga0070679_101188883 | Ga0070679_1011888832 | 166 |
| 345 | 3300005544 | Ga0070686_101055559 | Ga0070686_1010555591 | 166 |
| 346 | 3300005577 | Ga0068857_100067854 | Ga0068857_1000678542 | 166 |
| 347 | 3300005577 | Ga0068857_100102670 | Ga0068857_1001026702 | 166 |
| 348 | 3300005578 | Ga0068854_100182268 | Ga0068854_1001822682 | 166 |
| 349 | 3300005618 | Ga0068864_100012174 | Ga0068864_1000121747 | 166 |
| 350 | 3300005841 | Ga0068863_100009700 | Ga0068863_1000097008 | 166 |
| 351 | 3300005843 | Ga0068860_100579424 | Ga0068860_1005794242 | 166 |
| 352 | 3300006195 | Ga0075366_10017242 | Ga0075366_100172422 | 166 |
| 353 | 3300006353 | Ga0075370_10100655 | Ga0075370_101006552 | 166 |
| 354 | 3300009101 | Ga0105247_10618861 | Ga0105247_106188612 | 166 |
| 355 | 3300009553 | Ga0105249_11754747 | Ga0105249_117547471 | 166 |
| 356 | 3300013105 | Ga0157369_10008669 | Ga0157369_100086696 | 166 |
| 357 | 3300014968 | Ga0157379_10308399 | Ga0157379_103083992 | 166 |
| 358 | 3300021358 | Ga0213873_10000007 | Ga0213873_10000007257 | 166 |
| 359 | 3300021358 | Ga0213873_10027588 | Ga0213873_100275882 | 166 |
| 360 | 3300021361 | Ga0213872_10126432 | Ga0213872_101264322 | 166 |
| 361 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005293 | 166 |
| 362 | 3300021441 | Ga0213871_10003839 | Ga0213871_100038393 | 166 |
| 363 | 3300025223 | Ga0207672_1005086 | Ga0207672_10050861 | 166 |
| 364 | 3300025909 | Ga0207705_10103351 | Ga0207705_101033513 | 166 |
| 365 | 3300025909 | Ga0207705_10131355 | Ga0207705_101313552 | 166 |
| 366 | 3300025909 | Ga0207705_10246306 | Ga0207705_102463062 | 166 |
| 367 | 3300025910 | Ga0207684_10215440 | Ga0207684_102154402 | 166 |
| 368 | 3300025912 | Ga0207707_10106419 | Ga0207707_101064192 | 166 |
| 369 | 3300025917 | Ga0207660_10002430 | Ga0207660_100024306 | 166 |
| 370 | 3300025920 | Ga0207649_10000393 | Ga0207649_1000039310 | 166 |
| 371 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004265 | 166 |
| 372 | 3300025923 | Ga0207681_10067961 | Ga0207681_100679614 | 166 |
| 373 | 3300026041 | Ga0207639_10908420 | Ga0207639_109084202 | 166 |
| 374 | 3300026088 | Ga0207641_10000277 | Ga0207641_1000027721 | 166 |
| 375 | 3300026095 | Ga0207676_10000600 | Ga0207676_1000060018 | 166 |
| 376 | 3300026116 | Ga0207674_10048226 | Ga0207674_100482263 | 166 |
| 377 | 3300026118 | Ga0207675_100423211 | Ga0207675_1004232112 | 166 |
| 378 | 3300028381 | Ga0268264_10516537 | Ga0268264_105165372 | 166 |
| 379 | 3300031731 | Ga0307405_10942180 | Ga0307405_109421802 | 166 |
| 380 | 3300031901 | Ga0307406_10412255 | Ga0307406_104122552 | 166 |
| 381 | 3300031901 | Ga0307406_10663458 | Ga0307406_106634581 | 166 |
| 382 | 3300032004 | Ga0307414_10268528 | Ga0307414_102685282 | 166 |
| 383 | 3300032004 | Ga0307414_10369404 | Ga0307414_103694042 | 166 |
| 384 | 3300037471 | Ga0395905_0061435 | Ga0395905_0061435_261_761 | 166 |
| 385 | 3300037853 | Ga0436364_1549875 | Ga0436364_1549875_747_1268 | 166 |
| 386 | 3300038443 | Ga0395901_0008085 | Ga0395901_0008085_5696_6196 | 166 |
| 387 | 3300038443 | Ga0395901_0573348 | Ga0395901_0573348_47_547 | 166 |
| 388 | 3300039437 | Ga0436365_0176211 | Ga0436365_0176211_7274_7774 | 166 |
| 389 | 3300039438 | Ga0436360_1357732 | Ga0436360_1357732_1933_2460 | 166 |
| 390 | 3300039447 | Ga0436361_1102360 | Ga0436361_1102360_1677_2204 | 166 |
| 391 | 3300039453 | Ga0436362_0945445 | Ga0436362_0945445_1854_2381 | 166 |
| 392 | 3300039453 | Ga0436362_0976836 | Ga0436362_0976836_85160_85660 | 166 |
| 393 | 3300046513 | Ga0495616_0000182 | Ga0495616_0000182_49430_49930 | 166 |
| 394 | 3300049513 | Ga0501290_006651 | Ga0501290_006651_419_919 | 166 |
| 395 | 3300049570 | Ga0501033_0392407 | Ga0501033_0392407_213_800 | 166 |
| 396 | 3300049571 | Ga0501034_0344439 | Ga0501034_0344439_693_1280 | 166 |
| 397 | 3300049573 | Ga0501037_0484270 | Ga0501037_0484270_95_682 | 166 |
| 398 | 3300049581 | Ga0501047_0235519 | Ga0501047_0235519_186_773 | 166 |
| 399 | 3300049586 | Ga0501070_0152544 | Ga0501070_0152544_11_598 | 166 |
| 400 | 3300049663 | Ga0501223_016865 | Ga0501223_016865_112_612 | 166 |
| 401 | 3300049665 | Ga0501227_015092 | Ga0501227_015092_143_643 | 166 |
| 402 | 3300049686 | Ga0501257_000073 | Ga0501257_000073_3986_4486 | 166 |
| 403 | 3300049774 | Ga0501278_016981 | Ga0501278_016981_65_565 | 166 |
| 404 | 3300049776 | Ga0501280_005610 | Ga0501280_005610_749_1249 | 166 |
| 405 | 3300049823 | Ga0501044_0225587 | Ga0501044_0225587_1054_1641 | 166 |
| 406 | 3300049823 | Ga0501044_0267643 | Ga0501044_0267643_1099_1620 | 166 |
| 407 | 3300049823 | Ga0501044_0484226 | Ga0501044_0484226_212_757 | 166 |
| 408 | 3300049823 | Ga0501044_1284043 | Ga0501044_1284043_86_586 | 166 |
| 409 | 3300050493 | nmdc:mga0k408_202812_c1 | nmdc:mga0k408_202812_c1_89_589 | 166 |
| 410 | 3300050496 | nmdc:mga07m45_152791_c1 | nmdc:mga07m45_152791_c1_336_836 | 166 |
| 411 | 3300053087 | Ga0500643_000136 | Ga0500643_000136_44426_44926 | 166 |
| 412 | iso_pu_bacteria | 2775507255 | 2778126027 | 166 |
| 413 | iso_pu_bacteria | 2808606401 | 2809062871 | 166 |
| 414 | iso_pu_bacteria | 2808606404 | 2809078835 | 166 |
| 415 | iso_pu_bacteria | 2808606405 | 2809085895 | 166 |
| 416 | iso_pu_bacteria | 2880518877 | 2880520150 | 166 |
| 417 | iso_pu_bacteria | 2919709256 | 2919710480 | 166 |
| 418 | 3300005366 | Ga0070659_100544125 | Ga0070659_1005441252 | 167 |
| 419 | 3300013306 | Ga0163162_10363831 | Ga0163162_103638312 | 167 |
| 420 | 3300014325 | Ga0163163_10151215 | Ga0163163_101512154 | 167 |
| 421 | 3300031903 | Ga0307407_10321260 | Ga0307407_103212602 | 167 |
| 422 | 3300031911 | Ga0307412_10057889 | Ga0307412_100578893 | 167 |
| 423 | 3300039450 | Ga0436363_0689652 | Ga0436363_0689652_80_583 | 167 |
| 424 | 3300039450 | Ga0436363_1450113 | Ga0436363_1450113_36_539 | 167 |
| 425 | 3300001976 | JGI24752J21851_1001534 | JGI24752J21851_10015342 | 168 |
| 426 | 3300003214 | JGI25165J46597_1000024 | JGI25165J46597_100002432 | 168 |
| 427 | 3300004625 | Ga0055543_1035427 | Ga0055543_10354272 | 168 |
| 428 | 3300005331 | Ga0070670_100000964 | Ga0070670_1000009647 | 168 |
| 429 | 3300005334 | Ga0068869_100501048 | Ga0068869_1005010481 | 168 |
| 430 | 3300005335 | Ga0070666_10000089 | Ga0070666_1000008942 | 168 |
| 431 | 3300005335 | Ga0070666_10111826 | Ga0070666_101118262 | 168 |
| 432 | 3300005347 | Ga0070668_100000014 | Ga0070668_10000001441 | 168 |
| 433 | 3300005347 | Ga0070668_100137456 | Ga0070668_1001374562 | 168 |
| 434 | 3300005353 | Ga0070669_100000024 | Ga0070669_100000024138 | 168 |
| 435 | 3300005353 | Ga0070669_100018244 | Ga0070669_1000182445 | 168 |
| 436 | 3300005355 | Ga0070671_100000006 | Ga0070671_100000006114 | 168 |
| 437 | 3300005367 | Ga0070667_100000051 | Ga0070667_10000005191 | 168 |
| 438 | 3300005367 | Ga0070667_100056171 | Ga0070667_1000561715 | 168 |
| 439 | 3300005445 | Ga0070708_100039593 | Ga0070708_1000395933 | 168 |
| 440 | 3300005548 | Ga0070665_100000471 | Ga0070665_10000047121 | 168 |
| 441 | 3300005548 | Ga0070665_100095368 | Ga0070665_1000953684 | 168 |
| 442 | 3300005577 | Ga0068857_100693885 | Ga0068857_1006938852 | 168 |
| 443 | 3300005578 | Ga0068854_100228496 | Ga0068854_1002284962 | 168 |
| 444 | 3300005617 | Ga0068859_100000256 | Ga0068859_10000025628 | 168 |
| 445 | 3300005618 | Ga0068864_100001091 | Ga0068864_1000010912 | 168 |
| 446 | 3300005618 | Ga0068864_100001437 | Ga0068864_1000014377 | 168 |
| 447 | 3300005719 | Ga0068861_100000799 | Ga0068861_10000079913 | 168 |
| 448 | 3300005841 | Ga0068863_100000028 | Ga0068863_100000028121 | 168 |
| 449 | 3300005841 | Ga0068863_100005179 | Ga0068863_1000051795 | 168 |
| 450 | 3300005842 | Ga0068858_100000181 | Ga0068858_10000018146 | 168 |
| 451 | 3300005842 | Ga0068858_100004139 | Ga0068858_1000041397 | 168 |
| 452 | 3300005842 | Ga0068858_100047175 | Ga0068858_1000471753 | 168 |
| 453 | 3300005843 | Ga0068860_100005743 | Ga0068860_1000057437 | 168 |
| 454 | 3300005843 | Ga0068860_100041662 | Ga0068860_1000416625 | 168 |
| 455 | 3300005844 | Ga0068862_100000310 | Ga0068862_10000031023 | 168 |
| 456 | 3300005844 | Ga0068862_100190712 | Ga0068862_1001907121 | 168 |
| 457 | 3300006931 | Ga0097620_100000256 | Ga0097620_10000025628 | 168 |
| 458 | 3300009011 | Ga0105251_10023016 | Ga0105251_100230165 | 168 |
| 459 | 3300009098 | Ga0105245_10000853 | Ga0105245_1000085323 | 168 |
| 460 | 3300009101 | Ga0105247_10000644 | Ga0105247_1000064428 | 168 |
| 461 | 3300009148 | Ga0105243_10063765 | Ga0105243_100637653 | 168 |
| 462 | 3300009177 | Ga0105248_10020230 | Ga0105248_100202307 | 168 |
| 463 | 3300009553 | Ga0105249_10004911 | Ga0105249_1000491114 | 168 |
| 464 | 3300013296 | Ga0157374_10113648 | Ga0157374_101136484 | 168 |
| 465 | 3300013297 | Ga0157378_10040072 | Ga0157378_100400725 | 168 |
| 466 | 3300013297 | Ga0157378_10081723 | Ga0157378_100817232 | 168 |
| 467 | 3300013306 | Ga0163162_10035439 | Ga0163162_100354395 | 168 |
| 468 | 3300013306 | Ga0163162_10041138 | Ga0163162_100411383 | 168 |
| 469 | 3300014325 | Ga0163163_10080992 | Ga0163163_100809924 | 168 |
| 470 | 3300014968 | Ga0157379_10081986 | Ga0157379_100819864 | 168 |
| 471 | 3300015690 | Ga0183363_1007 | Ga0183363_100768 | 168 |
| 472 | 3300025233 | Ga0209437_101961 | Ga0209437_1019613 | 168 |
| 473 | 3300025254 | Ga0209148_1026487 | Ga0209148_10264872 | 168 |
| 474 | 3300025261 | Ga0209233_1000084 | Ga0209233_1000084278 | 168 |
| 475 | 3300025315 | Ga0207697_10000419 | Ga0207697_100004197 | 168 |
| 476 | 3300025315 | Ga0207697_10066668 | Ga0207697_100666682 | 168 |
| 477 | 3300025900 | Ga0207710_10000700 | Ga0207710_1000070013 | 168 |
| 478 | 3300025903 | Ga0207680_10000481 | Ga0207680_1000048113 | 168 |
| 479 | 3300025903 | Ga0207680_10052317 | Ga0207680_100523173 | 168 |
| 480 | 3300025923 | Ga0207681_10000004 | Ga0207681_10000004312 | 168 |
| 481 | 3300025923 | Ga0207681_10127025 | Ga0207681_101270252 | 168 |
| 482 | 3300025925 | Ga0207650_10003090 | Ga0207650_100030906 | 168 |
| 483 | 3300025927 | Ga0207687_10003237 | Ga0207687_100032376 | 168 |
| 484 | 3300025931 | Ga0207644_10000009 | Ga0207644_10000009136 | 168 |
| 485 | 3300025935 | Ga0207709_10045384 | Ga0207709_100453844 | 168 |
| 486 | 3300025941 | Ga0207711_10011481 | Ga0207711_100114815 | 168 |
| 487 | 3300025961 | Ga0207712_10019312 | Ga0207712_100193122 | 168 |
| 488 | 3300025972 | Ga0207668_10000047 | Ga0207668_1000004778 | 168 |
| 489 | 3300025972 | Ga0207668_10154373 | Ga0207668_101543732 | 168 |
| 490 | 3300025986 | Ga0207658_10000057 | Ga0207658_1000005792 | 168 |
| 491 | 3300025986 | Ga0207658_10002888 | Ga0207658_100028886 | 168 |
| 492 | 3300026035 | Ga0207703_10000135 | Ga0207703_1000013518 | 168 |
| 493 | 3300026035 | Ga0207703_10006420 | Ga0207703_1000642013 | 168 |
| 494 | 3300026078 | Ga0207702_10658268 | Ga0207702_106582682 | 168 |
| 495 | 3300026088 | Ga0207641_10000014 | Ga0207641_10000014267 | 168 |
| 496 | 3300026088 | Ga0207641_10016289 | Ga0207641_100162896 | 168 |
| 497 | 3300026095 | Ga0207676_10000532 | Ga0207676_1000053220 | 168 |
| 498 | 3300026095 | Ga0207676_10001074 | Ga0207676_100010742 | 168 |
| 499 | 3300026118 | Ga0207675_100000740 | Ga0207675_10000074011 | 168 |
| 500 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021001 | 168 |
| 501 | 3300028379 | Ga0268266_10193219 | Ga0268266_101932192 | 168 |
| 502 | 3300028380 | Ga0268265_10001269 | Ga0268265_1000126912 | 168 |
| 503 | 3300028380 | Ga0268265_10160681 | Ga0268265_101606812 | 168 |
| 504 | 3300028381 | Ga0268264_10000069 | Ga0268264_10000069110 | 168 |
| 505 | 3300028381 | Ga0268264_10004744 | Ga0268264_100047445 | 168 |
| 506 | 3300031456 | Ga0307513_10030103 | Ga0307513_100301036 | 168 |
| 507 | 3300031616 | Ga0307508_10001350 | Ga0307508_1000135023 | 168 |
| 508 | 3300032004 | Ga0307414_11249543 | Ga0307414_112495432 | 168 |
| 509 | 3300036401 | Ga0373937_0300059 | Ga0373937_0300059_793_1299 | 168 |
| 510 | 3300039437 | Ga0436365_0862951 | Ga0436365_0862951_398_904 | 168 |
| 511 | 3300046492 | Ga0495585_0280224 | Ga0495585_0280224_243_749 | 168 |
| 512 | 3300046524 | Ga0495648_0004271 | Ga0495648_0004271_2476_2982 | 168 |
| 513 | 3300046660 | Ga0495625_0000107 | Ga0495625_0000107_4658_5164 | 168 |
| 514 | 3300047472 | Ga0495686_0000513 | Ga0495686_0000513_28085_28591 | 168 |
| 515 | 3300047472 | Ga0495686_0032568 | Ga0495686_0032568_2359_2865 | 168 |
| 516 | 3300048905 | Ga0496102_0702575 | Ga0496102_0702575_105_611 | 168 |
| 517 | 3300048906 | Ga0496103_0504660 | Ga0496103_0504660_78_590 | 168 |
| 518 | 3300048908 | Ga0496105_0325649 | Ga0496105_0325649_238_744 | 168 |
| 519 | 3300048924 | Ga0496121_0000189 | Ga0496121_0000189_11785_12291 | 168 |
| 520 | 3300048924 | Ga0496121_0035146 | Ga0496121_0035146_2934_3440 | 168 |
| 521 | 3300048927 | Ga0496124_0196213 | Ga0496124_0196213_776_1282 | 168 |
| 522 | 3300049580 | Ga0501046_0106566 | Ga0501046_0106566_93_599 | 168 |
| 523 | 3300049823 | Ga0501044_0653431 | Ga0501044_0653431_11_517 | 168 |
| 524 | 3300053087 | Ga0500643_001250 | Ga0500643_001250_11497_12003 | 168 |
| 525 | 3300053087 | Ga0500643_037629 | Ga0500643_037629_22_534 | 168 |
| 526 | 3300053119 | Ga0500595_001051 | Ga0500595_001051_12443_12949 | 168 |
| 527 | 3300053140 | Ga0500573_0000021 | Ga0500573_0000021_146435_146941 | 168 |
| 528 | 3300053153 | Ga0500616_0199798 | Ga0500616_0199798_14_520 | 168 |
| 529 | 3300053157 | Ga0500624_000930 | Ga0500624_000930_4158_4670 | 168 |
| 530 | 3300053177 | Ga0500636_0102937 | Ga0500636_0102937_905_1417 | 168 |
| 531 | 3300053730 | Ga0500645_003386 | Ga0500645_003386_5384_5890 | 168 |
| 532 | iso_pu_bacteria | 2512564014 | 2512643921 | 168 |
| 533 | 2162886007 | SwRhRL2b_contig_3731301 | SwRhRL2b_0633.00000600 | 169 |
| 534 | 3300002774 | JGI25150J39212_1000711 | JGI25150J39212_10007115 | 169 |
| 535 | 3300003187 | JGI25151J46595_10023430 | JGI25151J46595_100234302 | 169 |
| 536 | 3300003215 | JGI25153J46596_10000186 | JGI25153J46596_1000018629 | 169 |
| 537 | 3300003771 | Ga0055526_1000503 | Ga0055526_10005031 | 169 |
| 538 | 3300003781 | Ga0055536_1026934 | Ga0055536_10269342 | 169 |
| 539 | 3300003792 | Ga0055540_1003332 | Ga0055540_100333210 | 169 |
| 540 | 3300003792 | Ga0055540_1006395 | Ga0055540_10063955 | 169 |
| 541 | 3300005289 | Ga0065704_10001990 | Ga0065704_1000199010 | 169 |
| 542 | 3300005289 | Ga0065704_10190368 | Ga0065704_101903682 | 169 |
| 543 | 3300005353 | Ga0070669_100068114 | Ga0070669_1000681143 | 169 |
| 544 | 3300005539 | Ga0068853_100005871 | Ga0068853_1000058717 | 169 |
| 545 | 3300005539 | Ga0068853_100024335 | Ga0068853_1000243355 | 169 |
| 546 | 3300005577 | Ga0068857_100005612 | Ga0068857_1000056128 | 169 |
| 547 | 3300005616 | Ga0068852_100364779 | Ga0068852_1003647792 | 169 |
| 548 | 3300005834 | Ga0068851_10019383 | Ga0068851_100193834 | 169 |
| 549 | 3300009011 | Ga0105251_10107027 | Ga0105251_101070272 | 169 |
| 550 | 3300009092 | Ga0105250_10285979 | Ga0105250_102859791 | 169 |
| 551 | 3300009978 | Ga0105148_100460 | Ga0105148_1004603 | 169 |
| 552 | 3300013100 | Ga0157373_10164707 | Ga0157373_101647071 | 169 |
| 553 | 3300013102 | Ga0157371_10102209 | Ga0157371_101022093 | 169 |
| 554 | 3300014497 | Ga0182008_10288782 | Ga0182008_102887822 | 169 |
| 555 | 3300017792 | Ga0163161_10034019 | Ga0163161_100340194 | 169 |
| 556 | 3300025245 | Ga0207425_1000049 | Ga0207425_100004960 | 169 |
| 557 | 3300025258 | Ga0209129_1004041 | Ga0209129_10040413 | 169 |
| 558 | 3300025263 | Ga0209565_1000170 | Ga0209565_100017072 | 169 |
| 559 | 3300025273 | Ga0209673_1006861 | Ga0209673_10068614 | 169 |
| 560 | 3300025292 | Ga0209676_1004023 | Ga0209676_10040238 | 169 |
| 561 | 3300025294 | Ga0209025_1000068 | Ga0209025_100006832 | 169 |
| 562 | 3300025295 | Ga0209564_1000733 | Ga0209564_100073340 | 169 |
| 563 | 3300025297 | Ga0209758_1000019 | Ga0209758_1000019646 | 169 |
| 564 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000011861 | 169 |
| 565 | 3300025298 | Ga0209050_1000108 | Ga0209050_1000108149 | 169 |
| 566 | 3300025298 | Ga0209050_1034129 | Ga0209050_10341292 | 169 |
| 567 | 3300025303 | Ga0209051_1000239 | Ga0209051_100023961 | 169 |
| 568 | 3300025304 | Ga0209257_1001303 | Ga0209257_100130310 | 169 |
| 569 | 3300025304 | Ga0209257_1001609 | Ga0209257_100160910 | 169 |
| 570 | 3300025321 | Ga0207656_10014744 | Ga0207656_100147444 | 169 |
| 571 | 3300025735 | Ga0207713_1078990 | Ga0207713_10789902 | 169 |
| 572 | 3300025923 | Ga0207681_10057830 | Ga0207681_100578303 | 169 |
| 573 | 3300025924 | Ga0207694_10141633 | Ga0207694_101416331 | 169 |
| 574 | 3300025949 | Ga0207667_10181620 | Ga0207667_101816201 | 169 |
| 575 | 3300026041 | Ga0207639_10017444 | Ga0207639_100174442 | 169 |
| 576 | 3300026041 | Ga0207639_10057207 | Ga0207639_100572072 | 169 |
| 577 | 3300026116 | Ga0207674_10022118 | Ga0207674_100221185 | 169 |
| 578 | 3300026142 | Ga0207698_10176048 | Ga0207698_101760483 | 169 |
| 579 | 3300031548 | Ga0307408_100008912 | Ga0307408_1000089127 | 169 |
| 580 | 3300046453 | Ga0495627_088423 | Ga0495627_088423_120_629 | 169 |
| 581 | 3300046460 | Ga0495638_0055240 | Ga0495638_0055240_43_567 | 169 |
| 582 | 3300046460 | Ga0495638_0247843 | Ga0495638_0247843_96_605 | 169 |
| 583 | 3300046491 | Ga0495584_0322376 | Ga0495584_0322376_256_765 | 169 |
| 584 | 3300046492 | Ga0495585_0182581 | Ga0495585_0182581_455_976 | 169 |
| 585 | 3300046519 | Ga0495632_0001056 | Ga0495632_0001056_20290_20799 | 169 |
| 586 | 3300046520 | Ga0495637_0018088 | Ga0495637_0018088_862_1371 | 169 |
| 587 | 3300046522 | Ga0495643_0000146 | Ga0495643_0000146_63518_64027 | 169 |
| 588 | 3300046524 | Ga0495648_0113632 | Ga0495648_0113632_80_589 | 169 |
| 589 | 3300046525 | Ga0495663_0000006 | Ga0495663_0000006_170647_171156 | 169 |
| 590 | 3300046558 | Ga0495633_0000192 | Ga0495633_0000192_329_838 | 169 |
| 591 | 3300046558 | Ga0495633_0001161 | Ga0495633_0001161_532_1041 | 169 |
| 592 | 3300046558 | Ga0495633_0020434 | Ga0495633_0020434_27_536 | 169 |
| 593 | 3300046616 | Ga0495668_0016769 | Ga0495668_0016769_3143_3652 | 169 |
| 594 | 3300046692 | Ga0495671_0000100 | Ga0495671_0000100_58136_58645 | 169 |
| 595 | 3300047470 | Ga0495681_0034366 | Ga0495681_0034366_701_1210 | 169 |
| 596 | 3300047472 | Ga0495686_0047524 | Ga0495686_0047524_432_941 | 169 |
| 597 | 3300048905 | Ga0496102_0631815 | Ga0496102_0631815_126_635 | 169 |
| 598 | 3300048913 | Ga0496110_0045756 | Ga0496110_0045756_2157_2666 | 169 |
| 599 | 3300048918 | Ga0496115_0001013 | Ga0496115_0001013_2738_3247 | 169 |
| 600 | 3300048925 | Ga0496122_0125665 | Ga0496122_0125665_725_1234 | 169 |
| 601 | 3300048926 | Ga0496123_0019732 | Ga0496123_0019732_2620_3129 | 169 |
| 602 | 3300048927 | Ga0496124_0060805 | Ga0496124_0060805_2549_3058 | 169 |
| 603 | 3300048928 | Ga0496125_0009585 | Ga0496125_0009585_1704_2213 | 169 |
| 604 | 3300048929 | Ga0496126_0829352 | Ga0496126_0829352_123_635 | 169 |
| 605 | 3300049571 | Ga0501034_0020877 | Ga0501034_0020877_5052_5567 | 169 |
| 606 | 3300049649 | Ga0501198_020873 | Ga0501198_020873_299_814 | 169 |
| 607 | 3300049658 | Ga0501211_013375 | Ga0501211_013375_108_617 | 169 |
| 608 | 3300049663 | Ga0501223_006069 | Ga0501223_006069_1187_1702 | 169 |
| 609 | 3300049664 | Ga0501224_000001 | Ga0501224_000001_241418_241933 | 169 |
| 610 | 3300049669 | Ga0501235_012396 | Ga0501235_012396_906_1421 | 169 |
| 611 | 3300049675 | Ga0501243_040218 | Ga0501243_040218_189_698 | 169 |
| 612 | 3300049705 | Ga0501225_0001326 | Ga0501225_0001326_6708_7223 | 169 |
| 613 | 3300049853 | Ga0501226_000047 | Ga0501226_000047_6077_6592 | 169 |
| 614 | 3300053140 | Ga0500573_0110159 | Ga0500573_0110159_668_1177 | 169 |
| 615 | 3300053151 | Ga0500604_0004006 | Ga0500604_0004006_510_1019 | 169 |
| 616 | 3300053157 | Ga0500624_000015 | Ga0500624_000015_121552_122061 | 169 |
| 617 | 3300053158 | Ga0500627_0000774 | Ga0500627_0000774_2483_2992 | 169 |
| 618 | 2162886007 | SwRhRL2b_contig_158587 | SwRhRL2b_0927.00012210 | 170 |
| 619 | 3300001979 | JGI24740J21852_10000581 | JGI24740J21852_1000058112 | 170 |
| 620 | 3300001989 | JGI24739J22299_10000556 | JGI24739J22299_100005568 | 170 |
| 621 | 3300001990 | JGI24737J22298_10004950 | JGI24737J22298_100049505 | 170 |
| 622 | 3300002075 | JGI24738J21930_10002503 | JGI24738J21930_100025037 | 170 |
| 623 | 3300005289 | Ga0065704_10004250 | Ga0065704_100042507 | 170 |
| 624 | 3300005327 | Ga0070658_10022607 | Ga0070658_100226073 | 170 |
| 625 | 3300005347 | Ga0070668_100050210 | Ga0070668_1000502103 | 170 |
| 626 | 3300005355 | Ga0070671_100031481 | Ga0070671_1000314814 | 170 |
| 627 | 3300005455 | Ga0070663_100013235 | Ga0070663_1000132356 | 170 |
| 628 | 3300005563 | Ga0068855_100055176 | Ga0068855_1000551766 | 170 |
| 629 | 3300005577 | Ga0068857_101286437 | Ga0068857_1012864371 | 170 |
| 630 | 3300005577 | Ga0068857_101286438 | Ga0068857_1012864381 | 170 |
| 631 | 3300005614 | Ga0068856_100011736 | Ga0068856_1000117369 | 170 |
| 632 | 3300005618 | Ga0068864_100012452 | Ga0068864_1000124529 | 170 |
| 633 | 3300006042 | Ga0075368_10000166 | Ga0075368_100001663 | 170 |
| 634 | 3300006048 | Ga0075363_100154936 | Ga0075363_1001549362 | 170 |
| 635 | 3300006178 | Ga0075367_10000165 | Ga0075367_1000016517 | 170 |
| 636 | 3300009545 | Ga0105237_10008645 | Ga0105237_1000864510 | 170 |
| 637 | 3300009551 | Ga0105238_11127583 | Ga0105238_111275832 | 170 |
| 638 | 3300013100 | Ga0157373_10004059 | Ga0157373_100040597 | 170 |
| 639 | 3300013102 | Ga0157371_10175356 | Ga0157371_101753561 | 170 |
| 640 | 3300013104 | Ga0157370_10053517 | Ga0157370_100535173 | 170 |
| 641 | 3300013307 | Ga0157372_11846898 | Ga0157372_118468982 | 170 |
| 642 | 3300025904 | Ga0207647_10002965 | Ga0207647_100029657 | 170 |
| 643 | 3300025909 | Ga0207705_10372644 | Ga0207705_103726442 | 170 |
| 644 | 3300025911 | Ga0207654_10055457 | Ga0207654_100554572 | 170 |
| 645 | 3300025913 | Ga0207695_10029118 | Ga0207695_100291183 | 170 |
| 646 | 3300025914 | Ga0207671_10012474 | Ga0207671_100124745 | 170 |
| 647 | 3300025919 | Ga0207657_10031828 | Ga0207657_100318282 | 170 |
| 648 | 3300025924 | Ga0207694_10003601 | Ga0207694_100036017 | 170 |
| 649 | 3300025933 | Ga0207706_10053926 | Ga0207706_100539263 | 170 |
| 650 | 3300025945 | Ga0207679_10155985 | Ga0207679_101559852 | 170 |
| 651 | 3300025949 | Ga0207667_10087995 | Ga0207667_100879952 | 170 |
| 652 | 3300025972 | Ga0207668_10062258 | Ga0207668_100622583 | 170 |
| 653 | 3300025981 | Ga0207640_10015151 | Ga0207640_100151516 | 170 |
| 654 | 3300026041 | Ga0207639_10000323 | Ga0207639_100003234 | 170 |
| 655 | 3300026067 | Ga0207678_10000068 | Ga0207678_1000006863 | 170 |
| 656 | 3300026078 | Ga0207702_10008576 | Ga0207702_100085767 | 170 |
| 657 | 3300026116 | Ga0207674_11407119 | Ga0207674_114071192 | 170 |
| 658 | 3300026116 | Ga0207674_11407120 | Ga0207674_114071202 | 170 |
| 659 | 3300026142 | Ga0207698_10051137 | Ga0207698_100511374 | 170 |
| 660 | 3300027866 | Ga0209813_10000062 | Ga0209813_1000006236 | 170 |
| 661 | 3300031548 | Ga0307408_100001959 | Ga0307408_10000195911 | 170 |
| 662 | 3300031731 | Ga0307405_10005480 | Ga0307405_100054806 | 170 |
| 663 | 3300031824 | Ga0307413_10018804 | Ga0307413_100188046 | 170 |
| 664 | 3300031852 | Ga0307410_10006448 | Ga0307410_100064486 | 170 |
| 665 | 3300031911 | Ga0307412_10054477 | Ga0307412_100544772 | 170 |
| 666 | 3300031995 | Ga0307409_100134104 | Ga0307409_1001341042 | 170 |
| 667 | 3300032002 | Ga0307416_100163788 | Ga0307416_1001637882 | 170 |
| 668 | 3300032004 | Ga0307414_10182960 | Ga0307414_101829602 | 170 |
| 669 | 3300032005 | Ga0307411_10033420 | Ga0307411_100334203 | 170 |
| 670 | 3300046452 | Ga0495617_041834 | Ga0495617_041834_660_1172 | 170 |
| 671 | 3300046453 | Ga0495627_000584 | Ga0495627_000584_25891_26403 | 170 |
| 672 | 3300046453 | Ga0495627_000871 | Ga0495627_000871_3917_4435 | 170 |
| 673 | 3300046512 | Ga0495610_0000186 | Ga0495610_0000186_56572_57084 | 170 |
| 674 | 3300046512 | Ga0495610_0017207 | Ga0495610_0017207_1638_2150 | 170 |
| 675 | 3300046520 | Ga0495637_0020325 | Ga0495637_0020325_709_1221 | 170 |
| 676 | 3300046524 | Ga0495648_0217601 | Ga0495648_0217601_33_551 | 170 |
| 677 | 3300047470 | Ga0495681_0001332 | Ga0495681_0001332_15299_15811 | 170 |
| 678 | 3300047472 | Ga0495686_0087793 | Ga0495686_0087793_662_1174 | 170 |
| 679 | 3300048905 | Ga0496102_0562859 | Ga0496102_0562859_292_804 | 170 |
| 680 | 3300048905 | Ga0496102_1326051 | Ga0496102_1326051_61_579 | 170 |
| 681 | 3300048911 | Ga0496108_0000914 | Ga0496108_0000914_9303_9815 | 170 |
| 682 | 3300048912 | Ga0496109_0051693 | Ga0496109_0051693_1806_2318 | 170 |
| 683 | 3300048913 | Ga0496110_0057006 | Ga0496110_0057006_351_863 | 170 |
| 684 | 3300048914 | Ga0496111_0139718 | Ga0496111_0139718_711_1223 | 170 |
| 685 | 3300048916 | Ga0496113_0194112 | Ga0496113_0194112_695_1207 | 170 |
| 686 | 3300048919 | Ga0496116_0019717 | Ga0496116_0019717_2049_2561 | 170 |
| 687 | 3300048919 | Ga0496116_0047570 | Ga0496116_0047570_2171_2689 | 170 |
| 688 | 3300048920 | Ga0496117_0030704 | Ga0496117_0030704_1162_1680 | 170 |
| 689 | 3300048922 | Ga0496119_0025551 | Ga0496119_0025551_1990_2508 | 170 |
| 690 | 3300048923 | Ga0496120_0146262 | Ga0496120_0146262_78_596 | 170 |
| 691 | 3300048924 | Ga0496121_0003303 | Ga0496121_0003303_2216_2728 | 170 |
| 692 | 3300048926 | Ga0496123_0070113 | Ga0496123_0070113_965_1477 | 170 |
| 693 | 3300048927 | Ga0496124_0029380 | Ga0496124_0029380_3434_3952 | 170 |
| 694 | 3300048927 | Ga0496124_0225022 | Ga0496124_0225022_391_903 | 170 |
| 695 | 3300048928 | Ga0496125_0035550 | Ga0496125_0035550_2831_3343 | 170 |
| 696 | 3300048928 | Ga0496125_0084265 | Ga0496125_0084265_1057_1569 | 170 |
| 697 | 3300048929 | Ga0496126_0018985 | Ga0496126_0018985_1531_2043 | 170 |
| 698 | 3300049459 | Ga0495678_059497 | Ga0495678_059497_491_1003 | 170 |
| 699 | 3300049663 | Ga0501223_000036 | Ga0501223_000036_16476_16988 | 170 |
| 700 | 3300049685 | Ga0501256_002042 | Ga0501256_002042_445_957 | 170 |
| 701 | 3300049705 | Ga0501225_0000037 | Ga0501225_0000037_15966_16478 | 170 |
| 702 | 3300050490 | nmdc:mga03n38_326177_c1 | nmdc:mga03n38_326177_c1_31_543 | 170 |
| 703 | 3300050494 | nmdc:mga06z11_36_c1 | nmdc:mga06z11_36_c1_29517_30029 | 170 |
| 704 | 3300050495 | nmdc:mga04h51_475_c1 | nmdc:mga04h51_475_c1_6453_6965 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o0a-assembly1.cif.gz_B | crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) | 0.9697 | 5 | 161 |
| 8i8i-assembly2.cif.gz_C-2 | crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution | 0.9652 | 4 | 161 |
| 3nba-assembly2.cif.gz_B | phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp) | 0.9636 | 5 | 160 |
| 7yy8-assembly1.cif.gz_B-2 | crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 | 0.963 | 5 | 161 |
| 6g6v-assembly1.cif.gz_A | phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. | 0.9606 | 5 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9582 | 5 | 161 | 3.40.50.620 |
| 4natB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9491 | 3 | 161 | 3.40.50.620 |
| 3nbkD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9488 | 1 | 161 | 3.40.50.620 |
| 6g7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9391 | 5 | 161 | 3.40.50.620 |
| 5ts2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9357 | 1 | 161 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G9SKH7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9852 | 5 | 162 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A3C0MD70-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9846 | 1 | 164 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A0Q4CFV7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9825 | 21 | 169 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-B8GVE7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.9821 | 5 | 163 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A3C0YCS7-F1-model_v4 | Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) | 0.981 | 3 | 164 |
GO:0004595
GO:0005524 GO:0005737 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar