F476380

General Info

Members Datasets Scaffolds Average Seq Length
704 321 687 166

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0392407|Ga0501033_0392407_213_800
Length 195
Sequence MPSPARARHPDPFRTAVFTGTFDPISLGHLDVIRRGRLLFDHLVVGIGVHPSKTSLFAIDERLSLARRVVEPFPNVSVESFEELTVQYVRRIGARVILRGLRTLTDMEYEFGMTLTNQRLDPEIETVFLMADSQYSHVSSSLIRQVARFGGRESLKPFVPELVIDPILAKLSVNRSADTAVDYDKRSVAVKLPEP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
5 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
6 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
9 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
10 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
11 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
12 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
13 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
14 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
15 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
16 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
17 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
18 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
19 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
28 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
29 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
254 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
287 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
288 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
289 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
290 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
291 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
292 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
293 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
294 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
295 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
296 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
297 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
298 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
299 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
300 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
301 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
302 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
303 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
306 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
307 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
308 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
313 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
314 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
315 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
316 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
319 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0
Isolates 2.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.71
Bulb 0
Endosphere 7.24
Nodule 0
Rhizoplane 2.56
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_158587 2162886007 Bacteria 2633
2 SwRhRL2b_contig_3731301 2162886007 Bacteria 1169
3 JGI24736J21556_1035193 3300001904 Bacteria 773
4 JGI24741J21665_1019720 3300001915 Bacteria 1066
5 JGI24752J21851_1001534 3300001976 Bacteria 3108
6 JGI24740J21852_10000581 3300001979 Bacteria 15714
7 JGI24740J21852_10040944 3300001979 Bacteria 1400
8 JGI24740J21852_10082444 3300001979 Bacteria 840
9 JGI24739J22299_10000556 3300001989 Bacteria 13387
10 JGI24739J22299_10085242 3300001989 Bacteria 966
11 JGI24737J22298_10004950 3300001990 Bacteria 4616
12 JGI24737J22298_10018373 3300001990 Bacteria 2244
13 JGI24737J22298_10073671 3300001990 Bacteria 1018
14 JGI24735J21928_10000676 3300002067 Bacteria 12079
15 JGI24735J21928_10007951 3300002067 Bacteria 3444
16 JGI24735J21928_10010773 3300002067 Bacteria 2906
17 JGI24738J21930_10002503 3300002075 Bacteria 4786
18 JGI24749J21850_1022072 3300002076 Bacteria 902
19 JGI24034J26672_10009458 3300002239 Bacteria 1438
20 JGI25150J39212_1000711 3300002774 Bacteria 11968
21 JGI25151J46595_10023430 3300003187 Bacteria 2544
22 JGI25165J46597_1000024 3300003214 Bacteria 335150
23 JGI25153J46596_10000186 3300003215 Bacteria 60427
24 Ga0055526_1000503 3300003771 Bacteria 31087
25 Ga0055536_1026934 3300003781 Bacteria 1602
26 Ga0055540_1003332 3300003792 Bacteria 7820
27 Ga0055540_1006395 3300003792 Bacteria 4685
28 Ga0055543_1035427 3300004625 Bacteria 857
29 Ga0065704_10001990 3300005289 Bacteria 8995
30 Ga0065704_10004250 3300005289 Bacteria 5531
31 Ga0065704_10190368 3300005289 Bacteria 1192
32 Ga0065715_10000724 3300005293 Bacteria 9238
33 Ga0070658_10022607 3300005327 Bacteria 5045
34 Ga0070658_10135521 3300005327 Bacteria 2054
35 Ga0070658_10138794 3300005327 Bacteria 2030
36 Ga0070658_10295647 3300005327 Bacteria 1380
37 Ga0070658_10528128 3300005327 Bacteria 1020
38 Ga0070658_10779209 3300005327 Bacteria 831
39 Ga0070683_100836122 3300005329 Bacteria 883
40 Ga0070690_100026517 3300005330 Bacteria 3575
41 Ga0070670_100000964 3300005331 Bacteria 22587
42 Ga0070670_100001075 3300005331 Bacteria 21713
43 Ga0070670_100003439 3300005331 Bacteria 13136
44 Ga0070670_100055005 3300005331 Bacteria 3416
45 Ga0070670_100273307 3300005331 Bacteria 1475
46 Ga0070677_10000705 3300005333 Bacteria 11228
47 Ga0068869_100501048 3300005334 Bacteria 1014
48 Ga0070666_10000089 3300005335 Bacteria 64147
49 Ga0070666_10082589 3300005335 Bacteria 2197
50 Ga0070666_10111826 3300005335 Bacteria 1889
51 Ga0070680_100010145 3300005336 Bacteria 7262
52 Ga0070680_100061186 3300005336 Bacteria 3082
53 Ga0070680_100203329 3300005336 Bacteria 1671
54 Ga0070680_100381810 3300005336 Bacteria 1199
55 Ga0070680_100478403 3300005336 Bacteria 1064
56 Ga0070682_100327637 3300005337 Bacteria 1134
57 Ga0070682_100675763 3300005337 Bacteria 825
58 Ga0068868_100088300 3300005338 Bacteria 2495
59 Ga0070660_100051863 3300005339 Bacteria 3161
60 Ga0070660_100067208 3300005339 Bacteria 2792
61 Ga0070660_100285692 3300005339 Bacteria 1350
62 Ga0070660_100635435 3300005339 Bacteria 894
63 Ga0070660_100757531 3300005339 Bacteria 815
64 Ga0070660_101062951 3300005339 Bacteria 685
65 Ga0070660_101219995 3300005339 Bacteria 638
66 Ga0070691_10454621 3300005341 Bacteria 732
67 Ga0070661_100000014 3300005344 Bacteria 158652
68 Ga0070661_100056132 3300005344 Bacteria 2885
69 Ga0070661_100078489 3300005344 Bacteria 2435
70 Ga0070692_10006130 3300005345 Bacteria 5195
71 Ga0070668_100000014 3300005347 Bacteria 112374
72 Ga0070668_100035049 3300005347 Bacteria 3825
73 Ga0070668_100050210 3300005347 Bacteria 3211
74 Ga0070668_100078772 3300005347 Bacteria 2578
75 Ga0070668_100137456 3300005347 Bacteria 1966
76 Ga0070668_100576832 3300005347 Bacteria 982
77 Ga0070669_100000024 3300005353 Bacteria 173107
78 Ga0070669_100003409 3300005353 Bacteria 11441
79 Ga0070669_100018244 3300005353 Bacteria 5013
80 Ga0070669_100068114 3300005353 Bacteria 2627
81 Ga0070669_100390569 3300005353 Bacteria 1136
82 Ga0070669_100525624 3300005353 Bacteria 984
83 Ga0070675_100006846 3300005354 Bacteria 8752
84 Ga0070671_100000006 3300005355 Bacteria 250635
85 Ga0070671_100031481 3300005355 Bacteria 4382
86 Ga0070671_100051163 3300005355 Bacteria 3435
87 Ga0070671_100462840 3300005355 Bacteria 1088
88 Ga0070674_100010543 3300005356 Bacteria 5593
89 Ga0070673_100034866 3300005364 Bacteria 3812
90 Ga0070673_100038050 3300005364 Bacteria 3671
91 Ga0070659_100059544 3300005366 Bacteria 3015
92 Ga0070659_100060274 3300005366 Bacteria 2997
93 Ga0070659_100544125 3300005366 Bacteria 993
94 Ga0070659_100862008 3300005366 Bacteria 790
95 Ga0070667_100000051 3300005367 Bacteria 155117
96 Ga0070667_100056171 3300005367 Bacteria 3325
97 Ga0070667_100137672 3300005367 Bacteria 2135
98 Ga0070701_10088315 3300005438 Bacteria 1693
99 Ga0070700_100055816 3300005441 Bacteria 2473
100 Ga0070708_100039593 3300005445 Bacteria 4125
101 Ga0070663_100013235 3300005455 Bacteria 5251
102 Ga0070663_100095827 3300005455 Bacteria 2206
103 Ga0070663_100340925 3300005455 Bacteria 1211
104 Ga0070663_101366240 3300005455 Bacteria 626
105 Ga0070678_100006580 3300005456 Bacteria 6830
106 Ga0070662_100001528 3300005457 Bacteria 14251
107 Ga0070662_100019126 3300005457 Bacteria 4645
108 Ga0070662_100152991 3300005457 Bacteria 1798
109 Ga0070662_100240976 3300005457 Bacteria 1450
110 Ga0070662_100477549 3300005457 Bacteria 1037
111 Ga0070681_10069647 3300005458 Bacteria 3484
112 Ga0070681_10125533 3300005458 Bacteria 2499
113 Ga0070681_10302567 3300005458 Bacteria 1509
114 Ga0070681_10304875 3300005458 Bacteria 1502
115 Ga0070681_10503411 3300005458 Bacteria 1124
116 Ga0068867_100064156 3300005459 Bacteria 2731
117 Ga0070706_100618422 3300005467 Bacteria 1006
118 Ga0070679_100000003 3300005530 Bacteria 307836
119 Ga0070679_100033561 3300005530 Bacteria 5082
120 Ga0070679_100091875 3300005530 Bacteria 3023
121 Ga0070679_100205183 3300005530 Bacteria 1935
122 Ga0070679_100262730 3300005530 Bacteria 1681
123 Ga0070679_101170360 3300005530 Bacteria 714
124 Ga0070679_101188883 3300005530 Bacteria 708
125 Ga0070684_100274879 3300005535 Bacteria 1543
126 Ga0070684_101284704 3300005535 Bacteria 689
127 Ga0068853_100005871 3300005539 Bacteria 9677
128 Ga0068853_100024335 3300005539 Bacteria 5076
129 Ga0068853_100124119 3300005539 Bacteria 2305
130 Ga0068853_100235623 3300005539 Bacteria 1676
131 Ga0068853_100383723 3300005539 Bacteria 1312
132 Ga0070672_100005676 3300005543 Bacteria 8310
133 Ga0070686_101055559 3300005544 Bacteria 669
134 Ga0070665_100000471 3300005548 Bacteria 58097
135 Ga0070665_100095368 3300005548 Bacteria 2980
136 Ga0070665_100310719 3300005548 Bacteria 1580
137 Ga0070665_100822401 3300005548 Bacteria 942
138 Ga0070665_101837287 3300005548 Bacteria 612
139 Ga0068855_100055176 3300005563 Bacteria 4668
140 Ga0068855_100473645 3300005563 Bacteria 1364
141 Ga0068855_101277420 3300005563 Bacteria 761
142 Ga0070664_100061185 3300005564 Bacteria 3209
143 Ga0070664_100119688 3300005564 Bacteria 2304
144 Ga0070664_100194348 3300005564 Bacteria 1809
145 Ga0070664_100560586 3300005564 Bacteria 1057
146 Ga0068857_100005612 3300005577 Bacteria 10725
147 Ga0068857_100067854 3300005577 Bacteria 3174
148 Ga0068857_100102670 3300005577 Bacteria 2567
149 Ga0068857_100160563 3300005577 Bacteria 2039
150 Ga0068857_100693885 3300005577 Bacteria 967
151 Ga0068857_101286437 3300005577 Bacteria 709
152 Ga0068857_101286438 3300005577 Bacteria 709
153 Ga0068854_100119433 3300005578 Bacteria 1999
154 Ga0068854_100176768 3300005578 Bacteria 1665
155 Ga0068854_100182268 3300005578 Bacteria 1641
156 Ga0068854_100228496 3300005578 Bacteria 1476
157 Ga0068854_100264883 3300005578 Bacteria 1377
158 Ga0068854_100552740 3300005578 Bacteria 977
159 Ga0068856_100011736 3300005614 Bacteria 8498
160 Ga0068856_100290455 3300005614 Bacteria 1652
161 Ga0068852_100013294 3300005616 Bacteria 6296
162 Ga0068852_100051429 3300005616 Bacteria 3535
163 Ga0068852_100364779 3300005616 Bacteria 1414
164 Ga0068859_100000256 3300005617 Bacteria 52870
165 Ga0068859_100014519 3300005617 Bacteria 7909
166 Ga0068864_100001091 3300005618 Bacteria 22748
167 Ga0068864_100001437 3300005618 Bacteria 19648
168 Ga0068864_100012174 3300005618 Bacteria 7111
169 Ga0068864_100012452 3300005618 Bacteria 7033
170 Ga0068861_100000799 3300005719 Bacteria 18980
171 Ga0068861_100004837 3300005719 Bacteria 9057
172 Ga0068851_10019383 3300005834 Bacteria 3286
173 Ga0068851_10159714 3300005834 Bacteria 1237
174 Ga0068863_100000028 3300005841 Bacteria 181662
175 Ga0068863_100005179 3300005841 Bacteria 12862
176 Ga0068863_100009700 3300005841 Bacteria 9393
177 Ga0068863_100203058 3300005841 Bacteria 1907
178 Ga0068858_100000181 3300005842 Bacteria 66254
179 Ga0068858_100004139 3300005842 Bacteria 14270
180 Ga0068858_100047175 3300005842 Bacteria 3994
181 Ga0068858_100869672 3300005842 Bacteria 881
182 Ga0068860_100005743 3300005843 Bacteria 12515
183 Ga0068860_100041662 3300005843 Bacteria 4386
184 Ga0068860_100579424 3300005843 Bacteria 1126
185 Ga0068862_100000310 3300005844 Bacteria 53315
186 Ga0068862_100135043 3300005844 Bacteria 2186
187 Ga0068862_100190712 3300005844 Bacteria 1844
188 Ga0075368_10000166 3300006042 Bacteria 17785
189 Ga0075363_100154936 3300006048 Bacteria 1295
190 Ga0075367_10000165 3300006178 Bacteria 20961
191 Ga0075366_10017242 3300006195 Bacteria 4154
192 Ga0097621_100495776 3300006237 Bacteria 1106
193 Ga0075370_10100655 3300006353 Bacteria 1672
194 Ga0097620_100000256 3300006931 Bacteria 52870
195 Ga0097620_100014519 3300006931 Bacteria 7909
196 Ga0105251_10023016 3300009011 Bacteria 3223
197 Ga0105251_10107027 3300009011 Bacteria 1276
198 Ga0105250_10285979 3300009092 Bacteria 710
199 Ga0105240_10023003 3300009093 Bacteria 8254
200 Ga0111539_10267250 3300009094 Bacteria 1991
201 Ga0105245_10000853 3300009098 Bacteria 27630
202 Ga0105247_10000644 3300009101 Bacteria 27956
203 Ga0105247_10618861 3300009101 Bacteria 805
204 Ga0105243_10063765 3300009148 Bacteria 2954
205 Ga0105243_10181415 3300009148 Bacteria 1831
206 Ga0105243_10281670 3300009148 Bacteria 1498
207 Ga0105241_10008572 3300009174 Bacteria 7510
208 Ga0105241_10424314 3300009174 Bacteria 1171
209 Ga0105242_10201400 3300009176 Unclassified 1768
210 Ga0105248_10020230 3300009177 Bacteria 7372
211 Ga0105248_10232476 3300009177 Bacteria 2075
212 Ga0105237_10008645 3300009545 Bacteria 11003
213 Ga0105238_10374635 3300009551 Bacteria 1414
214 Ga0105238_11127583 3300009551 Bacteria 807
215 Ga0105249_10004911 3300009553 Bacteria 11538
216 Ga0105249_10157827 3300009553 Bacteria 2189
217 Ga0105249_11754747 3300009553 Bacteria 693
218 Ga0105148_100460 3300009978 Bacteria 3824
219 Ga0157373_10003521 3300013100 Bacteria 11836
220 Ga0157373_10004059 3300013100 Bacteria 11028
221 Ga0157373_10081951 3300013100 Bacteria 2274
222 Ga0157373_10162755 3300013100 Bacteria 1570
223 Ga0157373_10164707 3300013100 Bacteria 1560
224 Ga0157373_10340048 3300013100 Bacteria 1070
225 Ga0157371_10065105 3300013102 Bacteria 2581
226 Ga0157371_10097703 3300013102 Bacteria 2082
227 Ga0157371_10102209 3300013102 Bacteria 2033
228 Ga0157371_10175356 3300013102 Bacteria 1533
229 Ga0157371_10236991 3300013102 Bacteria 1312
230 Ga0157371_10416884 3300013102 Bacteria 984
231 Ga0157370_10053517 3300013104 Bacteria 3849
232 Ga0157370_10261661 3300013104 Bacteria 1599
233 Ga0157370_10393871 3300013104 Bacteria 1275
234 Ga0157369_10005483 3300013105 Bacteria 14744
235 Ga0157369_10008669 3300013105 Bacteria 11658
236 Ga0157369_10020246 3300013105 Bacteria 7437
237 Ga0157369_10068610 3300013105 Bacteria 3810
238 Ga0157369_10102893 3300013105 Bacteria 3042
239 Ga0157369_10217589 3300013105 Bacteria 2000
240 Ga0157374_10113648 3300013296 Bacteria 2606
241 Ga0157374_10538032 3300013296 Bacteria 1175
242 Ga0157378_10040072 3300013297 Bacteria 4154
243 Ga0157378_10081723 3300013297 Bacteria 2920
244 Ga0157378_10837975 3300013297 Bacteria 947
245 Ga0163162_10035439 3300013306 Bacteria 4971
246 Ga0163162_10041138 3300013306 Bacteria 4623
247 Ga0163162_10363831 3300013306 Bacteria 1579
248 Ga0163162_10383996 3300013306 Bacteria 1538
249 Ga0157372_10182330 3300013307 Bacteria 2431
250 Ga0157372_10202554 3300013307 Bacteria 2299
251 Ga0157372_11846898 3300013307 Bacteria 695
252 Ga0157372_12518700 3300013307 Bacteria 591
253 Ga0163163_10080992 3300014325 Bacteria 3248
254 Ga0163163_10082591 3300014325 Bacteria 3217
255 Ga0163163_10151215 3300014325 Bacteria 2365
256 Ga0157380_10001163 3300014326 Bacteria 17048
257 Ga0157380_10104065 3300014326 Bacteria 2370
258 Ga0182008_10288782 3300014497 Bacteria 855
259 Ga0157379_10081986 3300014968 Bacteria 2890
260 Ga0157379_10308399 3300014968 Bacteria 1443
261 Ga0183363_1007 3300015690 Bacteria 315687
262 Ga0163161_10009743 3300017792 Bacteria 6657
263 Ga0163161_10034019 3300017792 Bacteria 3644
264 Ga0213873_10000007 3300021358 Bacteria 309961
265 Ga0213873_10027588 3300021358 Bacteria 1386
266 Ga0213872_10126432 3300021361 Bacteria 1128
267 Ga0213876_10000005 3300021384 Bacteria 727326
268 Ga0213871_10003839 3300021441 Bacteria 2946
269 Ga0207672_1005086 3300025223 Bacteria 746
270 Ga0209437_101961 3300025233 Bacteria 4266
271 Ga0207425_1000049 3300025245 Bacteria 180735
272 Ga0209148_1026487 3300025254 Bacteria 899
273 Ga0209129_1004041 3300025258 Bacteria 5987
274 Ga0209233_1000084 3300025261 Bacteria 335222
275 Ga0209565_1000170 3300025263 Bacteria 84580
276 Ga0209673_1006861 3300025273 Bacteria 5398
277 Ga0209676_1004023 3300025292 Bacteria 8468
278 Ga0209025_1000068 3300025294 Bacteria 294129
279 Ga0209564_1000733 3300025295 Bacteria 46758
280 Ga0209758_1000019 3300025297 Bacteria 743682
281 Ga0209050_1000001 3300025298 Bacteria 3563507
282 Ga0209050_1000108 3300025298 Bacteria 222534
283 Ga0209050_1034129 3300025298 Bacteria 1529
284 Ga0209051_1000239 3300025303 Bacteria 92575
285 Ga0209257_1001303 3300025304 Bacteria 30370
286 Ga0209257_1001609 3300025304 Bacteria 25860
287 Ga0207697_10000419 3300025315 Bacteria 24002
288 Ga0207697_10008882 3300025315 Bacteria 4369
289 Ga0207697_10066668 3300025315 Bacteria 1504
290 Ga0207656_10014744 3300025321 Bacteria 3018
291 Ga0207713_1078990 3300025735 Bacteria 1189
292 Ga0207682_10003154 3300025893 Bacteria 7222
293 Ga0207682_10329151 3300025893 Bacteria 718
294 Ga0207710_10000700 3300025900 Bacteria 18794
295 Ga0207688_10117503 3300025901 Bacteria 1549
296 Ga0207680_10000481 3300025903 Bacteria 18900
297 Ga0207680_10052317 3300025903 Bacteria 2446
298 Ga0207647_10000848 3300025904 Bacteria 23724
299 Ga0207647_10002965 3300025904 Bacteria 12768
300 Ga0207647_10019937 3300025904 Bacteria 4503
301 Ga0207647_10351267 3300025904 Bacteria 835
302 Ga0207705_10057951 3300025909 Bacteria 2795
303 Ga0207705_10092403 3300025909 Bacteria 2217
304 Ga0207705_10103351 3300025909 Bacteria 2099
305 Ga0207705_10131355 3300025909 Bacteria 1864
306 Ga0207705_10140325 3300025909 Bacteria 1804
307 Ga0207705_10185314 3300025909 Bacteria 1572
308 Ga0207705_10246306 3300025909 Bacteria 1362
309 Ga0207705_10372644 3300025909 Bacteria 1102
310 Ga0207705_11095867 3300025909 Bacteria 613
311 Ga0207684_10215440 3300025910 Bacteria 1657
312 Ga0207654_10055457 3300025911 Bacteria 2295
313 Ga0207654_10155086 3300025911 Bacteria 1474
314 Ga0207707_10106419 3300025912 Bacteria 2452
315 Ga0207707_10173424 3300025912 Bacteria 1884
316 Ga0207707_10246896 3300025912 Bacteria 1551
317 Ga0207707_10401112 3300025912 Bacteria 1177
318 Ga0207695_10018286 3300025913 Bacteria 8108
319 Ga0207695_10029118 3300025913 Bacteria 6110
320 Ga0207671_10012474 3300025914 Bacteria 6828
321 Ga0207660_10002430 3300025917 Bacteria 12233
322 Ga0207660_10492475 3300025917 Bacteria 994
323 Ga0207660_10617513 3300025917 Bacteria 883
324 Ga0207657_10008341 3300025919 Bacteria 10530
325 Ga0207657_10013974 3300025919 Bacteria 7855
326 Ga0207657_10031828 3300025919 Bacteria 4771
327 Ga0207657_10073222 3300025919 Bacteria 2896
328 Ga0207657_10085802 3300025919 Bacteria 2636
329 Ga0207657_10225535 3300025919 Bacteria 1500
330 Ga0207657_10240989 3300025919 Bacteria 1444
331 Ga0207657_11206075 3300025919 Bacteria 575
332 Ga0207649_10000393 3300025920 Bacteria 32808
333 Ga0207649_10388117 3300025920 Bacteria 1042
334 Ga0207652_10000004 3300025921 Bacteria 436303
335 Ga0207652_10064277 3300025921 Bacteria 3175
336 Ga0207652_10144292 3300025921 Bacteria 2130
337 Ga0207652_10473307 3300025921 Bacteria 1128
338 Ga0207652_10578512 3300025921 Bacteria 1008
339 Ga0207681_10000004 3300025923 Bacteria 559005
340 Ga0207681_10003633 3300025923 Bacteria 9591
341 Ga0207681_10057830 3300025923 Bacteria 2652
342 Ga0207681_10067961 3300025923 Bacteria 2473
343 Ga0207681_10127025 3300025923 Bacteria 1879
344 Ga0207681_10330869 3300025923 Bacteria 1214
345 Ga0207694_10003601 3300025924 Bacteria 12274
346 Ga0207694_10141633 3300025924 Bacteria 1934
347 Ga0207694_10365311 3300025924 Bacteria 1196
348 Ga0207650_10002357 3300025925 Bacteria 13129
349 Ga0207650_10003090 3300025925 Bacteria 11462
350 Ga0207650_10049939 3300025925 Bacteria 3091
351 Ga0207650_10230002 3300025925 Bacteria 1495
352 Ga0207659_10002277 3300025926 Bacteria 11433
353 Ga0207687_10003237 3300025927 Bacteria 11034
354 Ga0207644_10000009 3300025931 Bacteria 251643
355 Ga0207644_10141096 3300025931 Bacteria 1855
356 Ga0207690_10067960 3300025932 Bacteria 2446
357 Ga0207690_10102309 3300025932 Bacteria 2048
358 Ga0207690_10174708 3300025932 Bacteria 1612
359 Ga0207690_10479921 3300025932 Bacteria 1003
360 Ga0207690_10756158 3300025932 Bacteria 801
361 Ga0207706_10001776 3300025933 Bacteria 21179
362 Ga0207706_10002422 3300025933 Bacteria 18208
363 Ga0207706_10009419 3300025933 Bacteria 8966
364 Ga0207706_10053926 3300025933 Bacteria 3549
365 Ga0207706_10111158 3300025933 Bacteria 2410
366 Ga0207686_10738817 3300025934 Unclassified 785
367 Ga0207709_10045384 3300025935 Bacteria 2661
368 Ga0207709_10097896 3300025935 Bacteria 1933
369 Ga0207691_10024273 3300025940 Bacteria 5702
370 Ga0207711_10011481 3300025941 Bacteria 7363
371 Ga0207661_10311270 3300025944 Bacteria 1414
372 Ga0207679_10102831 3300025945 Bacteria 2238
373 Ga0207679_10155985 3300025945 Bacteria 1864
374 Ga0207667_10087995 3300025949 Bacteria 3212
375 Ga0207667_10181620 3300025949 Bacteria 2160
376 Ga0207667_10467109 3300025949 Bacteria 1281
377 Ga0207667_10713898 3300025949 Bacteria 1004
378 Ga0207651_10017718 3300025960 Bacteria 4215
379 Ga0207712_10019312 3300025961 Bacteria 4449
380 Ga0207712_10041519 3300025961 Bacteria 3162
381 Ga0207668_10000047 3300025972 Bacteria 101453
382 Ga0207668_10001399 3300025972 Bacteria 14213
383 Ga0207668_10062258 3300025972 Bacteria 2627
384 Ga0207668_10110957 3300025972 Bacteria 2058
385 Ga0207668_10154373 3300025972 Bacteria 1781
386 Ga0207668_10326348 3300025972 Bacteria 1275
387 Ga0207640_10003418 3300025981 Bacteria 8550
388 Ga0207640_10015151 3300025981 Bacteria 4456
389 Ga0207640_10053669 3300025981 Bacteria 2632
390 Ga0207658_10000057 3300025986 Bacteria 124003
391 Ga0207658_10002888 3300025986 Bacteria 12319
392 Ga0207703_10000135 3300026035 Bacteria 89779
393 Ga0207703_10006420 3300026035 Bacteria 9398
394 Ga0207639_10000323 3300026041 Bacteria 33257
395 Ga0207639_10017444 3300026041 Bacteria 5090
396 Ga0207639_10057207 3300026041 Bacteria 2993
397 Ga0207639_10070294 3300026041 Bacteria 2734
398 Ga0207639_10445859 3300026041 Bacteria 1174
399 Ga0207639_10908420 3300026041 Bacteria 823
400 Ga0207678_10000068 3300026067 Bacteria 81610
401 Ga0207678_10008727 3300026067 Bacteria 8925
402 Ga0207678_10076194 3300026067 Bacteria 2873
403 Ga0207678_10181976 3300026067 Bacteria 1795
404 Ga0207678_10801019 3300026067 Bacteria 832
405 Ga0207708_10111841 3300026075 Bacteria 2121
406 Ga0207702_10008576 3300026078 Bacteria 8617
407 Ga0207702_10658268 3300026078 Bacteria 1030
408 Ga0207702_11833888 3300026078 Bacteria 598
409 Ga0207641_10000014 3300026088 Bacteria 336170
410 Ga0207641_10000277 3300026088 Bacteria 64441
411 Ga0207641_10016289 3300026088 Bacteria 6087
412 Ga0207648_10072221 3300026089 Bacteria 3008
413 Ga0207648_10197422 3300026089 Bacteria 1784
414 Ga0207676_10000532 3300026095 Bacteria 31972
415 Ga0207676_10000600 3300026095 Bacteria 29522
416 Ga0207676_10001074 3300026095 Bacteria 20774
417 Ga0207676_10467989 3300026095 Bacteria 1191
418 Ga0207674_10022118 3300026116 Bacteria 6834
419 Ga0207674_10048226 3300026116 Bacteria 4360
420 Ga0207674_10063538 3300026116 Bacteria 3727
421 Ga0207674_10295080 3300026116 Bacteria 1570
422 Ga0207674_11407119 3300026116 Bacteria 667
423 Ga0207674_11407120 3300026116 Bacteria 667
424 Ga0207675_100000740 3300026118 Bacteria 32427
425 Ga0207675_100003945 3300026118 Bacteria 14400
426 Ga0207675_100423211 3300026118 Bacteria 1316
427 Ga0207683_10008377 3300026121 Bacteria 8843
428 Ga0207698_10016480 3300026142 Bacteria 4982
429 Ga0207698_10051137 3300026142 Bacteria 3157
430 Ga0207698_10083226 3300026142 Bacteria 2589
431 Ga0207698_10176048 3300026142 Bacteria 1889
432 Ga0207698_10398497 3300026142 Bacteria 1315
433 Ga0209813_10000062 3300027866 Bacteria 43852
434 Ga0209974_10030433 3300027876 Bacteria 1789
435 Ga0207428_10487573 3300027907 Bacteria 896
436 Ga0268266_10000002 3300028379 Bacteria 3059047
437 Ga0268266_10193219 3300028379 Bacteria 1859
438 Ga0268266_10226630 3300028379 Bacteria 1720
439 Ga0268266_10415806 3300028379 Bacteria 1274
440 Ga0268266_10632788 3300028379 Bacteria 1029
441 Ga0268265_10001269 3300028380 Bacteria 21775
442 Ga0268265_10008180 3300028380 Bacteria 7066
443 Ga0268265_10160681 3300028380 Bacteria 1908
444 Ga0268264_10000069 3300028381 Bacteria 270492
445 Ga0268264_10004744 3300028381 Bacteria 11545
446 Ga0268264_10516537 3300028381 Bacteria 1167
447 Ga0307513_10030103 3300031456 Bacteria 6172
448 Ga0307408_100001959 3300031548 Bacteria 14887
449 Ga0307408_100008912 3300031548 Bacteria 6630
450 Ga0307408_100018443 3300031548 Bacteria 4684
451 Ga0307508_10001350 3300031616 Bacteria 27688
452 Ga0307405_10005480 3300031731 Bacteria 6125
453 Ga0307405_10346769 3300031731 Bacteria 1144
454 Ga0307405_10942180 3300031731 Bacteria 733
455 Ga0307413_10018804 3300031824 Bacteria 3634
456 Ga0307413_10058402 3300031824 Bacteria 2364
457 Ga0307413_10158299 3300031824 Bacteria 1588
458 Ga0307410_10002493 3300031852 Bacteria 8895
459 Ga0307410_10006448 3300031852 Bacteria 6334
460 Ga0307410_10014471 3300031852 Bacteria 4643
461 Ga0307406_10281262 3300031901 Bacteria 1269
462 Ga0307406_10412255 3300031901 Bacteria 1074
463 Ga0307406_10663458 3300031901 Bacteria 867
464 Ga0307407_10011510 3300031903 Bacteria 4214
465 Ga0307407_10084793 3300031903 Bacteria 1926
466 Ga0307407_10321260 3300031903 Bacteria 1086
467 Ga0307412_10054477 3300031911 Bacteria 2655
468 Ga0307412_10057889 3300031911 Bacteria 2589
469 Ga0307412_10612831 3300031911 Bacteria 923
470 Ga0307412_10979349 3300031911 Bacteria 746
471 Ga0307412_11213228 3300031911 Bacteria 676
472 Ga0307409_100001956 3300031995 Bacteria 10535
473 Ga0307409_100134104 3300031995 Bacteria 2121
474 Ga0307409_100737894 3300031995 Bacteria 987
475 Ga0307416_100006877 3300032002 Bacteria 7160
476 Ga0307416_100067191 3300032002 Bacteria 2955
477 Ga0307416_100126467 3300032002 Bacteria 2290
478 Ga0307416_100163788 3300032002 Bacteria 2059
479 Ga0307416_100283559 3300032002 Bacteria 1635
480 Ga0307416_102348288 3300032002 Bacteria 633
481 Ga0307414_10005096 3300032004 Bacteria 7204
482 Ga0307414_10022674 3300032004 Bacteria 3966
483 Ga0307414_10130704 3300032004 Bacteria 1949
484 Ga0307414_10182960 3300032004 Bacteria 1687
485 Ga0307414_10268528 3300032004 Bacteria 1427
486 Ga0307414_10361270 3300032004 Bacteria 1249
487 Ga0307414_10369404 3300032004 Bacteria 1237
488 Ga0307414_11249543 3300032004 Bacteria 688
489 Ga0307411_10003049 3300032005 Bacteria 7653
490 Ga0307411_10033420 3300032005 Bacteria 3190
491 Ga0307411_10033422 3300032005 Bacteria 3190
492 Ga0307415_100031294 3300032126 Bacteria 3426
493 Ga0307415_100058462 3300032126 Bacteria 2655
494 Ga0307415_100160374 3300032126 Bacteria 1742
495 Ga0373923_0264169 3300035111 Bacteria 808
496 Ga0373935_0011883 3300035692 Bacteria 5231
497 Ga0373927_0618172 3300035695 Bacteria 716
498 Ga0373937_0300059 3300036401 Bacteria 1518
499 Ga0395899_0018782 3300037312 Bacteria 5252
500 Ga0395899_0158379 3300037312 Bacteria 1601
501 Ga0395899_0250521 3300037312 Bacteria 1215
502 Ga0395899_0401583 3300037312 Bacteria 907
503 Ga0395900_0000764 3300037418 Bacteria 42836
504 Ga0395900_0019021 3300037418 Bacteria 7004
505 Ga0395900_0020505 3300037418 Bacteria 6748
506 Ga0395900_0237976 3300037418 Bacteria 1827
507 Ga0395900_0525565 3300037418 Bacteria 1130
508 Ga0395900_0782442 3300037418 Bacteria 883
509 Ga0395898_0056692 3300037466 Bacteria 3819
510 Ga0395898_0081863 3300037466 Bacteria 3112
511 Ga0395898_0728105 3300037466 Bacteria 933
512 Ga0395898_1833019 3300037466 Bacteria 527
513 Ga0395905_0003045 3300037471 Bacteria 18153
514 Ga0395905_0021583 3300037471 Bacteria 6088
515 Ga0395905_0026680 3300037471 Bacteria 5447
516 Ga0395905_0026966 3300037471 Bacteria 5418
517 Ga0395905_0061435 3300037471 Bacteria 3515
518 Ga0395905_0119628 3300037471 Bacteria 2475
519 Ga0395905_0151993 3300037471 Bacteria 2178
520 Ga0395905_0201402 3300037471 Bacteria 1866
521 Ga0395905_0228802 3300037471 Bacteria 1739
522 Ga0395905_0422179 3300037471 Bacteria 1230
523 Ga0395905_0893439 3300037471 Bacteria 791
524 Ga0395905_1430114 3300037471 Bacteria 596
525 Ga0436364_0783469 3300037853 Bacteria 845
526 Ga0436364_1376076 3300037853 Bacteria 696
527 Ga0436364_1549875 3300037853 Bacteria 1560
528 Ga0395901_0008085 3300038443 Bacteria 10626
529 Ga0395901_0009829 3300038443 Bacteria 9698
530 Ga0395901_0011906 3300038443 Bacteria 8821
531 Ga0395901_0167230 3300038443 Bacteria 2308
532 Ga0395901_0180614 3300038443 Bacteria 2213
533 Ga0395901_0557676 3300038443 Bacteria 1160
534 Ga0395901_0573348 3300038443 Bacteria 1141
535 Ga0436365_0176211 3300039437 Bacteria 57194
536 Ga0436365_0862951 3300039437 Bacteria 1103
537 Ga0436365_1643344 3300039437 Bacteria 707
538 Ga0436360_1357732 3300039438 Bacteria 2661
539 Ga0436361_0580849 3300039447 Bacteria 1018
540 Ga0436361_1102360 3300039447 Bacteria 3934
541 Ga0436363_0689652 3300039450 Bacteria 689
542 Ga0436363_1450113 3300039450 Bacteria 858
543 Ga0436362_0386479 3300039453 Bacteria 885
544 Ga0436362_0945445 3300039453 Bacteria 4337
545 Ga0436362_0976836 3300039453 Bacteria 135942
546 Ga0439448_0002960 3300042005 Bacteria 4660
547 Ga0466966_0001337 3300044684 Bacteria 15828
548 Ga0466963_0277001 3300044694 Bacteria 1179
549 Ga0495617_041834 3300046452 Bacteria 1531
550 Ga0495627_000584 3300046453 Bacteria 29144
551 Ga0495627_000871 3300046453 Bacteria 21374
552 Ga0495627_062907 3300046453 Bacteria 1095
553 Ga0495627_088423 3300046453 Bacteria 892
554 Ga0495638_0055240 3300046460 Bacteria 2466
555 Ga0495638_0247843 3300046460 Bacteria 983
556 Ga0495584_0322376 3300046491 Bacteria 785
557 Ga0495585_0182581 3300046492 Bacteria 1078
558 Ga0495585_0280224 3300046492 Bacteria 824
559 Ga0495596_0045487 3300046500 Bacteria 1726
560 Ga0495610_0000186 3300046512 Bacteria 69408
561 Ga0495610_0017207 3300046512 Bacteria 4127
562 Ga0495616_0000182 3300046513 Bacteria 53346
563 Ga0495632_0001056 3300046519 Bacteria 23635
564 Ga0495637_0018088 3300046520 Bacteria 3272
565 Ga0495637_0020325 3300046520 Bacteria 3057
566 Ga0495643_0000146 3300046522 Bacteria 114508
567 Ga0495648_0004271 3300046524 Bacteria 12254
568 Ga0495648_0113632 3300046524 Bacteria 1468
569 Ga0495648_0217601 3300046524 Bacteria 944
570 Ga0495663_0000006 3300046525 Bacteria 306938
571 Ga0495663_0083488 3300046525 Bacteria 1032
572 Ga0495598_0013638 3300046537 Bacteria 2019
573 Ga0495621_0001565 3300046539 Bacteria 5962
574 Ga0495633_0000192 3300046558 Bacteria 78563
575 Ga0495633_0001161 3300046558 Bacteria 21140
576 Ga0495633_0020434 3300046558 Bacteria 3330
577 Ga0495633_0039310 3300046558 Bacteria 2258
578 Ga0495668_0016769 3300046616 Bacteria 4257
579 Ga0495625_0000107 3300046660 Bacteria 125777
580 Ga0495625_0377657 3300046660 Bacteria 890
581 Ga0495659_0010552 3300046664 Bacteria 2967
582 Ga0495670_0007711 3300046691 Bacteria 5293
583 Ga0495671_0000100 3300046692 Bacteria 78876
584 Ga0495677_0046050 3300047445 Bacteria 1601
585 Ga0495681_0001332 3300047470 Bacteria 18673
586 Ga0495681_0034366 3300047470 Bacteria 2527
587 Ga0495686_0000513 3300047472 Bacteria 56005
588 Ga0495686_0032568 3300047472 Bacteria 3373
589 Ga0495686_0047524 3300047472 Bacteria 2709
590 Ga0495686_0087793 3300047472 Bacteria 1891
591 Ga0496102_0562859 3300048905 Bacteria 1063
592 Ga0496102_0631815 3300048905 Bacteria 994
593 Ga0496102_0702575 3300048905 Bacteria 934
594 Ga0496102_1326051 3300048905 Bacteria 639
595 Ga0496103_0504660 3300048906 Bacteria 774
596 Ga0496105_0325649 3300048908 Bacteria 1231
597 Ga0496107_0108645 3300048910 Bacteria 2037
598 Ga0496108_0000914 3300048911 Bacteria 22971
599 Ga0496109_0051693 3300048912 Bacteria 3743
600 Ga0496110_0045756 3300048913 Bacteria 3826
601 Ga0496110_0057006 3300048913 Bacteria 3438
602 Ga0496110_0489587 3300048913 Bacteria 1120
603 Ga0496111_0139718 3300048914 Bacteria 1795
604 Ga0496113_0194112 3300048916 Bacteria 1612
605 Ga0496114_0000206 3300048917 Bacteria 42865
606 Ga0496115_0001013 3300048918 Bacteria 20385
607 Ga0496115_0429820 3300048918 Bacteria 1069
608 Ga0496116_0019717 3300048919 Bacteria 5155
609 Ga0496116_0047570 3300048919 Bacteria 2886
610 Ga0496117_0030704 3300048920 Bacteria 4117
611 Ga0496119_0025551 3300048922 Bacteria 4121
612 Ga0496120_0146262 3300048923 Bacteria 1193
613 Ga0496121_0000189 3300048924 Bacteria 137827
614 Ga0496121_0003303 3300048924 Bacteria 23154
615 Ga0496121_0035146 3300048924 Bacteria 4495
616 Ga0496122_0125665 3300048925 Bacteria 1642
617 Ga0496123_0019732 3300048926 Bacteria 5303
618 Ga0496123_0070113 3300048926 Bacteria 2196
619 Ga0496124_0029380 3300048927 Bacteria 4899
620 Ga0496124_0060805 3300048927 Bacteria 3168
621 Ga0496124_0196213 3300048927 Bacteria 1540
622 Ga0496124_0225022 3300048927 Bacteria 1407
623 Ga0496125_0009585 3300048928 Bacteria 9911
624 Ga0496125_0035550 3300048928 Bacteria 4367
625 Ga0496125_0084265 3300048928 Bacteria 2414
626 Ga0496126_0018985 3300048929 Bacteria 6789
627 Ga0496126_0829352 3300048929 Bacteria 707
628 Ga0495678_059497 3300049459 Bacteria 1440
629 Ga0501290_006651 3300049513 Bacteria 1447
630 Ga0501033_0157192 3300049570 Bacteria 1638
631 Ga0501033_0392407 3300049570 Bacteria 969
632 Ga0501034_0020877 3300049571 Bacteria 6685
633 Ga0501034_0344439 3300049571 Bacteria 1420
634 Ga0501037_0484270 3300049573 Bacteria 841
635 Ga0501046_0106566 3300049580 Bacteria 2145
636 Ga0501047_0235519 3300049581 Bacteria 1683
637 Ga0501070_0152544 3300049586 Bacteria 1906
638 Ga0501071_0239731 3300049587 Bacteria 1367
639 Ga0501198_020873 3300049649 Bacteria 1040
640 Ga0501211_013375 3300049658 Bacteria 816
641 Ga0501223_000036 3300049663 Bacteria 46823
642 Ga0501223_004150 3300049663 Bacteria 3121
643 Ga0501223_006069 3300049663 Bacteria 2513
644 Ga0501223_016865 3300049663 Bacteria 1442
645 Ga0501224_000001 3300049664 Bacteria 308131
646 Ga0501227_015092 3300049665 Bacteria 1724
647 Ga0501233_024940 3300049668 Bacteria 1311
648 Ga0501235_012396 3300049669 Bacteria 1875
649 Ga0501243_040218 3300049675 Bacteria 820
650 Ga0501247_006394 3300049677 Bacteria 1333
651 Ga0501256_002042 3300049685 Bacteria 1572
652 Ga0501257_000073 3300049686 Bacteria 25203
653 Ga0501225_0000037 3300049705 Bacteria 46276
654 Ga0501225_0001326 3300049705 Bacteria 7692
655 Ga0501225_0022235 3300049705 Bacteria 1751
656 Ga0501267_008201 3300049764 Bacteria 1028
657 Ga0501268_008723 3300049765 Bacteria 1543
658 Ga0501278_016981 3300049774 Bacteria 639
659 Ga0501279_012735 3300049775 Bacteria 1146
660 Ga0501280_005610 3300049776 Bacteria 1792
661 Ga0501283_035633 3300049779 Bacteria 848
662 Ga0501044_0225587 3300049823 Bacteria 1823
663 Ga0501044_0267643 3300049823 Bacteria 1646
664 Ga0501044_0484226 3300049823 Bacteria 1140
665 Ga0501044_0653431 3300049823 Bacteria 940
666 Ga0501044_1284043 3300049823 Bacteria 599
667 Ga0501226_000047 3300049853 Bacteria 54518
668 nmdc:mga03n38_326177_c1 3300050490 Bacteria 830
669 nmdc:mga0k408_202812_c1 3300050493 Bacteria 1184
670 nmdc:mga06z11_36_c1 3300050494 Bacteria 55905
671 nmdc:mga04h51_475_c1 3300050495 Bacteria 9623
672 nmdc:mga07m45_152791_c1 3300050496 Bacteria 1339
673 nmdc:mga08y16_187000_c1 3300050511 Bacteria 2149
674 Ga0500610_0418004 3300053079 Bacteria 538
675 Ga0500643_000136 3300053087 Bacteria 74292
676 Ga0500643_001250 3300053087 Bacteria 15061
677 Ga0500643_037629 3300053087 Bacteria 1439
678 Ga0500595_001051 3300053119 Bacteria 15380
679 Ga0500573_0000021 3300053140 Bacteria 159093
680 Ga0500573_0110159 3300053140 Bacteria 1541
681 Ga0500604_0004006 3300053151 Bacteria 3933
682 Ga0500616_0199798 3300053153 Bacteria 886
683 Ga0500624_000015 3300053157 Bacteria 161928
684 Ga0500624_000930 3300053157 Bacteria 6159
685 Ga0500627_0000774 3300053158 Bacteria 8513
686 Ga0500636_0102937 3300053177 Bacteria 1620
687 Ga0500645_003386 3300053730 Bacteria 6510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2993693658 2993696320 132
2 3300037471 Ga0395905_0893439 Ga0395905_0893439_360_761 133
3 3300037466 Ga0395898_1833019 Ga0395898_1833019_95_505 136
4 3300046453 Ga0495627_062907 Ga0495627_062907_609_1058 148
5 3300002067 JGI24735J21928_10000676 JGI24735J21928_1000067610 150
6 3300053079 Ga0500610_0418004 Ga0500610_0418004_70_525 151
7 3300046660 Ga0495625_0377657 Ga0495625_0377657_228_686 152
8 3300039437 Ga0436365_1643344 Ga0436365_1643344_105_638 156
9 iso_pu_bacteria 2920107658 2920114608 158
10 3300035111 Ga0373923_0264169 Ga0373923_0264169_123_605 159
11 3300009176 Ga0105242_10201400 Ga0105242_102014003 160
12 3300025934 Ga0207686_10738817 Ga0207686_107388172 160
13 3300005347 Ga0070668_100078772 Ga0070668_1000787722 161
14 3300005353 Ga0070669_100525624 Ga0070669_1005256242 161
15 3300005366 Ga0070659_100862008 Ga0070659_1008620082 161
16 3300005457 Ga0070662_100001528 Ga0070662_1000015288 161
17 3300005458 Ga0070681_10304875 Ga0070681_103048752 161
18 3300005530 Ga0070679_100091875 Ga0070679_1000918753 161
19 3300005548 Ga0070665_100310719 Ga0070665_1003107192 161
20 3300009093 Ga0105240_10023003 Ga0105240_100230033 161
21 3300009177 Ga0105248_10232476 Ga0105248_102324762 161
22 3300013100 Ga0157373_10003521 Ga0157373_1000352110 161
23 3300013105 Ga0157369_10020246 Ga0157369_100202466 161
24 3300014326 Ga0157380_10104065 Ga0157380_101040654 161
25 3300025893 Ga0207682_10329151 Ga0207682_103291512 161
26 3300025913 Ga0207695_10018286 Ga0207695_100182868 161
27 3300025921 Ga0207652_10064277 Ga0207652_100642773 161
28 3300025923 Ga0207681_10330869 Ga0207681_103308692 161
29 3300025932 Ga0207690_10756158 Ga0207690_107561582 161
30 3300025933 Ga0207706_10002422 Ga0207706_1000242212 161
31 3300025972 Ga0207668_10110957 Ga0207668_101109573 161
32 3300025981 Ga0207640_10003418 Ga0207640_100034186 161
33 3300026041 Ga0207639_10070294 Ga0207639_100702943 161
34 3300028379 Ga0268266_10226630 Ga0268266_102266302 161
35 3300031911 Ga0307412_10979349 Ga0307412_109793492 161
36 3300032002 Ga0307416_100283559 Ga0307416_1002835592 161
37 3300032126 Ga0307415_100160374 Ga0307415_1001603742 161
38 3300037466 Ga0395898_0056692 Ga0395898_0056692_747_1232 161
39 3300037471 Ga0395905_0026680 Ga0395905_0026680_1406_1891 161
40 3300038443 Ga0395901_0011906 Ga0395901_0011906_2664_3149 161
41 3300039447 Ga0436361_0580849 Ga0436361_0580849_327_869 161
42 3300044684 Ga0466966_0001337 Ga0466966_0001337_11721_12209 161
43 3300046500 Ga0495596_0045487 Ga0495596_0045487_103_591 161
44 3300046525 Ga0495663_0083488 Ga0495663_0083488_93_581 161
45 3300046537 Ga0495598_0013638 Ga0495598_0013638_544_1032 161
46 3300046539 Ga0495621_0001565 Ga0495621_0001565_1685_2173 161
47 3300046558 Ga0495633_0039310 Ga0495633_0039310_1416_1904 161
48 3300046664 Ga0495659_0010552 Ga0495659_0010552_1792_2280 161
49 3300046691 Ga0495670_0007711 Ga0495670_0007711_4495_4983 161
50 3300048918 Ga0496115_0429820 Ga0496115_0429820_493_1029 161
51 3300001904 JGI24736J21556_1035193 JGI24736J21556_10351931 162
52 3300001979 JGI24740J21852_10082444 JGI24740J21852_100824441 162
53 3300001990 JGI24737J22298_10018373 JGI24737J22298_100183732 162
54 3300002067 JGI24735J21928_10007951 JGI24735J21928_100079514 162
55 3300002076 JGI24749J21850_1022072 JGI24749J21850_10220722 162
56 3300002239 JGI24034J26672_10009458 JGI24034J26672_100094582 162
57 3300005293 Ga0065715_10000724 Ga0065715_100007249 162
58 3300005327 Ga0070658_10135521 Ga0070658_101355212 162
59 3300005327 Ga0070658_10295647 Ga0070658_102956471 162
60 3300005327 Ga0070658_10528128 Ga0070658_105281282 162
61 3300005329 Ga0070683_100836122 Ga0070683_1008361221 162
62 3300005331 Ga0070670_100001075 Ga0070670_10000107512 162
63 3300005331 Ga0070670_100003439 Ga0070670_1000034399 162
64 3300005331 Ga0070670_100055005 Ga0070670_1000550055 162
65 3300005333 Ga0070677_10000705 Ga0070677_100007054 162
66 3300005335 Ga0070666_10082589 Ga0070666_100825893 162
67 3300005336 Ga0070680_100061186 Ga0070680_1000611862 162
68 3300005336 Ga0070680_100203329 Ga0070680_1002033292 162
69 3300005336 Ga0070680_100478403 Ga0070680_1004784032 162
70 3300005339 Ga0070660_100067208 Ga0070660_1000672082 162
71 3300005339 Ga0070660_100285692 Ga0070660_1002856922 162
72 3300005339 Ga0070660_100635435 Ga0070660_1006354351 162
73 3300005339 Ga0070660_101062951 Ga0070660_1010629511 162
74 3300005344 Ga0070661_100078489 Ga0070661_1000784893 162
75 3300005345 Ga0070692_10006130 Ga0070692_100061302 162
76 3300005347 Ga0070668_100035049 Ga0070668_1000350493 162
77 3300005347 Ga0070668_100576832 Ga0070668_1005768322 162
78 3300005353 Ga0070669_100003409 Ga0070669_1000034095 162
79 3300005354 Ga0070675_100006846 Ga0070675_1000068462 162
80 3300005355 Ga0070671_100051163 Ga0070671_1000511632 162
81 3300005356 Ga0070674_100010543 Ga0070674_1000105438 162
82 3300005364 Ga0070673_100034866 Ga0070673_1000348662 162
83 3300005366 Ga0070659_100060274 Ga0070659_1000602741 162
84 3300005367 Ga0070667_100137672 Ga0070667_1001376722 162
85 3300005438 Ga0070701_10088315 Ga0070701_100883152 162
86 3300005441 Ga0070700_100055816 Ga0070700_1000558163 162
87 3300005455 Ga0070663_100340925 Ga0070663_1003409252 162
88 3300005455 Ga0070663_101366240 Ga0070663_1013662401 162
89 3300005456 Ga0070678_100006580 Ga0070678_1000065806 162
90 3300005457 Ga0070662_100019126 Ga0070662_1000191266 162
91 3300005457 Ga0070662_100240976 Ga0070662_1002409762 162
92 3300005458 Ga0070681_10302567 Ga0070681_103025672 162
93 3300005458 Ga0070681_10503411 Ga0070681_105034112 162
94 3300005459 Ga0068867_100064156 Ga0068867_1000641562 162
95 3300005530 Ga0070679_100205183 Ga0070679_1002051832 162
96 3300005530 Ga0070679_100262730 Ga0070679_1002627303 162
97 3300005539 Ga0068853_100124119 Ga0068853_1001241192 162
98 3300005543 Ga0070672_100005676 Ga0070672_1000056765 162
99 3300005548 Ga0070665_100822401 Ga0070665_1008224012 162
100 3300005548 Ga0070665_101837287 Ga0070665_1018372871 162
101 3300005563 Ga0068855_100473645 Ga0068855_1004736452 162
102 3300005564 Ga0070664_100061185 Ga0070664_1000611854 162
103 3300005578 Ga0068854_100119433 Ga0068854_1001194333 162
104 3300005578 Ga0068854_100264883 Ga0068854_1002648832 162
105 3300005616 Ga0068852_100051429 Ga0068852_1000514292 162
106 3300005617 Ga0068859_100014519 Ga0068859_1000145194 162
107 3300005719 Ga0068861_100004837 Ga0068861_1000048378 162
108 3300005841 Ga0068863_100203058 Ga0068863_1002030582 162
109 3300005842 Ga0068858_100869672 Ga0068858_1008696722 162
110 3300005844 Ga0068862_100135043 Ga0068862_1001350432 162
111 3300006931 Ga0097620_100014519 Ga0097620_1000145197 162
112 3300009094 Ga0111539_10267250 Ga0111539_102672504 162
113 3300009148 Ga0105243_10281670 Ga0105243_102816702 162
114 3300009553 Ga0105249_10157827 Ga0105249_101578273 162
115 3300013100 Ga0157373_10340048 Ga0157373_103400482 162
116 3300013102 Ga0157371_10097703 Ga0157371_100977032 162
117 3300013102 Ga0157371_10416884 Ga0157371_104168842 162
118 3300013105 Ga0157369_10102893 Ga0157369_101028933 162
119 3300013296 Ga0157374_10538032 Ga0157374_105380322 162
120 3300013306 Ga0163162_10383996 Ga0163162_103839962 162
121 3300013307 Ga0157372_12518700 Ga0157372_125187001 162
122 3300014325 Ga0163163_10082591 Ga0163163_100825914 162
123 3300014326 Ga0157380_10001163 Ga0157380_1000116320 162
124 3300017792 Ga0163161_10009743 Ga0163161_100097433 162
125 3300025315 Ga0207697_10008882 Ga0207697_100088822 162
126 3300025893 Ga0207682_10003154 Ga0207682_100031548 162
127 3300025901 Ga0207688_10117503 Ga0207688_101175032 162
128 3300025904 Ga0207647_10000848 Ga0207647_1000084828 162
129 3300025904 Ga0207647_10351267 Ga0207647_103512672 162
130 3300025909 Ga0207705_10057951 Ga0207705_100579512 162
131 3300025909 Ga0207705_10140325 Ga0207705_101403253 162
132 3300025912 Ga0207707_10173424 Ga0207707_101734243 162
133 3300025912 Ga0207707_10246896 Ga0207707_102468962 162
134 3300025917 Ga0207660_10492475 Ga0207660_104924751 162
135 3300025919 Ga0207657_10013974 Ga0207657_100139746 162
136 3300025919 Ga0207657_10225535 Ga0207657_102255353 162
137 3300025919 Ga0207657_10240989 Ga0207657_102409892 162
138 3300025921 Ga0207652_10144292 Ga0207652_101442922 162
139 3300025921 Ga0207652_10473307 Ga0207652_104733072 162
140 3300025923 Ga0207681_10003633 Ga0207681_100036339 162
141 3300025925 Ga0207650_10002357 Ga0207650_100023578 162
142 3300025925 Ga0207650_10049939 Ga0207650_100499393 162
143 3300025925 Ga0207650_10230002 Ga0207650_102300022 162
144 3300025926 Ga0207659_10002277 Ga0207659_100022779 162
145 3300025931 Ga0207644_10141096 Ga0207644_101410962 162
146 3300025932 Ga0207690_10102309 Ga0207690_101023093 162
147 3300025932 Ga0207690_10174708 Ga0207690_101747083 162
148 3300025933 Ga0207706_10001776 Ga0207706_1000177614 162
149 3300025933 Ga0207706_10009419 Ga0207706_100094196 162
150 3300025935 Ga0207709_10097896 Ga0207709_100978963 162
151 3300025940 Ga0207691_10024273 Ga0207691_100242732 162
152 3300025944 Ga0207661_10311270 Ga0207661_103112702 162
153 3300025945 Ga0207679_10102831 Ga0207679_101028314 162
154 3300025949 Ga0207667_10467109 Ga0207667_104671092 162
155 3300025960 Ga0207651_10017718 Ga0207651_100177182 162
156 3300025961 Ga0207712_10041519 Ga0207712_100415192 162
157 3300025972 Ga0207668_10001399 Ga0207668_100013998 162
158 3300025972 Ga0207668_10326348 Ga0207668_103263482 162
159 3300025981 Ga0207640_10053669 Ga0207640_100536692 162
160 3300026067 Ga0207678_10008727 Ga0207678_100087275 162
161 3300026067 Ga0207678_10181976 Ga0207678_101819763 162
162 3300026067 Ga0207678_10801019 Ga0207678_108010191 162
163 3300026075 Ga0207708_10111841 Ga0207708_101118412 162
164 3300026089 Ga0207648_10072221 Ga0207648_100722212 162
165 3300026089 Ga0207648_10197422 Ga0207648_101974223 162
166 3300026095 Ga0207676_10467989 Ga0207676_104679891 162
167 3300026116 Ga0207674_10295080 Ga0207674_102950802 162
168 3300026118 Ga0207675_100003945 Ga0207675_10000394512 162
169 3300026121 Ga0207683_10008377 Ga0207683_100083777 162
170 3300026142 Ga0207698_10016480 Ga0207698_100164803 162
171 3300026142 Ga0207698_10398497 Ga0207698_103984972 162
172 3300027907 Ga0207428_10487573 Ga0207428_104875731 162
173 3300028379 Ga0268266_10415806 Ga0268266_104158062 162
174 3300028379 Ga0268266_10632788 Ga0268266_106327881 162
175 3300028380 Ga0268265_10008180 Ga0268265_100081808 162
176 3300031731 Ga0307405_10346769 Ga0307405_103467692 162
177 3300031824 Ga0307413_10058402 Ga0307413_100584024 162
178 3300031911 Ga0307412_11213228 Ga0307412_112132281 162
179 3300031995 Ga0307409_100737894 Ga0307409_1007378942 162
180 3300032002 Ga0307416_100126467 Ga0307416_1001264672 162
181 3300032004 Ga0307414_10022674 Ga0307414_100226742 162
182 3300032004 Ga0307414_10130704 Ga0307414_101307043 162
183 3300032005 Ga0307411_10033422 Ga0307411_100334225 162
184 3300032126 Ga0307415_100058462 Ga0307415_1000584623 162
185 3300037312 Ga0395899_0018782 Ga0395899_0018782_3779_4267 162
186 3300037312 Ga0395899_0250521 Ga0395899_0250521_567_1055 162
187 3300037418 Ga0395900_0525565 Ga0395900_0525565_276_764 162
188 3300037418 Ga0395900_0782442 Ga0395900_0782442_63_551 162
189 3300037466 Ga0395898_0728105 Ga0395898_0728105_208_696 162
190 3300037471 Ga0395905_0151993 Ga0395905_0151993_599_1090 162
191 3300038443 Ga0395901_0180614 Ga0395901_0180614_971_1459 162
192 3300047445 Ga0495677_0046050 Ga0495677_0046050_412_903 162
193 3300048910 Ga0496107_0108645 Ga0496107_0108645_1509_1997 162
194 3300049570 Ga0501033_0157192 Ga0501033_0157192_480_977 162
195 3300050511 nmdc:mga08y16_187000_c1 nmdc:mga08y16_187000_c1_224_715 162
196 3300001915 JGI24741J21665_1019720 JGI24741J21665_10197202 163
197 3300001979 JGI24740J21852_10040944 JGI24740J21852_100409442 163
198 3300001989 JGI24739J22299_10085242 JGI24739J22299_100852422 163
199 3300001990 JGI24737J22298_10073671 JGI24737J22298_100736712 163
200 3300002067 JGI24735J21928_10010773 JGI24735J21928_100107732 163
201 3300005327 Ga0070658_10138794 Ga0070658_101387942 163
202 3300005336 Ga0070680_100010145 Ga0070680_1000101453 163
203 3300005336 Ga0070680_100381810 Ga0070680_1003818102 163
204 3300005337 Ga0070682_100327637 Ga0070682_1003276372 163
205 3300005338 Ga0068868_100088300 Ga0068868_1000883001 163
206 3300005339 Ga0070660_100051863 Ga0070660_1000518632 163
207 3300005339 Ga0070660_101219995 Ga0070660_1012199951 163
208 3300005341 Ga0070691_10454621 Ga0070691_104546211 163
209 3300005344 Ga0070661_100056132 Ga0070661_1000561323 163
210 3300005364 Ga0070673_100038050 Ga0070673_1000380505 163
211 3300005366 Ga0070659_100059544 Ga0070659_1000595442 163
212 3300005455 Ga0070663_100095827 Ga0070663_1000958273 163
213 3300005457 Ga0070662_100152991 Ga0070662_1001529913 163
214 3300005457 Ga0070662_100477549 Ga0070662_1004775491 163
215 3300005458 Ga0070681_10069647 Ga0070681_100696473 163
216 3300005530 Ga0070679_100033561 Ga0070679_1000335616 163
217 3300005535 Ga0070684_100274879 Ga0070684_1002748792 163
218 3300005535 Ga0070684_101284704 Ga0070684_1012847041 163
219 3300005539 Ga0068853_100235623 Ga0068853_1002356233 163
220 3300005539 Ga0068853_100383723 Ga0068853_1003837232 163
221 3300005563 Ga0068855_101277420 Ga0068855_1012774202 163
222 3300005564 Ga0070664_100119688 Ga0070664_1001196883 163
223 3300005564 Ga0070664_100194348 Ga0070664_1001943483 163
224 3300005564 Ga0070664_100560586 Ga0070664_1005605862 163
225 3300005577 Ga0068857_100160563 Ga0068857_1001605631 163
226 3300005578 Ga0068854_100176768 Ga0068854_1001767682 163
227 3300005578 Ga0068854_100552740 Ga0068854_1005527402 163
228 3300005614 Ga0068856_100290455 Ga0068856_1002904551 163
229 3300005616 Ga0068852_100013294 Ga0068852_1000132948 163
230 3300005834 Ga0068851_10159714 Ga0068851_101597142 163
231 3300006237 Ga0097621_100495776 Ga0097621_1004957762 163
232 3300009174 Ga0105241_10424314 Ga0105241_104243142 163
233 3300009551 Ga0105238_10374635 Ga0105238_103746353 163
234 3300013100 Ga0157373_10081951 Ga0157373_100819512 163
235 3300013100 Ga0157373_10162755 Ga0157373_101627552 163
236 3300013102 Ga0157371_10065105 Ga0157371_100651053 163
237 3300013102 Ga0157371_10236991 Ga0157371_102369912 163
238 3300013104 Ga0157370_10261661 Ga0157370_102616613 163
239 3300013104 Ga0157370_10393871 Ga0157370_103938712 163
240 3300013105 Ga0157369_10005483 Ga0157369_100054834 163
241 3300013105 Ga0157369_10068610 Ga0157369_100686103 163
242 3300013105 Ga0157369_10217589 Ga0157369_102175892 163
243 3300013297 Ga0157378_10837975 Ga0157378_108379752 163
244 3300013307 Ga0157372_10182330 Ga0157372_101823302 163
245 3300013307 Ga0157372_10202554 Ga0157372_102025544 163
246 3300025904 Ga0207647_10019937 Ga0207647_100199374 163
247 3300025909 Ga0207705_10092403 Ga0207705_100924033 163
248 3300025909 Ga0207705_10185314 Ga0207705_101853142 163
249 3300025909 Ga0207705_11095867 Ga0207705_110958671 163
250 3300025911 Ga0207654_10155086 Ga0207654_101550862 163
251 3300025912 Ga0207707_10401112 Ga0207707_104011122 163
252 3300025917 Ga0207660_10617513 Ga0207660_106175132 163
253 3300025919 Ga0207657_10008341 Ga0207657_100083412 163
254 3300025919 Ga0207657_10073222 Ga0207657_100732223 163
255 3300025919 Ga0207657_10085802 Ga0207657_100858023 163
256 3300025919 Ga0207657_11206075 Ga0207657_112060751 163
257 3300025920 Ga0207649_10388117 Ga0207649_103881172 163
258 3300025921 Ga0207652_10578512 Ga0207652_105785122 163
259 3300025924 Ga0207694_10365311 Ga0207694_103653112 163
260 3300025932 Ga0207690_10067960 Ga0207690_100679603 163
261 3300025932 Ga0207690_10479921 Ga0207690_104799212 163
262 3300025933 Ga0207706_10111158 Ga0207706_101111582 163
263 3300025949 Ga0207667_10713898 Ga0207667_107138982 163
264 3300026041 Ga0207639_10445859 Ga0207639_104458592 163
265 3300026067 Ga0207678_10076194 Ga0207678_100761945 163
266 3300026078 Ga0207702_11833888 Ga0207702_118338882 163
267 3300026116 Ga0207674_10063538 Ga0207674_100635384 163
268 3300026142 Ga0207698_10083226 Ga0207698_100832263 163
269 3300027876 Ga0209974_10030433 Ga0209974_100304332 163
270 3300031548 Ga0307408_100018443 Ga0307408_1000184432 163
271 3300031824 Ga0307413_10158299 Ga0307413_101582992 163
272 3300031852 Ga0307410_10014471 Ga0307410_100144714 163
273 3300031903 Ga0307407_10011510 Ga0307407_100115105 163
274 3300031911 Ga0307412_10612831 Ga0307412_106128312 163
275 3300032002 Ga0307416_100006877 Ga0307416_1000068776 163
276 3300032002 Ga0307416_102348288 Ga0307416_1023482882 163
277 3300032004 Ga0307414_10361270 Ga0307414_103612702 163
278 3300032126 Ga0307415_100031294 Ga0307415_1000312942 163
279 3300035692 Ga0373935_0011883 Ga0373935_0011883_2720_3211 163
280 3300035695 Ga0373927_0618172 Ga0373927_0618172_102_593 163
281 3300037312 Ga0395899_0158379 Ga0395899_0158379_452_949 163
282 3300037312 Ga0395899_0401583 Ga0395899_0401583_74_565 163
283 3300037418 Ga0395900_0000764 Ga0395900_0000764_33010_33507 163
284 3300037418 Ga0395900_0020505 Ga0395900_0020505_1020_1511 163
285 3300037418 Ga0395900_0237976 Ga0395900_0237976_212_703 163
286 3300037466 Ga0395898_0081863 Ga0395898_0081863_1699_2196 163
287 3300037471 Ga0395905_0003045 Ga0395905_0003045_9759_10256 163
288 3300037471 Ga0395905_0021583 Ga0395905_0021583_15_506 163
289 3300037471 Ga0395905_0026966 Ga0395905_0026966_4604_5095 163
290 3300037471 Ga0395905_0119628 Ga0395905_0119628_43_534 163
291 3300037471 Ga0395905_0201402 Ga0395905_0201402_1256_1747 163
292 3300037471 Ga0395905_0228802 Ga0395905_0228802_111_605 163
293 3300037471 Ga0395905_0422179 Ga0395905_0422179_445_936 163
294 3300038443 Ga0395901_0009829 Ga0395901_0009829_1617_2114 163
295 3300038443 Ga0395901_0167230 Ga0395901_0167230_1731_2222 163
296 3300038443 Ga0395901_0557676 Ga0395901_0557676_146_637 163
297 3300042005 Ga0439448_0002960 Ga0439448_0002960_2299_2790 163
298 3300044694 Ga0466963_0277001 Ga0466963_0277001_362_853 163
299 3300048913 Ga0496110_0489587 Ga0496110_0489587_163_654 163
300 3300048917 Ga0496114_0000206 Ga0496114_0000206_36252_36743 163
301 3300049663 Ga0501223_004150 Ga0501223_004150_190_684 163
302 3300049668 Ga0501233_024940 Ga0501233_024940_146_640 163
303 3300049677 Ga0501247_006394 Ga0501247_006394_180_674 163
304 3300049705 Ga0501225_0022235 Ga0501225_0022235_765_1259 163
305 3300049764 Ga0501267_008201 Ga0501267_008201_144_638 163
306 3300049765 Ga0501268_008723 Ga0501268_008723_729_1223 163
307 3300049775 Ga0501279_012735 Ga0501279_012735_641_1132 163
308 3300049779 Ga0501283_035633 Ga0501283_035633_224_715 163
309 iso_pu_bacteria 2928027323 2928028486 163
310 iso_pu_bacteria 2984555340 2984555938 163
311 iso_pu_bacteria 2984564862 2984565956 163
312 iso_pu_bacteria 2993356040 2993356965 163
313 3300005330 Ga0070690_100026517 Ga0070690_1000265174 164
314 3300009148 Ga0105243_10181415 Ga0105243_101814153 164
315 3300037418 Ga0395900_0019021 Ga0395900_0019021_18_575 164
316 3300037471 Ga0395905_1430114 Ga0395905_1430114_21_527 164
317 3300037853 Ga0436364_0783469 Ga0436364_0783469_13_525 164
318 3300037853 Ga0436364_1376076 Ga0436364_1376076_90_668 164
319 3300039453 Ga0436362_0386479 Ga0436362_0386479_67_579 164
320 iso_pu_bacteria 2599185354 2600202973 164
321 iso_pu_bacteria 2990265787 2990265889 164
322 3300005331 Ga0070670_100273307 Ga0070670_1002733073 165
323 3300005337 Ga0070682_100675763 Ga0070682_1006757631 165
324 3300005339 Ga0070660_100757531 Ga0070660_1007575311 165
325 3300009174 Ga0105241_10008572 Ga0105241_100085726 165
326 3300031852 Ga0307410_10002493 Ga0307410_100024935 165
327 3300031901 Ga0307406_10281262 Ga0307406_102812622 165
328 3300031903 Ga0307407_10084793 Ga0307407_100847932 165
329 3300031995 Ga0307409_100001956 Ga0307409_1000019566 165
330 3300032002 Ga0307416_100067191 Ga0307416_1000671914 165
331 3300032004 Ga0307414_10005096 Ga0307414_100050965 165
332 3300032005 Ga0307411_10003049 Ga0307411_100030497 165
333 3300049587 Ga0501071_0239731 Ga0501071_0239731_805_1302 165
334 iso_pu_bacteria 2687453257 2688066608 165
335 iso_pu_bacteria 2889415604 2889416005 165
336 3300005327 Ga0070658_10779209 Ga0070658_107792092 166
337 3300005344 Ga0070661_100000014 Ga0070661_10000001491 166
338 3300005353 Ga0070669_100390569 Ga0070669_1003905691 166
339 3300005355 Ga0070671_100462840 Ga0070671_1004628401 166
340 3300005458 Ga0070681_10125533 Ga0070681_101255333 166
341 3300005467 Ga0070706_100618422 Ga0070706_1006184222 166
342 3300005530 Ga0070679_100000003 Ga0070679_100000003264 166
343 3300005530 Ga0070679_101170360 Ga0070679_1011703601 166
344 3300005530 Ga0070679_101188883 Ga0070679_1011888832 166
345 3300005544 Ga0070686_101055559 Ga0070686_1010555591 166
346 3300005577 Ga0068857_100067854 Ga0068857_1000678542 166
347 3300005577 Ga0068857_100102670 Ga0068857_1001026702 166
348 3300005578 Ga0068854_100182268 Ga0068854_1001822682 166
349 3300005618 Ga0068864_100012174 Ga0068864_1000121747 166
350 3300005841 Ga0068863_100009700 Ga0068863_1000097008 166
351 3300005843 Ga0068860_100579424 Ga0068860_1005794242 166
352 3300006195 Ga0075366_10017242 Ga0075366_100172422 166
353 3300006353 Ga0075370_10100655 Ga0075370_101006552 166
354 3300009101 Ga0105247_10618861 Ga0105247_106188612 166
355 3300009553 Ga0105249_11754747 Ga0105249_117547471 166
356 3300013105 Ga0157369_10008669 Ga0157369_100086696 166
357 3300014968 Ga0157379_10308399 Ga0157379_103083992 166
358 3300021358 Ga0213873_10000007 Ga0213873_10000007257 166
359 3300021358 Ga0213873_10027588 Ga0213873_100275882 166
360 3300021361 Ga0213872_10126432 Ga0213872_101264322 166
361 3300021384 Ga0213876_10000005 Ga0213876_10000005293 166
362 3300021441 Ga0213871_10003839 Ga0213871_100038393 166
363 3300025223 Ga0207672_1005086 Ga0207672_10050861 166
364 3300025909 Ga0207705_10103351 Ga0207705_101033513 166
365 3300025909 Ga0207705_10131355 Ga0207705_101313552 166
366 3300025909 Ga0207705_10246306 Ga0207705_102463062 166
367 3300025910 Ga0207684_10215440 Ga0207684_102154402 166
368 3300025912 Ga0207707_10106419 Ga0207707_101064192 166
369 3300025917 Ga0207660_10002430 Ga0207660_100024306 166
370 3300025920 Ga0207649_10000393 Ga0207649_1000039310 166
371 3300025921 Ga0207652_10000004 Ga0207652_10000004265 166
372 3300025923 Ga0207681_10067961 Ga0207681_100679614 166
373 3300026041 Ga0207639_10908420 Ga0207639_109084202 166
374 3300026088 Ga0207641_10000277 Ga0207641_1000027721 166
375 3300026095 Ga0207676_10000600 Ga0207676_1000060018 166
376 3300026116 Ga0207674_10048226 Ga0207674_100482263 166
377 3300026118 Ga0207675_100423211 Ga0207675_1004232112 166
378 3300028381 Ga0268264_10516537 Ga0268264_105165372 166
379 3300031731 Ga0307405_10942180 Ga0307405_109421802 166
380 3300031901 Ga0307406_10412255 Ga0307406_104122552 166
381 3300031901 Ga0307406_10663458 Ga0307406_106634581 166
382 3300032004 Ga0307414_10268528 Ga0307414_102685282 166
383 3300032004 Ga0307414_10369404 Ga0307414_103694042 166
384 3300037471 Ga0395905_0061435 Ga0395905_0061435_261_761 166
385 3300037853 Ga0436364_1549875 Ga0436364_1549875_747_1268 166
386 3300038443 Ga0395901_0008085 Ga0395901_0008085_5696_6196 166
387 3300038443 Ga0395901_0573348 Ga0395901_0573348_47_547 166
388 3300039437 Ga0436365_0176211 Ga0436365_0176211_7274_7774 166
389 3300039438 Ga0436360_1357732 Ga0436360_1357732_1933_2460 166
390 3300039447 Ga0436361_1102360 Ga0436361_1102360_1677_2204 166
391 3300039453 Ga0436362_0945445 Ga0436362_0945445_1854_2381 166
392 3300039453 Ga0436362_0976836 Ga0436362_0976836_85160_85660 166
393 3300046513 Ga0495616_0000182 Ga0495616_0000182_49430_49930 166
394 3300049513 Ga0501290_006651 Ga0501290_006651_419_919 166
395 3300049570 Ga0501033_0392407 Ga0501033_0392407_213_800 166
396 3300049571 Ga0501034_0344439 Ga0501034_0344439_693_1280 166
397 3300049573 Ga0501037_0484270 Ga0501037_0484270_95_682 166
398 3300049581 Ga0501047_0235519 Ga0501047_0235519_186_773 166
399 3300049586 Ga0501070_0152544 Ga0501070_0152544_11_598 166
400 3300049663 Ga0501223_016865 Ga0501223_016865_112_612 166
401 3300049665 Ga0501227_015092 Ga0501227_015092_143_643 166
402 3300049686 Ga0501257_000073 Ga0501257_000073_3986_4486 166
403 3300049774 Ga0501278_016981 Ga0501278_016981_65_565 166
404 3300049776 Ga0501280_005610 Ga0501280_005610_749_1249 166
405 3300049823 Ga0501044_0225587 Ga0501044_0225587_1054_1641 166
406 3300049823 Ga0501044_0267643 Ga0501044_0267643_1099_1620 166
407 3300049823 Ga0501044_0484226 Ga0501044_0484226_212_757 166
408 3300049823 Ga0501044_1284043 Ga0501044_1284043_86_586 166
409 3300050493 nmdc:mga0k408_202812_c1 nmdc:mga0k408_202812_c1_89_589 166
410 3300050496 nmdc:mga07m45_152791_c1 nmdc:mga07m45_152791_c1_336_836 166
411 3300053087 Ga0500643_000136 Ga0500643_000136_44426_44926 166
412 iso_pu_bacteria 2775507255 2778126027 166
413 iso_pu_bacteria 2808606401 2809062871 166
414 iso_pu_bacteria 2808606404 2809078835 166
415 iso_pu_bacteria 2808606405 2809085895 166
416 iso_pu_bacteria 2880518877 2880520150 166
417 iso_pu_bacteria 2919709256 2919710480 166
418 3300005366 Ga0070659_100544125 Ga0070659_1005441252 167
419 3300013306 Ga0163162_10363831 Ga0163162_103638312 167
420 3300014325 Ga0163163_10151215 Ga0163163_101512154 167
421 3300031903 Ga0307407_10321260 Ga0307407_103212602 167
422 3300031911 Ga0307412_10057889 Ga0307412_100578893 167
423 3300039450 Ga0436363_0689652 Ga0436363_0689652_80_583 167
424 3300039450 Ga0436363_1450113 Ga0436363_1450113_36_539 167
425 3300001976 JGI24752J21851_1001534 JGI24752J21851_10015342 168
426 3300003214 JGI25165J46597_1000024 JGI25165J46597_100002432 168
427 3300004625 Ga0055543_1035427 Ga0055543_10354272 168
428 3300005331 Ga0070670_100000964 Ga0070670_1000009647 168
429 3300005334 Ga0068869_100501048 Ga0068869_1005010481 168
430 3300005335 Ga0070666_10000089 Ga0070666_1000008942 168
431 3300005335 Ga0070666_10111826 Ga0070666_101118262 168
432 3300005347 Ga0070668_100000014 Ga0070668_10000001441 168
433 3300005347 Ga0070668_100137456 Ga0070668_1001374562 168
434 3300005353 Ga0070669_100000024 Ga0070669_100000024138 168
435 3300005353 Ga0070669_100018244 Ga0070669_1000182445 168
436 3300005355 Ga0070671_100000006 Ga0070671_100000006114 168
437 3300005367 Ga0070667_100000051 Ga0070667_10000005191 168
438 3300005367 Ga0070667_100056171 Ga0070667_1000561715 168
439 3300005445 Ga0070708_100039593 Ga0070708_1000395933 168
440 3300005548 Ga0070665_100000471 Ga0070665_10000047121 168
441 3300005548 Ga0070665_100095368 Ga0070665_1000953684 168
442 3300005577 Ga0068857_100693885 Ga0068857_1006938852 168
443 3300005578 Ga0068854_100228496 Ga0068854_1002284962 168
444 3300005617 Ga0068859_100000256 Ga0068859_10000025628 168
445 3300005618 Ga0068864_100001091 Ga0068864_1000010912 168
446 3300005618 Ga0068864_100001437 Ga0068864_1000014377 168
447 3300005719 Ga0068861_100000799 Ga0068861_10000079913 168
448 3300005841 Ga0068863_100000028 Ga0068863_100000028121 168
449 3300005841 Ga0068863_100005179 Ga0068863_1000051795 168
450 3300005842 Ga0068858_100000181 Ga0068858_10000018146 168
451 3300005842 Ga0068858_100004139 Ga0068858_1000041397 168
452 3300005842 Ga0068858_100047175 Ga0068858_1000471753 168
453 3300005843 Ga0068860_100005743 Ga0068860_1000057437 168
454 3300005843 Ga0068860_100041662 Ga0068860_1000416625 168
455 3300005844 Ga0068862_100000310 Ga0068862_10000031023 168
456 3300005844 Ga0068862_100190712 Ga0068862_1001907121 168
457 3300006931 Ga0097620_100000256 Ga0097620_10000025628 168
458 3300009011 Ga0105251_10023016 Ga0105251_100230165 168
459 3300009098 Ga0105245_10000853 Ga0105245_1000085323 168
460 3300009101 Ga0105247_10000644 Ga0105247_1000064428 168
461 3300009148 Ga0105243_10063765 Ga0105243_100637653 168
462 3300009177 Ga0105248_10020230 Ga0105248_100202307 168
463 3300009553 Ga0105249_10004911 Ga0105249_1000491114 168
464 3300013296 Ga0157374_10113648 Ga0157374_101136484 168
465 3300013297 Ga0157378_10040072 Ga0157378_100400725 168
466 3300013297 Ga0157378_10081723 Ga0157378_100817232 168
467 3300013306 Ga0163162_10035439 Ga0163162_100354395 168
468 3300013306 Ga0163162_10041138 Ga0163162_100411383 168
469 3300014325 Ga0163163_10080992 Ga0163163_100809924 168
470 3300014968 Ga0157379_10081986 Ga0157379_100819864 168
471 3300015690 Ga0183363_1007 Ga0183363_100768 168
472 3300025233 Ga0209437_101961 Ga0209437_1019613 168
473 3300025254 Ga0209148_1026487 Ga0209148_10264872 168
474 3300025261 Ga0209233_1000084 Ga0209233_1000084278 168
475 3300025315 Ga0207697_10000419 Ga0207697_100004197 168
476 3300025315 Ga0207697_10066668 Ga0207697_100666682 168
477 3300025900 Ga0207710_10000700 Ga0207710_1000070013 168
478 3300025903 Ga0207680_10000481 Ga0207680_1000048113 168
479 3300025903 Ga0207680_10052317 Ga0207680_100523173 168
480 3300025923 Ga0207681_10000004 Ga0207681_10000004312 168
481 3300025923 Ga0207681_10127025 Ga0207681_101270252 168
482 3300025925 Ga0207650_10003090 Ga0207650_100030906 168
483 3300025927 Ga0207687_10003237 Ga0207687_100032376 168
484 3300025931 Ga0207644_10000009 Ga0207644_10000009136 168
485 3300025935 Ga0207709_10045384 Ga0207709_100453844 168
486 3300025941 Ga0207711_10011481 Ga0207711_100114815 168
487 3300025961 Ga0207712_10019312 Ga0207712_100193122 168
488 3300025972 Ga0207668_10000047 Ga0207668_1000004778 168
489 3300025972 Ga0207668_10154373 Ga0207668_101543732 168
490 3300025986 Ga0207658_10000057 Ga0207658_1000005792 168
491 3300025986 Ga0207658_10002888 Ga0207658_100028886 168
492 3300026035 Ga0207703_10000135 Ga0207703_1000013518 168
493 3300026035 Ga0207703_10006420 Ga0207703_1000642013 168
494 3300026078 Ga0207702_10658268 Ga0207702_106582682 168
495 3300026088 Ga0207641_10000014 Ga0207641_10000014267 168
496 3300026088 Ga0207641_10016289 Ga0207641_100162896 168
497 3300026095 Ga0207676_10000532 Ga0207676_1000053220 168
498 3300026095 Ga0207676_10001074 Ga0207676_100010742 168
499 3300026118 Ga0207675_100000740 Ga0207675_10000074011 168
500 3300028379 Ga0268266_10000002 Ga0268266_100000021001 168
501 3300028379 Ga0268266_10193219 Ga0268266_101932192 168
502 3300028380 Ga0268265_10001269 Ga0268265_1000126912 168
503 3300028380 Ga0268265_10160681 Ga0268265_101606812 168
504 3300028381 Ga0268264_10000069 Ga0268264_10000069110 168
505 3300028381 Ga0268264_10004744 Ga0268264_100047445 168
506 3300031456 Ga0307513_10030103 Ga0307513_100301036 168
507 3300031616 Ga0307508_10001350 Ga0307508_1000135023 168
508 3300032004 Ga0307414_11249543 Ga0307414_112495432 168
509 3300036401 Ga0373937_0300059 Ga0373937_0300059_793_1299 168
510 3300039437 Ga0436365_0862951 Ga0436365_0862951_398_904 168
511 3300046492 Ga0495585_0280224 Ga0495585_0280224_243_749 168
512 3300046524 Ga0495648_0004271 Ga0495648_0004271_2476_2982 168
513 3300046660 Ga0495625_0000107 Ga0495625_0000107_4658_5164 168
514 3300047472 Ga0495686_0000513 Ga0495686_0000513_28085_28591 168
515 3300047472 Ga0495686_0032568 Ga0495686_0032568_2359_2865 168
516 3300048905 Ga0496102_0702575 Ga0496102_0702575_105_611 168
517 3300048906 Ga0496103_0504660 Ga0496103_0504660_78_590 168
518 3300048908 Ga0496105_0325649 Ga0496105_0325649_238_744 168
519 3300048924 Ga0496121_0000189 Ga0496121_0000189_11785_12291 168
520 3300048924 Ga0496121_0035146 Ga0496121_0035146_2934_3440 168
521 3300048927 Ga0496124_0196213 Ga0496124_0196213_776_1282 168
522 3300049580 Ga0501046_0106566 Ga0501046_0106566_93_599 168
523 3300049823 Ga0501044_0653431 Ga0501044_0653431_11_517 168
524 3300053087 Ga0500643_001250 Ga0500643_001250_11497_12003 168
525 3300053087 Ga0500643_037629 Ga0500643_037629_22_534 168
526 3300053119 Ga0500595_001051 Ga0500595_001051_12443_12949 168
527 3300053140 Ga0500573_0000021 Ga0500573_0000021_146435_146941 168
528 3300053153 Ga0500616_0199798 Ga0500616_0199798_14_520 168
529 3300053157 Ga0500624_000930 Ga0500624_000930_4158_4670 168
530 3300053177 Ga0500636_0102937 Ga0500636_0102937_905_1417 168
531 3300053730 Ga0500645_003386 Ga0500645_003386_5384_5890 168
532 iso_pu_bacteria 2512564014 2512643921 168
533 2162886007 SwRhRL2b_contig_3731301 SwRhRL2b_0633.00000600 169
534 3300002774 JGI25150J39212_1000711 JGI25150J39212_10007115 169
535 3300003187 JGI25151J46595_10023430 JGI25151J46595_100234302 169
536 3300003215 JGI25153J46596_10000186 JGI25153J46596_1000018629 169
537 3300003771 Ga0055526_1000503 Ga0055526_10005031 169
538 3300003781 Ga0055536_1026934 Ga0055536_10269342 169
539 3300003792 Ga0055540_1003332 Ga0055540_100333210 169
540 3300003792 Ga0055540_1006395 Ga0055540_10063955 169
541 3300005289 Ga0065704_10001990 Ga0065704_1000199010 169
542 3300005289 Ga0065704_10190368 Ga0065704_101903682 169
543 3300005353 Ga0070669_100068114 Ga0070669_1000681143 169
544 3300005539 Ga0068853_100005871 Ga0068853_1000058717 169
545 3300005539 Ga0068853_100024335 Ga0068853_1000243355 169
546 3300005577 Ga0068857_100005612 Ga0068857_1000056128 169
547 3300005616 Ga0068852_100364779 Ga0068852_1003647792 169
548 3300005834 Ga0068851_10019383 Ga0068851_100193834 169
549 3300009011 Ga0105251_10107027 Ga0105251_101070272 169
550 3300009092 Ga0105250_10285979 Ga0105250_102859791 169
551 3300009978 Ga0105148_100460 Ga0105148_1004603 169
552 3300013100 Ga0157373_10164707 Ga0157373_101647071 169
553 3300013102 Ga0157371_10102209 Ga0157371_101022093 169
554 3300014497 Ga0182008_10288782 Ga0182008_102887822 169
555 3300017792 Ga0163161_10034019 Ga0163161_100340194 169
556 3300025245 Ga0207425_1000049 Ga0207425_100004960 169
557 3300025258 Ga0209129_1004041 Ga0209129_10040413 169
558 3300025263 Ga0209565_1000170 Ga0209565_100017072 169
559 3300025273 Ga0209673_1006861 Ga0209673_10068614 169
560 3300025292 Ga0209676_1004023 Ga0209676_10040238 169
561 3300025294 Ga0209025_1000068 Ga0209025_100006832 169
562 3300025295 Ga0209564_1000733 Ga0209564_100073340 169
563 3300025297 Ga0209758_1000019 Ga0209758_1000019646 169
564 3300025298 Ga0209050_1000001 Ga0209050_10000011861 169
565 3300025298 Ga0209050_1000108 Ga0209050_1000108149 169
566 3300025298 Ga0209050_1034129 Ga0209050_10341292 169
567 3300025303 Ga0209051_1000239 Ga0209051_100023961 169
568 3300025304 Ga0209257_1001303 Ga0209257_100130310 169
569 3300025304 Ga0209257_1001609 Ga0209257_100160910 169
570 3300025321 Ga0207656_10014744 Ga0207656_100147444 169
571 3300025735 Ga0207713_1078990 Ga0207713_10789902 169
572 3300025923 Ga0207681_10057830 Ga0207681_100578303 169
573 3300025924 Ga0207694_10141633 Ga0207694_101416331 169
574 3300025949 Ga0207667_10181620 Ga0207667_101816201 169
575 3300026041 Ga0207639_10017444 Ga0207639_100174442 169
576 3300026041 Ga0207639_10057207 Ga0207639_100572072 169
577 3300026116 Ga0207674_10022118 Ga0207674_100221185 169
578 3300026142 Ga0207698_10176048 Ga0207698_101760483 169
579 3300031548 Ga0307408_100008912 Ga0307408_1000089127 169
580 3300046453 Ga0495627_088423 Ga0495627_088423_120_629 169
581 3300046460 Ga0495638_0055240 Ga0495638_0055240_43_567 169
582 3300046460 Ga0495638_0247843 Ga0495638_0247843_96_605 169
583 3300046491 Ga0495584_0322376 Ga0495584_0322376_256_765 169
584 3300046492 Ga0495585_0182581 Ga0495585_0182581_455_976 169
585 3300046519 Ga0495632_0001056 Ga0495632_0001056_20290_20799 169
586 3300046520 Ga0495637_0018088 Ga0495637_0018088_862_1371 169
587 3300046522 Ga0495643_0000146 Ga0495643_0000146_63518_64027 169
588 3300046524 Ga0495648_0113632 Ga0495648_0113632_80_589 169
589 3300046525 Ga0495663_0000006 Ga0495663_0000006_170647_171156 169
590 3300046558 Ga0495633_0000192 Ga0495633_0000192_329_838 169
591 3300046558 Ga0495633_0001161 Ga0495633_0001161_532_1041 169
592 3300046558 Ga0495633_0020434 Ga0495633_0020434_27_536 169
593 3300046616 Ga0495668_0016769 Ga0495668_0016769_3143_3652 169
594 3300046692 Ga0495671_0000100 Ga0495671_0000100_58136_58645 169
595 3300047470 Ga0495681_0034366 Ga0495681_0034366_701_1210 169
596 3300047472 Ga0495686_0047524 Ga0495686_0047524_432_941 169
597 3300048905 Ga0496102_0631815 Ga0496102_0631815_126_635 169
598 3300048913 Ga0496110_0045756 Ga0496110_0045756_2157_2666 169
599 3300048918 Ga0496115_0001013 Ga0496115_0001013_2738_3247 169
600 3300048925 Ga0496122_0125665 Ga0496122_0125665_725_1234 169
601 3300048926 Ga0496123_0019732 Ga0496123_0019732_2620_3129 169
602 3300048927 Ga0496124_0060805 Ga0496124_0060805_2549_3058 169
603 3300048928 Ga0496125_0009585 Ga0496125_0009585_1704_2213 169
604 3300048929 Ga0496126_0829352 Ga0496126_0829352_123_635 169
605 3300049571 Ga0501034_0020877 Ga0501034_0020877_5052_5567 169
606 3300049649 Ga0501198_020873 Ga0501198_020873_299_814 169
607 3300049658 Ga0501211_013375 Ga0501211_013375_108_617 169
608 3300049663 Ga0501223_006069 Ga0501223_006069_1187_1702 169
609 3300049664 Ga0501224_000001 Ga0501224_000001_241418_241933 169
610 3300049669 Ga0501235_012396 Ga0501235_012396_906_1421 169
611 3300049675 Ga0501243_040218 Ga0501243_040218_189_698 169
612 3300049705 Ga0501225_0001326 Ga0501225_0001326_6708_7223 169
613 3300049853 Ga0501226_000047 Ga0501226_000047_6077_6592 169
614 3300053140 Ga0500573_0110159 Ga0500573_0110159_668_1177 169
615 3300053151 Ga0500604_0004006 Ga0500604_0004006_510_1019 169
616 3300053157 Ga0500624_000015 Ga0500624_000015_121552_122061 169
617 3300053158 Ga0500627_0000774 Ga0500627_0000774_2483_2992 169
618 2162886007 SwRhRL2b_contig_158587 SwRhRL2b_0927.00012210 170
619 3300001979 JGI24740J21852_10000581 JGI24740J21852_1000058112 170
620 3300001989 JGI24739J22299_10000556 JGI24739J22299_100005568 170
621 3300001990 JGI24737J22298_10004950 JGI24737J22298_100049505 170
622 3300002075 JGI24738J21930_10002503 JGI24738J21930_100025037 170
623 3300005289 Ga0065704_10004250 Ga0065704_100042507 170
624 3300005327 Ga0070658_10022607 Ga0070658_100226073 170
625 3300005347 Ga0070668_100050210 Ga0070668_1000502103 170
626 3300005355 Ga0070671_100031481 Ga0070671_1000314814 170
627 3300005455 Ga0070663_100013235 Ga0070663_1000132356 170
628 3300005563 Ga0068855_100055176 Ga0068855_1000551766 170
629 3300005577 Ga0068857_101286437 Ga0068857_1012864371 170
630 3300005577 Ga0068857_101286438 Ga0068857_1012864381 170
631 3300005614 Ga0068856_100011736 Ga0068856_1000117369 170
632 3300005618 Ga0068864_100012452 Ga0068864_1000124529 170
633 3300006042 Ga0075368_10000166 Ga0075368_100001663 170
634 3300006048 Ga0075363_100154936 Ga0075363_1001549362 170
635 3300006178 Ga0075367_10000165 Ga0075367_1000016517 170
636 3300009545 Ga0105237_10008645 Ga0105237_1000864510 170
637 3300009551 Ga0105238_11127583 Ga0105238_111275832 170
638 3300013100 Ga0157373_10004059 Ga0157373_100040597 170
639 3300013102 Ga0157371_10175356 Ga0157371_101753561 170
640 3300013104 Ga0157370_10053517 Ga0157370_100535173 170
641 3300013307 Ga0157372_11846898 Ga0157372_118468982 170
642 3300025904 Ga0207647_10002965 Ga0207647_100029657 170
643 3300025909 Ga0207705_10372644 Ga0207705_103726442 170
644 3300025911 Ga0207654_10055457 Ga0207654_100554572 170
645 3300025913 Ga0207695_10029118 Ga0207695_100291183 170
646 3300025914 Ga0207671_10012474 Ga0207671_100124745 170
647 3300025919 Ga0207657_10031828 Ga0207657_100318282 170
648 3300025924 Ga0207694_10003601 Ga0207694_100036017 170
649 3300025933 Ga0207706_10053926 Ga0207706_100539263 170
650 3300025945 Ga0207679_10155985 Ga0207679_101559852 170
651 3300025949 Ga0207667_10087995 Ga0207667_100879952 170
652 3300025972 Ga0207668_10062258 Ga0207668_100622583 170
653 3300025981 Ga0207640_10015151 Ga0207640_100151516 170
654 3300026041 Ga0207639_10000323 Ga0207639_100003234 170
655 3300026067 Ga0207678_10000068 Ga0207678_1000006863 170
656 3300026078 Ga0207702_10008576 Ga0207702_100085767 170
657 3300026116 Ga0207674_11407119 Ga0207674_114071192 170
658 3300026116 Ga0207674_11407120 Ga0207674_114071202 170
659 3300026142 Ga0207698_10051137 Ga0207698_100511374 170
660 3300027866 Ga0209813_10000062 Ga0209813_1000006236 170
661 3300031548 Ga0307408_100001959 Ga0307408_10000195911 170
662 3300031731 Ga0307405_10005480 Ga0307405_100054806 170
663 3300031824 Ga0307413_10018804 Ga0307413_100188046 170
664 3300031852 Ga0307410_10006448 Ga0307410_100064486 170
665 3300031911 Ga0307412_10054477 Ga0307412_100544772 170
666 3300031995 Ga0307409_100134104 Ga0307409_1001341042 170
667 3300032002 Ga0307416_100163788 Ga0307416_1001637882 170
668 3300032004 Ga0307414_10182960 Ga0307414_101829602 170
669 3300032005 Ga0307411_10033420 Ga0307411_100334203 170
670 3300046452 Ga0495617_041834 Ga0495617_041834_660_1172 170
671 3300046453 Ga0495627_000584 Ga0495627_000584_25891_26403 170
672 3300046453 Ga0495627_000871 Ga0495627_000871_3917_4435 170
673 3300046512 Ga0495610_0000186 Ga0495610_0000186_56572_57084 170
674 3300046512 Ga0495610_0017207 Ga0495610_0017207_1638_2150 170
675 3300046520 Ga0495637_0020325 Ga0495637_0020325_709_1221 170
676 3300046524 Ga0495648_0217601 Ga0495648_0217601_33_551 170
677 3300047470 Ga0495681_0001332 Ga0495681_0001332_15299_15811 170
678 3300047472 Ga0495686_0087793 Ga0495686_0087793_662_1174 170
679 3300048905 Ga0496102_0562859 Ga0496102_0562859_292_804 170
680 3300048905 Ga0496102_1326051 Ga0496102_1326051_61_579 170
681 3300048911 Ga0496108_0000914 Ga0496108_0000914_9303_9815 170
682 3300048912 Ga0496109_0051693 Ga0496109_0051693_1806_2318 170
683 3300048913 Ga0496110_0057006 Ga0496110_0057006_351_863 170
684 3300048914 Ga0496111_0139718 Ga0496111_0139718_711_1223 170
685 3300048916 Ga0496113_0194112 Ga0496113_0194112_695_1207 170
686 3300048919 Ga0496116_0019717 Ga0496116_0019717_2049_2561 170
687 3300048919 Ga0496116_0047570 Ga0496116_0047570_2171_2689 170
688 3300048920 Ga0496117_0030704 Ga0496117_0030704_1162_1680 170
689 3300048922 Ga0496119_0025551 Ga0496119_0025551_1990_2508 170
690 3300048923 Ga0496120_0146262 Ga0496120_0146262_78_596 170
691 3300048924 Ga0496121_0003303 Ga0496121_0003303_2216_2728 170
692 3300048926 Ga0496123_0070113 Ga0496123_0070113_965_1477 170
693 3300048927 Ga0496124_0029380 Ga0496124_0029380_3434_3952 170
694 3300048927 Ga0496124_0225022 Ga0496124_0225022_391_903 170
695 3300048928 Ga0496125_0035550 Ga0496125_0035550_2831_3343 170
696 3300048928 Ga0496125_0084265 Ga0496125_0084265_1057_1569 170
697 3300048929 Ga0496126_0018985 Ga0496126_0018985_1531_2043 170
698 3300049459 Ga0495678_059497 Ga0495678_059497_491_1003 170
699 3300049663 Ga0501223_000036 Ga0501223_000036_16476_16988 170
700 3300049685 Ga0501256_002042 Ga0501256_002042_445_957 170
701 3300049705 Ga0501225_0000037 Ga0501225_0000037_15966_16478 170
702 3300050490 nmdc:mga03n38_326177_c1 nmdc:mga03n38_326177_c1_31_543 170
703 3300050494 nmdc:mga06z11_36_c1 nmdc:mga06z11_36_c1_29517_30029 170
704 3300050495 nmdc:mga04h51_475_c1 nmdc:mga04h51_475_c1_6453_6965 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

17

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9697 5 161
8i8i-assembly2.cif.gz_C-2 crystal structure of phosphopantetheine adenylyltransferase from klebsiella pneumoniae at 2.59 a resolution 0.9652 4 161
3nba-assembly2.cif.gz_B phosphopantetheine adenylyltranferase from mycobacterium tuberculosis in complex with adenosine-5'-[(alpha,beta)-methyleno]triphosphate (ampcpp) 0.9636 5 160
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.963 5 161
6g6v-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution. 0.9606 5 161
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9582 5 161 3.40.50.620
4natB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9491 3 161 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9488 1 161 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9391 5 161 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9357 1 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7G9SKH7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9852 5 162 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3C0MD70-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9846 1 164 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0Q4CFV7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9825 21 169 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-B8GVE7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9821 5 163 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3C0YCS7-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.981 3 164 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Feature Viewer

pLDDT pTM Quality
93.66 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map