F476376
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 348 | 1408 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300047321|Ga0495676_0148827|Ga0495676_0148827_18_878 |
| Length | 286 |
| Sequence | MFLLSPPQILELNMFSRMPNAFRRADRCEWGDANRGGAVVDSFLEGPVLDGIGNLYVTDVPWGRIFRIDPAGEWRLIAEYAGDRQTLLIADYQNGLMRLDIRTGDVQPYLMRRNSERFKGVNDLCIDKAGNVYFTDQGQTGLHDPTGRLYRLRQDGRLDLLLSNVPSPNGVVLSTDERVAFVAVTRGNCVWRVPLLADGGVSKVGQFFTSYGPGGPDGLAVDANGRLYVANPGLGYVWVLNARAEPVLVLRGTPGASLTNIVLSQDGSRIYVTDSSQGAVLFADIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 184 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 186 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 187 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 188 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 189 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 190 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 208 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 209 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 210 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 211 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 212 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 213 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 214 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 215 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 218 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 219 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 220 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 268 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 283 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 285 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 287 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 288 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 290 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 291 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 292 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 293 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 294 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 295 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 296 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 297 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 298 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 299 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 300 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 301 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 302 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 303 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 304 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 305 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 306 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 307 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 308 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 309 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 310 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 311 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 312 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 313 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 314 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 315 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 316 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 317 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 318 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 319 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 320 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 321 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 322 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 323 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 324 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 325 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 326 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 327 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 328 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 329 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 330 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 331 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 332 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 333 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 334 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 335 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 336 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 337 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 338 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 339 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 340 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 341 | 2941479691 | |||
| 342 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 343 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 344 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 345 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 346 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 347 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 348 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.19 |
| Metatranscriptomes | 0 |
| Isolates | 7.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 20.88 |
| Nodule | 0.57 |
| Rhizoplane | 3.12 |
| Rhizosphere | 61.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495676_0148827 | 3300047321 | Bacteria | 1669 |
| 2 | JGI24739J22299_10000552 | 3300001989 | Bacteria | 13402 |
| 3 | JGI25152J39213_1004142 | 3300002773 | Bacteria | 4678 |
| 4 | JGI25150J39212_1000775 | 3300002774 | Bacteria | 10994 |
| 5 | JGI25159J45721_1001723 | 3300002987 | Bacteria | 8831 |
| 6 | JGI25151J46595_10001812 | 3300003187 | Bacteria | 13795 |
| 7 | JGI25151J46595_10007029 | 3300003187 | Bacteria | 5568 |
| 8 | JGI25153J46596_10004018 | 3300003215 | Bacteria | 8023 |
| 9 | rootH1_10004795 | 3300003316 | Bacteria | 4693 |
| 10 | rootH2_10062676 | 3300003320 | Bacteria | 4187 |
| 11 | rootL2_10002392 | 3300003322 | Bacteria | 54339 |
| 12 | rootL2_10002696 | 3300003322 | Bacteria | 25570 |
| 13 | rootH1_10015486 | 3300003323 | Bacteria | 2203 |
| 14 | JGI25160J50197_1005064 | 3300003354 | Bacteria | 5568 |
| 15 | JGI25160J50197_1005195 | 3300003354 | Bacteria | 5461 |
| 16 | JGI25161J50226_1001404 | 3300003374 | Bacteria | 7320 |
| 17 | JGI25161J50226_1002166 | 3300003374 | Bacteria | 5240 |
| 18 | Ga0055542_1000127 | 3300003762 | Bacteria | 100078 |
| 19 | Ga0055529_1001542 | 3300003763 | Bacteria | 6569 |
| 20 | Ga0055526_1007653 | 3300003771 | Bacteria | 5568 |
| 21 | Ga0055526_1012185 | 3300003771 | Bacteria | 3779 |
| 22 | Ga0055537_1002831 | 3300003773 | Bacteria | 5568 |
| 23 | Ga0055524_1005618 | 3300003775 | Bacteria | 5568 |
| 24 | Ga0055524_1005619 | 3300003775 | Bacteria | 5568 |
| 25 | Ga0055536_1001127 | 3300003781 | Bacteria | 16744 |
| 26 | Ga0055536_1002533 | 3300003781 | Bacteria | 10234 |
| 27 | Ga0055536_1007829 | 3300003781 | Bacteria | 4711 |
| 28 | Ga0055534_1002993 | 3300003784 | Bacteria | 5568 |
| 29 | Ga0055534_1004483 | 3300003784 | Bacteria | 4032 |
| 30 | Ga0055528_1005990 | 3300003790 | Bacteria | 5568 |
| 31 | Ga0055530_10000503 | 3300003791 | Bacteria | 33931 |
| 32 | Ga0055530_10009571 | 3300003791 | Bacteria | 3704 |
| 33 | Ga0055540_1000142 | 3300003792 | Bacteria | 71685 |
| 34 | Ga0055540_1001148 | 3300003792 | Bacteria | 16490 |
| 35 | Ga0055540_1002310 | 3300003792 | Bacteria | 10231 |
| 36 | Ga0055540_1023554 | 3300003792 | Bacteria | 1548 |
| 37 | Ga0055531_10000424 | 3300003794 | Bacteria | 40020 |
| 38 | Ga0055531_10001995 | 3300003794 | Bacteria | 14183 |
| 39 | Ga0058692_1001362 | 3300003856 | Bacteria | 9061 |
| 40 | Ga0058692_1002854 | 3300003856 | Bacteria | 5634 |
| 41 | Ga0055543_1000926 | 3300004625 | Bacteria | 13662 |
| 42 | Ga0065165_1002808 | 3300005262 | Bacteria | 13662 |
| 43 | Ga0065714_10068311 | 3300005288 | Bacteria | 4822 |
| 44 | Ga0065704_10081506 | 3300005289 | Bacteria | 3749 |
| 45 | Ga0070676_10004601 | 3300005328 | Bacteria | 7274 |
| 46 | Ga0070676_10255136 | 3300005328 | Bacteria | 1172 |
| 47 | Ga0070690_100009433 | 3300005330 | Bacteria | 5653 |
| 48 | Ga0070690_100047880 | 3300005330 | Bacteria | 2721 |
| 49 | Ga0070670_100039904 | 3300005331 | Bacteria | 4037 |
| 50 | Ga0070670_100309315 | 3300005331 | Bacteria | 1383 |
| 51 | Ga0070670_100368063 | 3300005331 | Bacteria | 1265 |
| 52 | Ga0070677_10014435 | 3300005333 | Bacteria | 2780 |
| 53 | Ga0070677_10016655 | 3300005333 | Bacteria | 2620 |
| 54 | Ga0070677_10030919 | 3300005333 | Bacteria | 2042 |
| 55 | Ga0068869_100011077 | 3300005334 | Bacteria | 5906 |
| 56 | Ga0068869_100012518 | 3300005334 | Bacteria | 5610 |
| 57 | Ga0068869_100031362 | 3300005334 | Bacteria | 3739 |
| 58 | Ga0068869_100216971 | 3300005334 | Bacteria | 1515 |
| 59 | Ga0070666_10020203 | 3300005335 | Bacteria | 4304 |
| 60 | Ga0070666_10039876 | 3300005335 | Bacteria | 3132 |
| 61 | Ga0070666_10181550 | 3300005335 | Bacteria | 1476 |
| 62 | Ga0068868_100037908 | 3300005338 | Bacteria | 3739 |
| 63 | Ga0068868_100056382 | 3300005338 | Bacteria | 3103 |
| 64 | Ga0068868_100067906 | 3300005338 | Bacteria | 2838 |
| 65 | Ga0070689_100027295 | 3300005340 | Bacteria | 4304 |
| 66 | Ga0070668_100005095 | 3300005347 | Bacteria | 9732 |
| 67 | Ga0070668_100168716 | 3300005347 | Bacteria | 1780 |
| 68 | Ga0070669_100003928 | 3300005353 | Bacteria | 10759 |
| 69 | Ga0070669_100039927 | 3300005353 | Bacteria | 3411 |
| 70 | Ga0070675_100000867 | 3300005354 | Bacteria | 21513 |
| 71 | Ga0070675_100002412 | 3300005354 | Bacteria | 13936 |
| 72 | Ga0070675_100081791 | 3300005354 | Bacteria | 2694 |
| 73 | Ga0070671_100007799 | 3300005355 | Bacteria | 8551 |
| 74 | Ga0070671_100042525 | 3300005355 | Bacteria | 3777 |
| 75 | Ga0070671_100048851 | 3300005355 | Bacteria | 3520 |
| 76 | Ga0070671_100364888 | 3300005355 | Bacteria | 1233 |
| 77 | Ga0070674_100002652 | 3300005356 | Bacteria | 9908 |
| 78 | Ga0070674_100004011 | 3300005356 | Bacteria | 8342 |
| 79 | Ga0070674_100014171 | 3300005356 | Bacteria | 4950 |
| 80 | Ga0070674_100025028 | 3300005356 | Bacteria | 3879 |
| 81 | Ga0070674_100034062 | 3300005356 | Bacteria | 3397 |
| 82 | Ga0070674_100184332 | 3300005356 | Bacteria | 1601 |
| 83 | Ga0070673_100000636 | 3300005364 | Bacteria | 19252 |
| 84 | Ga0070673_100003720 | 3300005364 | Bacteria | 9557 |
| 85 | Ga0070673_100040145 | 3300005364 | Bacteria | 3588 |
| 86 | Ga0070673_100048465 | 3300005364 | Bacteria | 3312 |
| 87 | Ga0070673_100057850 | 3300005364 | Bacteria | 3064 |
| 88 | Ga0070688_100045989 | 3300005365 | Bacteria | 2701 |
| 89 | Ga0070667_100003829 | 3300005367 | Bacteria | 12785 |
| 90 | Ga0070667_100006773 | 3300005367 | Bacteria | 9515 |
| 91 | Ga0070667_100025932 | 3300005367 | Bacteria | 4875 |
| 92 | Ga0070667_100050962 | 3300005367 | Bacteria | 3489 |
| 93 | Ga0070667_100163180 | 3300005367 | Bacteria | 1964 |
| 94 | Ga0070667_100181353 | 3300005367 | Bacteria | 1862 |
| 95 | Ga0070700_100243249 | 3300005441 | Unclassified | 1287 |
| 96 | Ga0070663_100262258 | 3300005455 | Bacteria | 1371 |
| 97 | Ga0070678_100028216 | 3300005456 | Bacteria | 3824 |
| 98 | Ga0070678_100147670 | 3300005456 | Bacteria | 1890 |
| 99 | Ga0070662_100009155 | 3300005457 | Bacteria | 6466 |
| 100 | Ga0070662_100037335 | 3300005457 | Bacteria | 3445 |
| 101 | Ga0070662_100067213 | 3300005457 | Bacteria | 2632 |
| 102 | Ga0068867_100002629 | 3300005459 | Bacteria | 12667 |
| 103 | Ga0068867_100016573 | 3300005459 | Bacteria | 5233 |
| 104 | Ga0068867_100019670 | 3300005459 | Bacteria | 4810 |
| 105 | Ga0068867_100072857 | 3300005459 | Bacteria | 2572 |
| 106 | Ga0068867_100260904 | 3300005459 | Bacteria | 1412 |
| 107 | Ga0068853_100088254 | 3300005539 | Bacteria | 2722 |
| 108 | Ga0068853_100308470 | 3300005539 | Bacteria | 1464 |
| 109 | Ga0068853_100395500 | 3300005539 | Bacteria | 1293 |
| 110 | Ga0070672_100010747 | 3300005543 | Bacteria | 6360 |
| 111 | Ga0070672_100014574 | 3300005543 | Bacteria | 5574 |
| 112 | Ga0070672_100031629 | 3300005543 | Bacteria | 3985 |
| 113 | Ga0070672_100036062 | 3300005543 | Bacteria | 3765 |
| 114 | Ga0070672_100043078 | 3300005543 | Bacteria | 3478 |
| 115 | Ga0070672_100066213 | 3300005543 | Bacteria | 2860 |
| 116 | Ga0070686_100074145 | 3300005544 | Bacteria | 2236 |
| 117 | Ga0070665_100028335 | 3300005548 | Bacteria | 5641 |
| 118 | Ga0070665_100579392 | 3300005548 | Bacteria | 1135 |
| 119 | Ga0070664_100040055 | 3300005564 | Bacteria | 3949 |
| 120 | Ga0070664_100066038 | 3300005564 | Bacteria | 3089 |
| 121 | Ga0068857_100048003 | 3300005577 | Bacteria | 3791 |
| 122 | Ga0068857_100124186 | 3300005577 | Bacteria | 2325 |
| 123 | Ga0068852_100048760 | 3300005616 | Bacteria | 3620 |
| 124 | Ga0068852_100052408 | 3300005616 | Bacteria | 3506 |
| 125 | Ga0068852_100113707 | 3300005616 | Bacteria | 2465 |
| 126 | Ga0068859_100059297 | 3300005617 | Bacteria | 3856 |
| 127 | Ga0068859_100077867 | 3300005617 | Bacteria | 3356 |
| 128 | Ga0068864_100001800 | 3300005618 | Bacteria | 17594 |
| 129 | Ga0068864_100005187 | 3300005618 | Bacteria | 10671 |
| 130 | Ga0068864_100071025 | 3300005618 | Bacteria | 3031 |
| 131 | Ga0068866_10010784 | 3300005718 | Bacteria | 3929 |
| 132 | Ga0068866_10047177 | 3300005718 | Bacteria | 2171 |
| 133 | Ga0068861_100001031 | 3300005719 | Bacteria | 17061 |
| 134 | Ga0068861_100006400 | 3300005719 | Bacteria | 8023 |
| 135 | Ga0068851_10026313 | 3300005834 | Bacteria | 2858 |
| 136 | Ga0068851_10032297 | 3300005834 | Bacteria | 2605 |
| 137 | Ga0068851_10083326 | 3300005834 | Bacteria | 1673 |
| 138 | Ga0068851_10106335 | 3300005834 | Bacteria | 1494 |
| 139 | Ga0068870_10114408 | 3300005840 | Bacteria | 1545 |
| 140 | Ga0068863_100001722 | 3300005841 | Bacteria | 21666 |
| 141 | Ga0068863_100006998 | 3300005841 | Bacteria | 11056 |
| 142 | Ga0068863_100044836 | 3300005841 | Bacteria | 4196 |
| 143 | Ga0068858_100010139 | 3300005842 | Bacteria | 8944 |
| 144 | Ga0068858_100034855 | 3300005842 | Bacteria | 4668 |
| 145 | Ga0068858_100035822 | 3300005842 | Bacteria | 4602 |
| 146 | Ga0068860_100001567 | 3300005843 | Bacteria | 24631 |
| 147 | Ga0068860_100052678 | 3300005843 | Bacteria | 3870 |
| 148 | Ga0068860_100135208 | 3300005843 | Bacteria | 2367 |
| 149 | Ga0068862_100025291 | 3300005844 | Bacteria | 4985 |
| 150 | Ga0068862_100438050 | 3300005844 | Bacteria | 1230 |
| 151 | Ga0075365_10047672 | 3300006038 | Bacteria | 2817 |
| 152 | Ga0075364_10001315 | 3300006051 | Bacteria | 13365 |
| 153 | Ga0075364_10005633 | 3300006051 | Bacteria | 7303 |
| 154 | Ga0075364_10048211 | 3300006051 | Bacteria | 2775 |
| 155 | Ga0075364_10176634 | 3300006051 | Bacteria | 1444 |
| 156 | Ga0075432_10033182 | 3300006058 | Bacteria | 1790 |
| 157 | Ga0075362_10006037 | 3300006177 | Bacteria | 4485 |
| 158 | Ga0075362_10007293 | 3300006177 | Bacteria | 4179 |
| 159 | Ga0075362_10035060 | 3300006177 | Bacteria | 2189 |
| 160 | Ga0075367_10033860 | 3300006178 | Bacteria | 2947 |
| 161 | Ga0075367_10161354 | 3300006178 | Bacteria | 1394 |
| 162 | Ga0075369_10005814 | 3300006186 | Bacteria | 4633 |
| 163 | Ga0075369_10018982 | 3300006186 | Bacteria | 2804 |
| 164 | Ga0075369_10038661 | 3300006186 | Bacteria | 2036 |
| 165 | Ga0075366_10004402 | 3300006195 | Bacteria | 7560 |
| 166 | Ga0075366_10004730 | 3300006195 | Bacteria | 7333 |
| 167 | Ga0075366_10005398 | 3300006195 | Bacteria | 6926 |
| 168 | Ga0075366_10016652 | 3300006195 | Bacteria | 4226 |
| 169 | Ga0075366_10185094 | 3300006195 | Bacteria | 1265 |
| 170 | Ga0097621_100020094 | 3300006237 | Bacteria | 5143 |
| 171 | Ga0097621_100030205 | 3300006237 | Bacteria | 4287 |
| 172 | Ga0075370_10000362 | 3300006353 | Bacteria | 16636 |
| 173 | Ga0075370_10002990 | 3300006353 | Bacteria | 7953 |
| 174 | Ga0075370_10018538 | 3300006353 | Bacteria | 3778 |
| 175 | Ga0075370_10042180 | 3300006353 | Bacteria | 2577 |
| 176 | Ga0068871_100017041 | 3300006358 | Bacteria | 5488 |
| 177 | Ga0068871_100075544 | 3300006358 | Bacteria | 2782 |
| 178 | Ga0075430_100069041 | 3300006846 | Bacteria | 2965 |
| 179 | Ga0075429_100003836 | 3300006880 | Bacteria | 12839 |
| 180 | Ga0068865_100022269 | 3300006881 | Bacteria | 4131 |
| 181 | Ga0068865_100025301 | 3300006881 | Bacteria | 3903 |
| 182 | Ga0097620_100059296 | 3300006931 | Bacteria | 3856 |
| 183 | Ga0097620_100077866 | 3300006931 | Bacteria | 3356 |
| 184 | Ga0099826_10000023 | 3300006948 | Bacteria | 154989 |
| 185 | Ga0099826_10007158 | 3300006948 | Bacteria | 8204 |
| 186 | Ga0105251_10002295 | 3300009011 | Bacteria | 15155 |
| 187 | Ga0105244_10003718 | 3300009036 | Bacteria | 10769 |
| 188 | Ga0105244_10010700 | 3300009036 | Bacteria | 5546 |
| 189 | Ga0105244_10059140 | 3300009036 | Bacteria | 1932 |
| 190 | Ga0105250_10022124 | 3300009092 | Bacteria | 2565 |
| 191 | Ga0105240_10084452 | 3300009093 | Bacteria | 3893 |
| 192 | Ga0105243_10001727 | 3300009148 | Bacteria | 18819 |
| 193 | Ga0105243_10005672 | 3300009148 | Bacteria | 9716 |
| 194 | Ga0105243_10034866 | 3300009148 | Bacteria | 3900 |
| 195 | Ga0105243_10224972 | 3300009148 | Bacteria | 1661 |
| 196 | Ga0105243_10290919 | 3300009148 | Bacteria | 1476 |
| 197 | Ga0105243_10458779 | 3300009148 | Bacteria | 1198 |
| 198 | Ga0105241_10332306 | 3300009174 | Bacteria | 1314 |
| 199 | Ga0105242_10012717 | 3300009176 | Bacteria | 6482 |
| 200 | Ga0105242_10035627 | 3300009176 | Bacteria | 3990 |
| 201 | Ga0105242_10090084 | 3300009176 | Bacteria | 2579 |
| 202 | Ga0105242_10129670 | 3300009176 | Bacteria | 2175 |
| 203 | Ga0105242_10137976 | 3300009176 | Bacteria | 2113 |
| 204 | Ga0105248_10026525 | 3300009177 | Bacteria | 6445 |
| 205 | Ga0105248_10063935 | 3300009177 | Bacteria | 4131 |
| 206 | Ga0105248_10100638 | 3300009177 | Bacteria | 3257 |
| 207 | Ga0105248_10172139 | 3300009177 | Bacteria | 2441 |
| 208 | Ga0105237_10017444 | 3300009545 | Bacteria | 7441 |
| 209 | Ga0105237_10113208 | 3300009545 | Bacteria | 2705 |
| 210 | Ga0105238_10357550 | 3300009551 | Bacteria | 1449 |
| 211 | Ga0105249_10009014 | 3300009553 | Bacteria | 8717 |
| 212 | Ga0105249_10024652 | 3300009553 | Bacteria | 5407 |
| 213 | Ga0105249_10251733 | 3300009553 | Bacteria | 1751 |
| 214 | Ga0105249_10547546 | 3300009553 | Bacteria | 1207 |
| 215 | Ga0105239_10754298 | 3300010375 | Bacteria | 1114 |
| 216 | Ga0105246_10071291 | 3300011119 | Bacteria | 2446 |
| 217 | Ga0157371_10103405 | 3300013102 | Bacteria | 2021 |
| 218 | Ga0157370_10000355 | 3300013104 | Bacteria | 58228 |
| 219 | Ga0157370_10005163 | 3300013104 | Bacteria | 14724 |
| 220 | Ga0157370_10053102 | 3300013104 | Bacteria | 3866 |
| 221 | Ga0157369_10370154 | 3300013105 | Bacteria | 1487 |
| 222 | Ga0157374_10219804 | 3300013296 | Bacteria | 1864 |
| 223 | Ga0157374_10359856 | 3300013296 | Bacteria | 1447 |
| 224 | Ga0157374_10669180 | 3300013296 | Bacteria | 1050 |
| 225 | Ga0157378_10007266 | 3300013297 | Bacteria | 9673 |
| 226 | Ga0157378_10032465 | 3300013297 | Bacteria | 4613 |
| 227 | Ga0163162_10004491 | 3300013306 | Bacteria | 13443 |
| 228 | Ga0163162_10035520 | 3300013306 | Bacteria | 4965 |
| 229 | Ga0163162_10293408 | 3300013306 | Bacteria | 1758 |
| 230 | Ga0157372_10454691 | 3300013307 | Bacteria | 1492 |
| 231 | Ga0157375_10008158 | 3300013308 | Bacteria | 9165 |
| 232 | Ga0157375_10077926 | 3300013308 | Bacteria | 3346 |
| 233 | Ga0157375_10082197 | 3300013308 | Bacteria | 3262 |
| 234 | Ga0157375_10087913 | 3300013308 | Bacteria | 3161 |
| 235 | Ga0163163_10004780 | 3300014325 | Bacteria | 11624 |
| 236 | Ga0157380_10002852 | 3300014326 | Bacteria | 11733 |
| 237 | Ga0157380_10014614 | 3300014326 | Bacteria | 5748 |
| 238 | Ga0157380_10056853 | 3300014326 | Bacteria | 3113 |
| 239 | Ga0157380_10077947 | 3300014326 | Bacteria | 2702 |
| 240 | Ga0157380_10173652 | 3300014326 | Bacteria | 1886 |
| 241 | Ga0182008_10000256 | 3300014497 | Bacteria | 41427 |
| 242 | Ga0182008_10002592 | 3300014497 | Bacteria | 11226 |
| 243 | Ga0182008_10022441 | 3300014497 | Bacteria | 3233 |
| 244 | Ga0182008_10022563 | 3300014497 | Bacteria | 3223 |
| 245 | Ga0182008_10064590 | 3300014497 | Bacteria | 1802 |
| 246 | Ga0182008_10077486 | 3300014497 | Bacteria | 1636 |
| 247 | Ga0182008_10119892 | 3300014497 | Bacteria | 1307 |
| 248 | Ga0157379_10021478 | 3300014968 | Bacteria | 5714 |
| 249 | Ga0157379_10046143 | 3300014968 | Bacteria | 3889 |
| 250 | Ga0157379_10070070 | 3300014968 | Bacteria | 3137 |
| 251 | Ga0157379_10123835 | 3300014968 | Bacteria | 2326 |
| 252 | Ga0157376_10018109 | 3300014969 | Bacteria | 5390 |
| 253 | Ga0157376_10022136 | 3300014969 | Bacteria | 4948 |
| 254 | Ga0182006_1006572 | 3300015261 | Bacteria | 5390 |
| 255 | Ga0182006_1008663 | 3300015261 | Bacteria | 4605 |
| 256 | Ga0182007_10004924 | 3300015262 | Bacteria | 5957 |
| 257 | Ga0182007_10015558 | 3300015262 | Bacteria | 2833 |
| 258 | Ga0182007_10041432 | 3300015262 | Bacteria | 1535 |
| 259 | Ga0163161_10000201 | 3300017792 | Bacteria | 54704 |
| 260 | Ga0163161_10058971 | 3300017792 | Bacteria | 2791 |
| 261 | Ga0163161_10065023 | 3300017792 | Bacteria | 2661 |
| 262 | Ga0163161_10072444 | 3300017792 | Bacteria | 2523 |
| 263 | Ga0213876_10060896 | 3300021384 | Bacteria | 1992 |
| 264 | Ga0209436_102685 | 3300025208 | Bacteria | 5149 |
| 265 | Ga0209436_105024 | 3300025208 | Bacteria | 3141 |
| 266 | Ga0209672_100172 | 3300025228 | Bacteria | 54226 |
| 267 | Ga0209147_100934 | 3300025229 | Bacteria | 12979 |
| 268 | Ga0209258_100078 | 3300025242 | Bacteria | 263996 |
| 269 | Ga0209258_102336 | 3300025242 | Bacteria | 5018 |
| 270 | Ga0207425_1000220 | 3300025245 | Bacteria | 44993 |
| 271 | Ga0207425_1011013 | 3300025245 | Bacteria | 2179 |
| 272 | Ga0209148_1000086 | 3300025254 | Bacteria | 263996 |
| 273 | Ga0209129_1000707 | 3300025258 | Bacteria | 21656 |
| 274 | Ga0209129_1000904 | 3300025258 | Bacteria | 18153 |
| 275 | Ga0209129_1001750 | 3300025258 | Bacteria | 11652 |
| 276 | Ga0209565_1000193 | 3300025263 | Bacteria | 73374 |
| 277 | Ga0209565_1006038 | 3300025263 | Bacteria | 3452 |
| 278 | Ga0209673_1000168 | 3300025273 | Bacteria | 135126 |
| 279 | Ga0209673_1000355 | 3300025273 | Bacteria | 83197 |
| 280 | Ga0209130_1000810 | 3300025284 | Bacteria | 26474 |
| 281 | Ga0209130_1001236 | 3300025284 | Bacteria | 17939 |
| 282 | Ga0209130_1001907 | 3300025284 | Bacteria | 11762 |
| 283 | Ga0209675_1001053 | 3300025291 | Bacteria | 17100 |
| 284 | Ga0209675_1001228 | 3300025291 | Bacteria | 15436 |
| 285 | Ga0209675_1007200 | 3300025291 | Bacteria | 4309 |
| 286 | Ga0209676_1000103 | 3300025292 | Bacteria | 226908 |
| 287 | Ga0209676_1000152 | 3300025292 | Bacteria | 166700 |
| 288 | Ga0209676_1010674 | 3300025292 | Bacteria | 3790 |
| 289 | Ga0209676_1023532 | 3300025292 | Bacteria | 2014 |
| 290 | Ga0209025_1000201 | 3300025294 | Bacteria | 145890 |
| 291 | Ga0209025_1000839 | 3300025294 | Bacteria | 48717 |
| 292 | Ga0209025_1014376 | 3300025294 | Bacteria | 4872 |
| 293 | Ga0209025_1045127 | 3300025294 | Bacteria | 1832 |
| 294 | Ga0209564_1000289 | 3300025295 | Bacteria | 101976 |
| 295 | Ga0209564_1000391 | 3300025295 | Bacteria | 78565 |
| 296 | Ga0209758_1000034 | 3300025297 | Bacteria | 467637 |
| 297 | Ga0209758_1007283 | 3300025297 | Bacteria | 7592 |
| 298 | Ga0209758_1020465 | 3300025297 | Bacteria | 3129 |
| 299 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 300 | Ga0209050_1000210 | 3300025298 | Bacteria | 129834 |
| 301 | Ga0209050_1004904 | 3300025298 | Bacteria | 8747 |
| 302 | Ga0209256_1000066 | 3300025299 | Bacteria | 247534 |
| 303 | Ga0209256_1000318 | 3300025299 | Bacteria | 82840 |
| 304 | Ga0207426_1000067 | 3300025302 | Bacteria | 342108 |
| 305 | Ga0207426_1000266 | 3300025302 | Bacteria | 109895 |
| 306 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 307 | Ga0209051_1000074 | 3300025303 | Bacteria | 208667 |
| 308 | Ga0209051_1001472 | 3300025303 | Bacteria | 19909 |
| 309 | Ga0209051_1003040 | 3300025303 | Bacteria | 11347 |
| 310 | Ga0209051_1017090 | 3300025303 | Bacteria | 3253 |
| 311 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 312 | Ga0209257_1000072 | 3300025304 | Bacteria | 332791 |
| 313 | Ga0209257_1004029 | 3300025304 | Bacteria | 11815 |
| 314 | Ga0207697_10009122 | 3300025315 | Bacteria | 4299 |
| 315 | Ga0207656_10152662 | 3300025321 | Bacteria | 1095 |
| 316 | Ga0207655_1079783 | 3300025728 | Bacteria | 1185 |
| 317 | Ga0207713_1016462 | 3300025735 | Bacteria | 3750 |
| 318 | Ga0207682_10004300 | 3300025893 | Bacteria | 5985 |
| 319 | Ga0207682_10014163 | 3300025893 | Bacteria | 3108 |
| 320 | Ga0207682_10021127 | 3300025893 | Bacteria | 2560 |
| 321 | Ga0207682_10034152 | 3300025893 | Bacteria | 2050 |
| 322 | Ga0207682_10040471 | 3300025893 | Bacteria | 1899 |
| 323 | Ga0207642_10003819 | 3300025899 | Bacteria | 4805 |
| 324 | Ga0207642_10097159 | 3300025899 | Bacteria | 1470 |
| 325 | Ga0207688_10053187 | 3300025901 | Bacteria | 2270 |
| 326 | Ga0207680_10000628 | 3300025903 | Bacteria | 16642 |
| 327 | Ga0207680_10010325 | 3300025903 | Bacteria | 4667 |
| 328 | Ga0207645_10018671 | 3300025907 | Bacteria | 4555 |
| 329 | Ga0207645_10019539 | 3300025907 | Bacteria | 4441 |
| 330 | Ga0207645_10086866 | 3300025907 | Bacteria | 2009 |
| 331 | Ga0207643_10070697 | 3300025908 | Bacteria | 2008 |
| 332 | Ga0207643_10106003 | 3300025908 | Bacteria | 1652 |
| 333 | Ga0207695_10360671 | 3300025913 | Bacteria | 1340 |
| 334 | Ga0207671_10098311 | 3300025914 | Bacteria | 2214 |
| 335 | Ga0207681_10001666 | 3300025923 | Bacteria | 14298 |
| 336 | Ga0207681_10005868 | 3300025923 | Bacteria | 7529 |
| 337 | Ga0207681_10045496 | 3300025923 | Bacteria | 2947 |
| 338 | Ga0207681_10141502 | 3300025923 | Bacteria | 1792 |
| 339 | Ga0207694_10157975 | 3300025924 | Bacteria | 1830 |
| 340 | Ga0207694_10226237 | 3300025924 | Bacteria | 1527 |
| 341 | Ga0207650_10000395 | 3300025925 | Bacteria | 39717 |
| 342 | Ga0207650_10005656 | 3300025925 | Bacteria | 8537 |
| 343 | Ga0207650_10056569 | 3300025925 | Bacteria | 2915 |
| 344 | Ga0207650_10189814 | 3300025925 | Bacteria | 1641 |
| 345 | Ga0207650_10295487 | 3300025925 | Bacteria | 1322 |
| 346 | Ga0207659_10000361 | 3300025926 | Bacteria | 27251 |
| 347 | Ga0207659_10001382 | 3300025926 | Bacteria | 14474 |
| 348 | Ga0207659_10027036 | 3300025926 | Bacteria | 3879 |
| 349 | Ga0207659_10109655 | 3300025926 | Bacteria | 2096 |
| 350 | Ga0207644_10009812 | 3300025931 | Bacteria | 6295 |
| 351 | Ga0207644_10021084 | 3300025931 | Bacteria | 4436 |
| 352 | Ga0207644_10056053 | 3300025931 | Bacteria | 2843 |
| 353 | Ga0207706_10031298 | 3300025933 | Bacteria | 4740 |
| 354 | Ga0207706_10046097 | 3300025933 | Bacteria | 3860 |
| 355 | Ga0207706_10092563 | 3300025933 | Bacteria | 2658 |
| 356 | Ga0207706_10278116 | 3300025933 | Bacteria | 1460 |
| 357 | Ga0207686_10018549 | 3300025934 | Bacteria | 3941 |
| 358 | Ga0207686_10032970 | 3300025934 | Bacteria | 3087 |
| 359 | Ga0207686_10101825 | 3300025934 | Bacteria | 1919 |
| 360 | Ga0207709_10000112 | 3300025935 | Bacteria | 127357 |
| 361 | Ga0207709_10000999 | 3300025935 | Bacteria | 21008 |
| 362 | Ga0207709_10012395 | 3300025935 | Bacteria | 4698 |
| 363 | Ga0207709_10088800 | 3300025935 | Bacteria | 2014 |
| 364 | Ga0207709_10239737 | 3300025935 | Bacteria | 1318 |
| 365 | Ga0207669_10008907 | 3300025937 | Bacteria | 4742 |
| 366 | Ga0207669_10010328 | 3300025937 | Bacteria | 4490 |
| 367 | Ga0207669_10011808 | 3300025937 | Bacteria | 4267 |
| 368 | Ga0207669_10016396 | 3300025937 | Bacteria | 3763 |
| 369 | Ga0207704_10003637 | 3300025938 | Bacteria | 7002 |
| 370 | Ga0207704_10097920 | 3300025938 | Bacteria | 1947 |
| 371 | Ga0207691_10000792 | 3300025940 | Bacteria | 31429 |
| 372 | Ga0207691_10013268 | 3300025940 | Bacteria | 7892 |
| 373 | Ga0207691_10047144 | 3300025940 | Bacteria | 3956 |
| 374 | Ga0207691_10047772 | 3300025940 | Bacteria | 3926 |
| 375 | Ga0207691_10054700 | 3300025940 | Bacteria | 3640 |
| 376 | Ga0207691_10104190 | 3300025940 | Bacteria | 2529 |
| 377 | Ga0207711_10004659 | 3300025941 | Bacteria | 11645 |
| 378 | Ga0207711_10008644 | 3300025941 | Bacteria | 8516 |
| 379 | Ga0207711_10021685 | 3300025941 | Bacteria | 5366 |
| 380 | Ga0207711_10109609 | 3300025941 | Bacteria | 2454 |
| 381 | Ga0207689_10006875 | 3300025942 | Bacteria | 10003 |
| 382 | Ga0207689_10027313 | 3300025942 | Bacteria | 4778 |
| 383 | Ga0207689_10041585 | 3300025942 | Bacteria | 3803 |
| 384 | Ga0207689_10455466 | 3300025942 | Bacteria | 1070 |
| 385 | Ga0207661_10039909 | 3300025944 | Bacteria | 3687 |
| 386 | Ga0207679_10030948 | 3300025945 | Bacteria | 3742 |
| 387 | Ga0207679_10239356 | 3300025945 | Bacteria | 1537 |
| 388 | Ga0207667_10018380 | 3300025949 | Bacteria | 7841 |
| 389 | Ga0207651_10000398 | 3300025960 | Bacteria | 18449 |
| 390 | Ga0207651_10020813 | 3300025960 | Bacteria | 3969 |
| 391 | Ga0207651_10155595 | 3300025960 | Unclassified | 1785 |
| 392 | Ga0207712_10009514 | 3300025961 | Bacteria | 6149 |
| 393 | Ga0207712_10027282 | 3300025961 | Bacteria | 3812 |
| 394 | Ga0207668_10008172 | 3300025972 | Bacteria | 6229 |
| 395 | Ga0207668_10045220 | 3300025972 | Bacteria | 3001 |
| 396 | Ga0207668_10055915 | 3300025972 | Bacteria | 2746 |
| 397 | Ga0207640_10043615 | 3300025981 | Bacteria | 2868 |
| 398 | Ga0207640_10271795 | 3300025981 | Bacteria | 1326 |
| 399 | Ga0207658_10002681 | 3300025986 | Bacteria | 12869 |
| 400 | Ga0207658_10007158 | 3300025986 | Bacteria | 7602 |
| 401 | Ga0207658_10070074 | 3300025986 | Bacteria | 2652 |
| 402 | Ga0207658_10080443 | 3300025986 | Bacteria | 2496 |
| 403 | Ga0207658_10241606 | 3300025986 | Bacteria | 1530 |
| 404 | Ga0207677_10012056 | 3300026023 | Bacteria | 4951 |
| 405 | Ga0207677_10054957 | 3300026023 | Bacteria | 2720 |
| 406 | Ga0207677_10592005 | 3300026023 | Bacteria | 972 |
| 407 | Ga0207703_10008523 | 3300026035 | Bacteria | 8096 |
| 408 | Ga0207703_10090385 | 3300026035 | Bacteria | 2573 |
| 409 | Ga0207639_10107200 | 3300026041 | Bacteria | 2269 |
| 410 | Ga0207639_10144464 | 3300026041 | Bacteria | 1986 |
| 411 | Ga0207639_10370319 | 3300026041 | Bacteria | 1284 |
| 412 | Ga0207678_10019463 | 3300026067 | Bacteria | 5963 |
| 413 | Ga0207678_10127924 | 3300026067 | Bacteria | 2167 |
| 414 | Ga0207708_10016701 | 3300026075 | Bacteria | 5524 |
| 415 | Ga0207641_10004010 | 3300026088 | Bacteria | 12847 |
| 416 | Ga0207641_10006561 | 3300026088 | Bacteria | 9779 |
| 417 | Ga0207648_10002731 | 3300026089 | Bacteria | 18746 |
| 418 | Ga0207648_10005525 | 3300026089 | Bacteria | 12740 |
| 419 | Ga0207648_10020733 | 3300026089 | Bacteria | 5917 |
| 420 | Ga0207648_10020894 | 3300026089 | Bacteria | 5894 |
| 421 | Ga0207648_10043492 | 3300026089 | Bacteria | 3942 |
| 422 | Ga0207648_10064840 | 3300026089 | Bacteria | 3184 |
| 423 | Ga0207648_10065521 | 3300026089 | Bacteria | 3167 |
| 424 | Ga0207676_10000082 | 3300026095 | Bacteria | 92500 |
| 425 | Ga0207676_10013301 | 3300026095 | Bacteria | 5912 |
| 426 | Ga0207676_10026597 | 3300026095 | Bacteria | 4303 |
| 427 | Ga0207676_10032458 | 3300026095 | Bacteria | 3935 |
| 428 | Ga0207674_10060789 | 3300026116 | Bacteria | 3820 |
| 429 | Ga0207674_10079187 | 3300026116 | Bacteria | 3291 |
| 430 | Ga0207675_100012003 | 3300026118 | Bacteria | 8096 |
| 431 | Ga0207675_100034565 | 3300026118 | Bacteria | 4713 |
| 432 | Ga0207683_10008053 | 3300026121 | Bacteria | 9012 |
| 433 | Ga0207683_10008094 | 3300026121 | Bacteria | 8989 |
| 434 | Ga0207683_10050736 | 3300026121 | Bacteria | 3635 |
| 435 | Ga0207683_10060353 | 3300026121 | Bacteria | 3333 |
| 436 | Ga0207683_10102470 | 3300026121 | Bacteria | 2556 |
| 437 | Ga0207683_10156837 | 3300026121 | Bacteria | 2056 |
| 438 | Ga0207698_10004335 | 3300026142 | Bacteria | 8638 |
| 439 | Ga0207698_10118371 | 3300026142 | Bacteria | 2237 |
| 440 | Ga0207698_10137730 | 3300026142 | Bacteria | 2097 |
| 441 | Ga0209371_1000363 | 3300027312 | Bacteria | 48923 |
| 442 | Ga0209371_1002523 | 3300027312 | Bacteria | 10127 |
| 443 | Ga0209371_1002974 | 3300027312 | Bacteria | 8803 |
| 444 | Ga0209371_1003137 | 3300027312 | Bacteria | 8401 |
| 445 | Ga0209282_1000047 | 3300027666 | Bacteria | 114735 |
| 446 | Ga0268266_10035509 | 3300028379 | Bacteria | 4240 |
| 447 | Ga0268265_10010659 | 3300028380 | Bacteria | 6208 |
| 448 | Ga0268264_10004490 | 3300028381 | Bacteria | 11902 |
| 449 | Ga0268264_10009726 | 3300028381 | Bacteria | 7960 |
| 450 | Ga0268264_10103159 | 3300028381 | Bacteria | 2483 |
| 451 | Ga0268264_10106096 | 3300028381 | Bacteria | 2452 |
| 452 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 453 | Ga0268256_1000310 | 3300030500 | Bacteria | 48923 |
| 454 | Ga0268256_1002626 | 3300030500 | Bacteria | 8931 |
| 455 | Ga0268256_1008491 | 3300030500 | Bacteria | 3512 |
| 456 | Ga0316176_1073913 | 3300030732 | Bacteria | 2487 |
| 457 | Ga0314311_1007068 | 3300030733 | Bacteria | 7871 |
| 458 | Ga0316178_1083134 | 3300030735 | Bacteria | 7166 |
| 459 | Ga0316183_1021165 | 3300030742 | Bacteria | 12700 |
| 460 | Ga0316181_1009424 | 3300030744 | Bacteria | 6953 |
| 461 | Ga0316182_1260907 | 3300030745 | Bacteria | 2818 |
| 462 | Ga0316182_1320483 | 3300030745 | Bacteria | 3947 |
| 463 | Ga0265327_10001420 | 3300031251 | Bacteria | 30486 |
| 464 | Ga0307513_10064270 | 3300031456 | Bacteria | 3868 |
| 465 | Ga0307408_100000048 | 3300031548 | Bacteria | 165579 |
| 466 | Ga0307408_100113357 | 3300031548 | Bacteria | 2087 |
| 467 | Ga0307514_10000241 | 3300031649 | Bacteria | 142059 |
| 468 | Ga0307405_10011663 | 3300031731 | Bacteria | 4620 |
| 469 | Ga0307405_10410872 | 3300031731 | Bacteria | 1062 |
| 470 | Ga0307406_10000575 | 3300031901 | Bacteria | 21150 |
| 471 | Ga0307406_10018312 | 3300031901 | Bacteria | 4089 |
| 472 | Ga0307416_100029109 | 3300032002 | Bacteria | 4121 |
| 473 | Ga0307416_100213790 | 3300032002 | Bacteria | 1842 |
| 474 | Ga0307414_10272388 | 3300032004 | Bacteria | 1418 |
| 475 | Ga0307507_10200504 | 3300033179 | Bacteria | 1381 |
| 476 | Ga0395899_0006393 | 3300037312 | Bacteria | 9127 |
| 477 | Ga0395900_0007035 | 3300037418 | Bacteria | 11650 |
| 478 | Ga0395900_0273614 | 3300037418 | Bacteria | 1683 |
| 479 | Ga0395900_0424486 | 3300037418 | Bacteria | 1290 |
| 480 | Ga0395898_0005299 | 3300037466 | Bacteria | 13946 |
| 481 | Ga0395905_0004239 | 3300037471 | Bacteria | 14986 |
| 482 | Ga0395905_0134957 | 3300037471 | Bacteria | 2321 |
| 483 | Ga0395905_0234994 | 3300037471 | Bacteria | 1713 |
| 484 | Ga0395901_0034987 | 3300038443 | Bacteria | 5189 |
| 485 | Ga0436365_0619898 | 3300039437 | Bacteria | 2566 |
| 486 | Ga0436361_0335889 | 3300039447 | Bacteria | 24833 |
| 487 | Ga0439436_0011989 | 3300041404 | Bacteria | 2632 |
| 488 | Ga0451797_0267875 | 3300041453 | Bacteria | 1758 |
| 489 | Ga0439442_002996 | 3300042002 | Bacteria | 3333 |
| 490 | Ga0439452_000068 | 3300042010 | Bacteria | 90768 |
| 491 | Ga0450911_000137 | 3300042115 | Bacteria | 29337 |
| 492 | Ga0450923_005756 | 3300042125 | Bacteria | 2020 |
| 493 | Ga0450898_006422 | 3300042134 | Bacteria | 1804 |
| 494 | Ga0450898_013362 | 3300042134 | Bacteria | 1367 |
| 495 | Ga0450906_015339 | 3300042145 | Bacteria | 1393 |
| 496 | Ga0450910_015556 | 3300042147 | Bacteria | 1120 |
| 497 | Ga0439434_0007810 | 3300042435 | Bacteria | 3136 |
| 498 | Ga0439464_0013440 | 3300042439 | Bacteria | 2192 |
| 499 | Ga0439464_0045304 | 3300042439 | Bacteria | 1262 |
| 500 | Ga0450918_001088 | 3300042531 | Bacteria | 5593 |
| 501 | Ga0450893_0016946 | 3300042532 | Bacteria | 1236 |
| 502 | Ga0495627_034134 | 3300046453 | Bacteria | 1591 |
| 503 | Ga0495590_0005754 | 3300046457 | Bacteria | 4871 |
| 504 | Ga0495638_0028297 | 3300046460 | Bacteria | 3620 |
| 505 | Ga0495639_0038848 | 3300046475 | Bacteria | 2138 |
| 506 | Ga0495584_0090492 | 3300046491 | Bacteria | 1543 |
| 507 | Ga0495610_0029518 | 3300046512 | Bacteria | 2886 |
| 508 | Ga0495616_0000820 | 3300046513 | Bacteria | 22673 |
| 509 | Ga0495620_0103668 | 3300046515 | Bacteria | 1132 |
| 510 | Ga0495631_0001019 | 3300046518 | Bacteria | 17402 |
| 511 | Ga0495637_0021953 | 3300046520 | Bacteria | 2918 |
| 512 | Ga0495643_0008246 | 3300046522 | Bacteria | 6618 |
| 513 | Ga0495643_0119533 | 3300046522 | Bacteria | 1333 |
| 514 | Ga0495666_0029775 | 3300046526 | Bacteria | 2685 |
| 515 | Ga0495654_0014840 | 3300046530 | Bacteria | 4140 |
| 516 | Ga0495598_0010884 | 3300046537 | Bacteria | 2191 |
| 517 | Ga0495621_0021875 | 3300046539 | Bacteria | 2113 |
| 518 | Ga0495621_0058383 | 3300046539 | Bacteria | 1395 |
| 519 | Ga0495597_0000271 | 3300046542 | Bacteria | 47044 |
| 520 | Ga0495597_0003723 | 3300046542 | Bacteria | 8703 |
| 521 | Ga0495597_0105947 | 3300046542 | Bacteria | 1182 |
| 522 | Ga0495668_0051859 | 3300046616 | Bacteria | 2271 |
| 523 | Ga0495625_0092173 | 3300046660 | Bacteria | 2094 |
| 524 | Ga0495625_0184002 | 3300046660 | Bacteria | 1387 |
| 525 | Ga0495661_0002118 | 3300046665 | Bacteria | 15560 |
| 526 | Ga0495658_0139595 | 3300046683 | Bacteria | 1481 |
| 527 | Ga0495604_0013867 | 3300047317 | Bacteria | 6428 |
| 528 | Ga0495676_0001369 | 3300047321 | Bacteria | 20985 |
| 529 | Ga0495687_000196 | 3300047443 | Bacteria | 87053 |
| 530 | Ga0495687_004760 | 3300047443 | Bacteria | 8966 |
| 531 | Ga0495593_0001089 | 3300047673 | Bacteria | 15869 |
| 532 | Ga0495602_0071967 | 3300048088 | Bacteria | 2951 |
| 533 | Ga0496101_0001615 | 3300048904 | Bacteria | 13560 |
| 534 | Ga0496101_0010104 | 3300048904 | Bacteria | 6224 |
| 535 | Ga0496102_0008762 | 3300048905 | Bacteria | 8674 |
| 536 | Ga0496103_0109038 | 3300048906 | Bacteria | 1757 |
| 537 | Ga0496104_0172719 | 3300048907 | Bacteria | 2072 |
| 538 | Ga0496104_0517631 | 3300048907 | Bacteria | 1104 |
| 539 | Ga0496105_0004091 | 3300048908 | Bacteria | 10927 |
| 540 | Ga0496106_0077556 | 3300048909 | Bacteria | 2548 |
| 541 | Ga0496107_0153890 | 3300048910 | Bacteria | 1702 |
| 542 | Ga0496108_0034003 | 3300048911 | Bacteria | 4234 |
| 543 | Ga0496108_0182242 | 3300048911 | Bacteria | 1819 |
| 544 | Ga0496108_0255587 | 3300048911 | Bacteria | 1524 |
| 545 | Ga0496110_0090050 | 3300048913 | Bacteria | 2743 |
| 546 | Ga0496110_0121084 | 3300048913 | Bacteria | 2357 |
| 547 | Ga0496114_0178959 | 3300048917 | Bacteria | 1851 |
| 548 | Ga0496116_0000304 | 3300048919 | Bacteria | 82649 |
| 549 | Ga0496116_0000729 | 3300048919 | Bacteria | 41969 |
| 550 | Ga0496116_0005690 | 3300048919 | Bacteria | 11465 |
| 551 | Ga0496116_0019405 | 3300048919 | Bacteria | 5206 |
| 552 | Ga0496116_0088476 | 3300048919 | Bacteria | 1892 |
| 553 | Ga0496117_0000758 | 3300048920 | Bacteria | 50906 |
| 554 | Ga0496117_0005654 | 3300048920 | Bacteria | 13040 |
| 555 | Ga0496117_0041815 | 3300048920 | Bacteria | 3352 |
| 556 | Ga0496117_0113630 | 3300048920 | Bacteria | 1681 |
| 557 | Ga0496118_0000287 | 3300048921 | Bacteria | 88069 |
| 558 | Ga0496118_0014822 | 3300048921 | Bacteria | 7269 |
| 559 | Ga0496118_0037928 | 3300048921 | Bacteria | 3870 |
| 560 | Ga0496118_0076429 | 3300048921 | Bacteria | 2381 |
| 561 | Ga0496119_0000005 | 3300048922 | Bacteria | 529799 |
| 562 | Ga0496119_0010495 | 3300048922 | Bacteria | 7786 |
| 563 | Ga0496119_0050293 | 3300048922 | Bacteria | 2570 |
| 564 | Ga0496120_0000005 | 3300048923 | Bacteria | 529797 |
| 565 | Ga0496120_0005639 | 3300048923 | Bacteria | 9917 |
| 566 | Ga0496121_0000094 | 3300048924 | Bacteria | 212726 |
| 567 | Ga0496121_0013192 | 3300048924 | Bacteria | 8906 |
| 568 | Ga0496121_0016763 | 3300048924 | Bacteria | 7537 |
| 569 | Ga0496121_0021214 | 3300048924 | Bacteria | 6375 |
| 570 | Ga0496121_0181333 | 3300048924 | Bacteria | 1519 |
| 571 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 572 | Ga0496122_0011015 | 3300048925 | Bacteria | 9240 |
| 573 | Ga0496122_0017450 | 3300048925 | Bacteria | 6710 |
| 574 | Ga0496122_0083990 | 3300048925 | Bacteria | 2205 |
| 575 | Ga0496122_0184009 | 3300048925 | Bacteria | 1242 |
| 576 | Ga0496123_0000117 | 3300048926 | Bacteria | 161679 |
| 577 | Ga0496123_0008799 | 3300048926 | Bacteria | 9206 |
| 578 | Ga0496123_0026419 | 3300048926 | Bacteria | 4348 |
| 579 | Ga0496123_0042578 | 3300048926 | Bacteria | 3132 |
| 580 | Ga0496123_0085380 | 3300048926 | Bacteria | 1899 |
| 581 | Ga0496124_0005381 | 3300048927 | Bacteria | 14451 |
| 582 | Ga0496124_0012275 | 3300048927 | Bacteria | 8465 |
| 583 | Ga0496124_0015120 | 3300048927 | Bacteria | 7418 |
| 584 | Ga0496124_0022970 | 3300048927 | Bacteria | 5706 |
| 585 | Ga0496124_0059047 | 3300048927 | Bacteria | 3223 |
| 586 | Ga0496124_0133445 | 3300048927 | Bacteria | 1969 |
| 587 | Ga0496124_0177633 | 3300048927 | Bacteria | 1642 |
| 588 | Ga0496124_0255353 | 3300048927 | Bacteria | 1293 |
| 589 | Ga0496125_0000095 | 3300048928 | Bacteria | 208094 |
| 590 | Ga0496125_0001090 | 3300048928 | Bacteria | 41847 |
| 591 | Ga0496125_0018519 | 3300048928 | Bacteria | 6613 |
| 592 | Ga0496125_0020531 | 3300048928 | Bacteria | 6198 |
| 593 | Ga0496125_0024806 | 3300048928 | Bacteria | 5505 |
| 594 | Ga0496125_0031462 | 3300048928 | Bacteria | 4729 |
| 595 | Ga0496125_0034095 | 3300048928 | Bacteria | 4492 |
| 596 | Ga0496125_0098857 | 3300048928 | Bacteria | 2158 |
| 597 | Ga0496126_0028596 | 3300048929 | Bacteria | 5310 |
| 598 | Ga0496126_0031309 | 3300048929 | Bacteria | 5029 |
| 599 | Ga0496126_0100799 | 3300048929 | Bacteria | 2527 |
| 600 | Ga0496126_0156078 | 3300048929 | Bacteria | 1953 |
| 601 | Ga0501072_0253641 | 3300049588 | Bacteria | 1401 |
| 602 | Ga0501223_003419 | 3300049663 | Bacteria | 3462 |
| 603 | Ga0501249_001925 | 3300049679 | Bacteria | 4220 |
| 604 | Ga0501225_0003451 | 3300049705 | Bacteria | 4781 |
| 605 | Ga0501035_0123926 | 3300049822 | Bacteria | 2257 |
| 606 | Ga0501044_0115367 | 3300049823 | Bacteria | 2691 |
| 607 | nmdc:mga03683_63052_c1 | 3300050489 | Bacteria | 1571 |
| 608 | nmdc:mga03683_71584_c1 | 3300050489 | Bacteria | 1013 |
| 609 | nmdc:mga03n38_53556_c1 | 3300050490 | Bacteria | 1810 |
| 610 | nmdc:mga00v17_114866_c1 | 3300050491 | Bacteria | 1710 |
| 611 | nmdc:mga00v17_32654_c1 | 3300050491 | Bacteria | 3078 |
| 612 | nmdc:mga00v17_55685_c1 | 3300050491 | Bacteria | 2416 |
| 613 | nmdc:mga00v17_8339_c1 | 3300050491 | Bacteria | 5576 |
| 614 | nmdc:mga0yw44_2633_c1 | 3300050492 | Bacteria | 7729 |
| 615 | nmdc:mga0yw44_341726_c1 | 3300050492 | Bacteria | 1007 |
| 616 | nmdc:mga0k408_150105_c1 | 3300050493 | Bacteria | 1388 |
| 617 | nmdc:mga0k408_2956_c1 | 3300050493 | Bacteria | 9007 |
| 618 | nmdc:mga0k408_33655_c1 | 3300050493 | Bacteria | 2932 |
| 619 | nmdc:mga0k408_3371_c1 | 3300050493 | Bacteria | 8464 |
| 620 | nmdc:mga0k408_40214_c1 | 3300050493 | Bacteria | 2689 |
| 621 | nmdc:mga0k408_4893_c1 | 3300050493 | Bacteria | 7104 |
| 622 | nmdc:mga06z11_22419_c1 | 3300050494 | Bacteria | 2949 |
| 623 | nmdc:mga07m45_111501_c1 | 3300050496 | Bacteria | 1576 |
| 624 | nmdc:mga07m45_14094_c1 | 3300050496 | Bacteria | 4253 |
| 625 | nmdc:mga07m45_401_c1 | 3300050496 | Bacteria | 17879 |
| 626 | nmdc:mga07m45_4350_c1 | 3300050496 | Bacteria | 6929 |
| 627 | nmdc:mga07m45_9111_c1 | 3300050496 | Bacteria | 5128 |
| 628 | nmdc:mga09592_279_c1 | 3300050508 | Bacteria | 37141 |
| 629 | nmdc:mga0qj67_25028_c1 | 3300050509 | Bacteria | 4607 |
| 630 | Ga0500643_004351 | 3300053087 | Bacteria | 6447 |
| 631 | Ga0500643_004392 | 3300053087 | Bacteria | 6398 |
| 632 | Ga0500644_0033838 | 3300053088 | Bacteria | 1644 |
| 633 | Ga0500651_0014707 | 3300053093 | Bacteria | 4791 |
| 634 | Ga0500566_0048225 | 3300053094 | Bacteria | 2443 |
| 635 | Ga0500562_003136 | 3300053108 | Bacteria | 4129 |
| 636 | Ga0500562_019951 | 3300053108 | Bacteria | 1738 |
| 637 | Ga0500571_000027 | 3300053110 | Bacteria | 51623 |
| 638 | Ga0500608_002433 | 3300053122 | Bacteria | 6769 |
| 639 | Ga0500608_035318 | 3300053122 | Bacteria | 2384 |
| 640 | Ga0500655_000333 | 3300053133 | Bacteria | 10412 |
| 641 | Ga0500658_0000114 | 3300053134 | Bacteria | 38111 |
| 642 | Ga0500658_0000684 | 3300053134 | Bacteria | 13995 |
| 643 | Ga0500559_0014205 | 3300053136 | Bacteria | 3365 |
| 644 | Ga0500568_0002311 | 3300053139 | Bacteria | 11314 |
| 645 | Ga0500574_009494 | 3300053141 | Bacteria | 2115 |
| 646 | Ga0500634_0001368 | 3300053161 | Bacteria | 9389 |
| 647 | Ga0500634_0008187 | 3300053161 | Bacteria | 5213 |
| 648 | Ga0500638_001743 | 3300053162 | Bacteria | 7106 |
| 649 | Ga0500636_0001401 | 3300053177 | Bacteria | 13118 |
| 650 | 2548500900 | 2547132374 | Bacteria | 5530232 |
| 651 | 2599626028 | 2599185214 | Bacteria | 8209958 |
| 652 | 2599674890 | 2599185226 | Bacteria | 8233575 |
| 653 | 2599683784 | 2599185227 | Bacteria | 8246414 |
| 654 | 2599695613 | 2599185229 | Bacteria | 8216126 |
| 655 | 2599903528 | 2599185292 | Bacteria | 6290804 |
| 656 | 2599926831 | 2599185299 | Bacteria | 4854625 |
| 657 | 2643866599 | 2643221570 | Bacteria | 5103772 |
| 658 | 2643991420 | 2643221596 | Bacteria | 5006805 |
| 659 | 2644062805 | 2643221609 | Bacteria | 6756331 |
| 660 | 2644076700 | 2643221611 | Bacteria | 6820941 |
| 661 | 2644296347 | 2643221652 | Bacteria | 5140275 |
| 662 | 2644400135 | 2643221672 | Bacteria | 6322190 |
| 663 | 2644647695 | 2643221717 | Bacteria | 5676132 |
| 664 | 2650896069 | 2648501693 | Bacteria | 5069560 |
| 665 | 2686356759 | 2684622997 | Bacteria | 4624240 |
| 666 | 2722883298 | 2721755523 | Bacteria | 6430384 |
| 667 | 2738720865 | 2738541277 | Bacteria | 7458140 |
| 668 | 2739244520 | 2738543012 | Bacteria | 7115078 |
| 669 | 2739248378 | 2738543013 | Bacteria | 5618633 |
| 670 | 2739280064 | 2738543019 | Bacteria | 7459457 |
| 671 | 2809127268 | 2808606414 | Bacteria | 4917181 |
| 672 | 2816474016 | 2816332133 | Bacteria | 7249298 |
| 673 | 2819600298 | 2818991446 | Bacteria | 7757362 |
| 674 | 2831271908 | 2831265667 | Bacteria | 7184833 |
| 675 | 2838059746 | 2838054893 | Bacteria | 7451788 |
| 676 | 2839143756 | 2839138175 | Bacteria | 6549354 |
| 677 | 2842682371 | 2842677519 | Bacteria | 5615038 |
| 678 | 2842719146 | 2842718218 | Bacteria | 4560148 |
| 679 | 2847798650 | 2847797336 | Bacteria | 5176640 |
| 680 | 2881104736 | 2881101125 | Bacteria | 4590519 |
| 681 | 2899928527 | 2899924645 | Bacteria | 7487985 |
| 682 | 2904453654 | 2904449895 | Bacteria | 6927402 |
| 683 | 2904459050 | 2904456579 | Bacteria | 6819253 |
| 684 | 2904483817 | 2904479285 | Bacteria | 5073931 |
| 685 | 2904549625 | 2904541872 | Bacteria | 8915136 |
| 686 | 2919705136 | 2919704043 | Bacteria | 5560311 |
| 687 | 2928041452 | 2928037797 | Bacteria | 7273642 |
| 688 | 2928048294 | 2928044640 | Bacteria | 7271509 |
| 689 | 2928055519 | 2928051484 | Bacteria | 7773759 |
| 690 | 2928056134 | 2928051484 | Bacteria | 7773759 |
| 691 | 2928066386 | 2928064002 | Bacteria | 7419480 |
| 692 | 2928076199 | 2928070936 | Bacteria | 8062541 |
| 693 | 2928086211 | 2928084124 | Bacteria | 7159212 |
| 694 | 2929166625 | 2929160207 | Bacteria | 9075316 |
| 695 | 2929524279 | 2929520902 | Bacteria | 6765052 |
| 696 | 2939606343 | 2939602548 | Bacteria | 4950493 |
| 697 | 2941484464 | |||
| 698 | 2954768038 | 2954767861 | Bacteria | 5535784 |
| 699 | 2974323296 | 2974320154 | Bacteria | 4571377 |
| 700 | 2984497869 | 2984494565 | Bacteria | 5000175 |
| 701 | 2990265372 | 2990261002 | Bacteria | 4919493 |
| 702 | 2990712212 | 2990710928 | Bacteria | 5002431 |
| 703 | 8048749446 | 8048746797 | Bacteria | 3557226 |
| 704 | 8055228530 | 8055225921 | Bacteria | 3341787 |
| 705 | Ga0495676_0148827 | |||
| 706 | JGI24739J22299_10000552 | |||
| 707 | JGI25152J39213_1004142 | |||
| 708 | JGI25150J39212_1000775 | |||
| 709 | JGI25159J45721_1001723 | |||
| 710 | JGI25151J46595_10001812 | |||
| 711 | JGI25151J46595_10007029 | |||
| 712 | JGI25153J46596_10004018 | |||
| 713 | rootH1_10004795 | |||
| 714 | rootH2_10062676 | |||
| 715 | rootL2_10002392 | |||
| 716 | rootL2_10002696 | |||
| 717 | rootH1_10015486 | |||
| 718 | JGI25160J50197_1005064 | |||
| 719 | JGI25160J50197_1005195 | |||
| 720 | JGI25161J50226_1001404 | |||
| 721 | JGI25161J50226_1002166 | |||
| 722 | Ga0055542_1000127 | |||
| 723 | Ga0055529_1001542 | |||
| 724 | Ga0055526_1007653 | |||
| 725 | Ga0055526_1012185 | |||
| 726 | Ga0055537_1002831 | |||
| 727 | Ga0055524_1005618 | |||
| 728 | Ga0055524_1005619 | |||
| 729 | Ga0055536_1001127 | |||
| 730 | Ga0055536_1002533 | |||
| 731 | Ga0055536_1007829 | |||
| 732 | Ga0055534_1002993 | |||
| 733 | Ga0055534_1004483 | |||
| 734 | Ga0055528_1005990 | |||
| 735 | Ga0055530_10000503 | |||
| 736 | Ga0055530_10009571 | |||
| 737 | Ga0055540_1000142 | |||
| 738 | Ga0055540_1001148 | |||
| 739 | Ga0055540_1002310 | |||
| 740 | Ga0055540_1023554 | |||
| 741 | Ga0055531_10000424 | |||
| 742 | Ga0055531_10001995 | |||
| 743 | Ga0058692_1001362 | |||
| 744 | Ga0058692_1002854 | |||
| 745 | Ga0055543_1000926 | |||
| 746 | Ga0065165_1002808 | |||
| 747 | Ga0065714_10068311 | |||
| 748 | Ga0065704_10081506 | |||
| 749 | Ga0070676_10004601 | |||
| 750 | Ga0070676_10255136 | |||
| 751 | Ga0070690_100009433 | |||
| 752 | Ga0070690_100047880 | |||
| 753 | Ga0070670_100039904 | |||
| 754 | Ga0070670_100309315 | |||
| 755 | Ga0070670_100368063 | |||
| 756 | Ga0070677_10014435 | |||
| 757 | Ga0070677_10016655 | |||
| 758 | Ga0070677_10030919 | |||
| 759 | Ga0068869_100011077 | |||
| 760 | Ga0068869_100012518 | |||
| 761 | Ga0068869_100031362 | |||
| 762 | Ga0068869_100216971 | |||
| 763 | Ga0070666_10020203 | |||
| 764 | Ga0070666_10039876 | |||
| 765 | Ga0070666_10181550 | |||
| 766 | Ga0068868_100037908 | |||
| 767 | Ga0068868_100056382 | |||
| 768 | Ga0068868_100067906 | |||
| 769 | Ga0070689_100027295 | |||
| 770 | Ga0070668_100005095 | |||
| 771 | Ga0070668_100168716 | |||
| 772 | Ga0070669_100003928 | |||
| 773 | Ga0070669_100039927 | |||
| 774 | Ga0070675_100000867 | |||
| 775 | Ga0070675_100002412 | |||
| 776 | Ga0070675_100081791 | |||
| 777 | Ga0070671_100007799 | |||
| 778 | Ga0070671_100042525 | |||
| 779 | Ga0070671_100048851 | |||
| 780 | Ga0070671_100364888 | |||
| 781 | Ga0070674_100002652 | |||
| 782 | Ga0070674_100004011 | |||
| 783 | Ga0070674_100014171 | |||
| 784 | Ga0070674_100025028 | |||
| 785 | Ga0070674_100034062 | |||
| 786 | Ga0070674_100184332 | |||
| 787 | Ga0070673_100000636 | |||
| 788 | Ga0070673_100003720 | |||
| 789 | Ga0070673_100040145 | |||
| 790 | Ga0070673_100048465 | |||
| 791 | Ga0070673_100057850 | |||
| 792 | Ga0070688_100045989 | |||
| 793 | Ga0070667_100003829 | |||
| 794 | Ga0070667_100006773 | |||
| 795 | Ga0070667_100025932 | |||
| 796 | Ga0070667_100050962 | |||
| 797 | Ga0070667_100163180 | |||
| 798 | Ga0070667_100181353 | |||
| 799 | Ga0070700_100243249 | |||
| 800 | Ga0070663_100262258 | |||
| 801 | Ga0070678_100028216 | |||
| 802 | Ga0070678_100147670 | |||
| 803 | Ga0070662_100009155 | |||
| 804 | Ga0070662_100037335 | |||
| 805 | Ga0070662_100067213 | |||
| 806 | Ga0068867_100002629 | |||
| 807 | Ga0068867_100016573 | |||
| 808 | Ga0068867_100019670 | |||
| 809 | Ga0068867_100072857 | |||
| 810 | Ga0068867_100260904 | |||
| 811 | Ga0068853_100088254 | |||
| 812 | Ga0068853_100308470 | |||
| 813 | Ga0068853_100395500 | |||
| 814 | Ga0070672_100010747 | |||
| 815 | Ga0070672_100014574 | |||
| 816 | Ga0070672_100031629 | |||
| 817 | Ga0070672_100036062 | |||
| 818 | Ga0070672_100043078 | |||
| 819 | Ga0070672_100066213 | |||
| 820 | Ga0070686_100074145 | |||
| 821 | Ga0070665_100028335 | |||
| 822 | Ga0070665_100579392 | |||
| 823 | Ga0070664_100040055 | |||
| 824 | Ga0070664_100066038 | |||
| 825 | Ga0068857_100048003 | |||
| 826 | Ga0068857_100124186 | |||
| 827 | Ga0068852_100048760 | |||
| 828 | Ga0068852_100052408 | |||
| 829 | Ga0068852_100113707 | |||
| 830 | Ga0068859_100059297 | |||
| 831 | Ga0068859_100077867 | |||
| 832 | Ga0068864_100001800 | |||
| 833 | Ga0068864_100005187 | |||
| 834 | Ga0068864_100071025 | |||
| 835 | Ga0068866_10010784 | |||
| 836 | Ga0068866_10047177 | |||
| 837 | Ga0068861_100001031 | |||
| 838 | Ga0068861_100006400 | |||
| 839 | Ga0068851_10026313 | |||
| 840 | Ga0068851_10032297 | |||
| 841 | Ga0068851_10083326 | |||
| 842 | Ga0068851_10106335 | |||
| 843 | Ga0068870_10114408 | |||
| 844 | Ga0068863_100001722 | |||
| 845 | Ga0068863_100006998 | |||
| 846 | Ga0068863_100044836 | |||
| 847 | Ga0068858_100010139 | |||
| 848 | Ga0068858_100034855 | |||
| 849 | Ga0068858_100035822 | |||
| 850 | Ga0068860_100001567 | |||
| 851 | Ga0068860_100052678 | |||
| 852 | Ga0068860_100135208 | |||
| 853 | Ga0068862_100025291 | |||
| 854 | Ga0068862_100438050 | |||
| 855 | Ga0075365_10047672 | |||
| 856 | Ga0075364_10001315 | |||
| 857 | Ga0075364_10005633 | |||
| 858 | Ga0075364_10048211 | |||
| 859 | Ga0075364_10176634 | |||
| 860 | Ga0075432_10033182 | |||
| 861 | Ga0075362_10006037 | |||
| 862 | Ga0075362_10007293 | |||
| 863 | Ga0075362_10035060 | |||
| 864 | Ga0075367_10033860 | |||
| 865 | Ga0075367_10161354 | |||
| 866 | Ga0075369_10005814 | |||
| 867 | Ga0075369_10018982 | |||
| 868 | Ga0075369_10038661 | |||
| 869 | Ga0075366_10004402 | |||
| 870 | Ga0075366_10004730 | |||
| 871 | Ga0075366_10005398 | |||
| 872 | Ga0075366_10016652 | |||
| 873 | Ga0075366_10185094 | |||
| 874 | Ga0097621_100020094 | |||
| 875 | Ga0097621_100030205 | |||
| 876 | Ga0075370_10000362 | |||
| 877 | Ga0075370_10002990 | |||
| 878 | Ga0075370_10018538 | |||
| 879 | Ga0075370_10042180 | |||
| 880 | Ga0068871_100017041 | |||
| 881 | Ga0068871_100075544 | |||
| 882 | Ga0075430_100069041 | |||
| 883 | Ga0075429_100003836 | |||
| 884 | Ga0068865_100022269 | |||
| 885 | Ga0068865_100025301 | |||
| 886 | Ga0097620_100059296 | |||
| 887 | Ga0097620_100077866 | |||
| 888 | Ga0099826_10000023 | |||
| 889 | Ga0099826_10007158 | |||
| 890 | Ga0105251_10002295 | |||
| 891 | Ga0105244_10003718 | |||
| 892 | Ga0105244_10010700 | |||
| 893 | Ga0105244_10059140 | |||
| 894 | Ga0105250_10022124 | |||
| 895 | Ga0105240_10084452 | |||
| 896 | Ga0105243_10001727 | |||
| 897 | Ga0105243_10005672 | |||
| 898 | Ga0105243_10034866 | |||
| 899 | Ga0105243_10224972 | |||
| 900 | Ga0105243_10290919 | |||
| 901 | Ga0105243_10458779 | |||
| 902 | Ga0105241_10332306 | |||
| 903 | Ga0105242_10012717 | |||
| 904 | Ga0105242_10035627 | |||
| 905 | Ga0105242_10090084 | |||
| 906 | Ga0105242_10129670 | |||
| 907 | Ga0105242_10137976 | |||
| 908 | Ga0105248_10026525 | |||
| 909 | Ga0105248_10063935 | |||
| 910 | Ga0105248_10100638 | |||
| 911 | Ga0105248_10172139 | |||
| 912 | Ga0105237_10017444 | |||
| 913 | Ga0105237_10113208 | |||
| 914 | Ga0105238_10357550 | |||
| 915 | Ga0105249_10009014 | |||
| 916 | Ga0105249_10024652 | |||
| 917 | Ga0105249_10251733 | |||
| 918 | Ga0105249_10547546 | |||
| 919 | Ga0105239_10754298 | |||
| 920 | Ga0105246_10071291 | |||
| 921 | Ga0157371_10103405 | |||
| 922 | Ga0157370_10000355 | |||
| 923 | Ga0157370_10005163 | |||
| 924 | Ga0157370_10053102 | |||
| 925 | Ga0157369_10370154 | |||
| 926 | Ga0157374_10219804 | |||
| 927 | Ga0157374_10359856 | |||
| 928 | Ga0157374_10669180 | |||
| 929 | Ga0157378_10007266 | |||
| 930 | Ga0157378_10032465 | |||
| 931 | Ga0163162_10004491 | |||
| 932 | Ga0163162_10035520 | |||
| 933 | Ga0163162_10293408 | |||
| 934 | Ga0157372_10454691 | |||
| 935 | Ga0157375_10008158 | |||
| 936 | Ga0157375_10077926 | |||
| 937 | Ga0157375_10082197 | |||
| 938 | Ga0157375_10087913 | |||
| 939 | Ga0163163_10004780 | |||
| 940 | Ga0157380_10002852 | |||
| 941 | Ga0157380_10014614 | |||
| 942 | Ga0157380_10056853 | |||
| 943 | Ga0157380_10077947 | |||
| 944 | Ga0157380_10173652 | |||
| 945 | Ga0182008_10000256 | |||
| 946 | Ga0182008_10002592 | |||
| 947 | Ga0182008_10022441 | |||
| 948 | Ga0182008_10022563 | |||
| 949 | Ga0182008_10064590 | |||
| 950 | Ga0182008_10077486 | |||
| 951 | Ga0182008_10119892 | |||
| 952 | Ga0157379_10021478 | |||
| 953 | Ga0157379_10046143 | |||
| 954 | Ga0157379_10070070 | |||
| 955 | Ga0157379_10123835 | |||
| 956 | Ga0157376_10018109 | |||
| 957 | Ga0157376_10022136 | |||
| 958 | Ga0182006_1006572 | |||
| 959 | Ga0182006_1008663 | |||
| 960 | Ga0182007_10004924 | |||
| 961 | Ga0182007_10015558 | |||
| 962 | Ga0182007_10041432 | |||
| 963 | Ga0163161_10000201 | |||
| 964 | Ga0163161_10058971 | |||
| 965 | Ga0163161_10065023 | |||
| 966 | Ga0163161_10072444 | |||
| 967 | Ga0213876_10060896 | |||
| 968 | Ga0209436_102685 | |||
| 969 | Ga0209436_105024 | |||
| 970 | Ga0209672_100172 | |||
| 971 | Ga0209147_100934 | |||
| 972 | Ga0209258_100078 | |||
| 973 | Ga0209258_102336 | |||
| 974 | Ga0207425_1000220 | |||
| 975 | Ga0207425_1011013 | |||
| 976 | Ga0209148_1000086 | |||
| 977 | Ga0209129_1000707 | |||
| 978 | Ga0209129_1000904 | |||
| 979 | Ga0209129_1001750 | |||
| 980 | Ga0209565_1000193 | |||
| 981 | Ga0209565_1006038 | |||
| 982 | Ga0209673_1000168 | |||
| 983 | Ga0209673_1000355 | |||
| 984 | Ga0209130_1000810 | |||
| 985 | Ga0209130_1001236 | |||
| 986 | Ga0209130_1001907 | |||
| 987 | Ga0209675_1001053 | |||
| 988 | Ga0209675_1001228 | |||
| 989 | Ga0209675_1007200 | |||
| 990 | Ga0209676_1000103 | |||
| 991 | Ga0209676_1000152 | |||
| 992 | Ga0209676_1010674 | |||
| 993 | Ga0209676_1023532 | |||
| 994 | Ga0209025_1000201 | |||
| 995 | Ga0209025_1000839 | |||
| 996 | Ga0209025_1014376 | |||
| 997 | Ga0209025_1045127 | |||
| 998 | Ga0209564_1000289 | |||
| 999 | Ga0209564_1000391 | |||
| 1000 | Ga0209758_1000034 | |||
| 1001 | Ga0209758_1007283 | |||
| 1002 | Ga0209758_1020465 | |||
| 1003 | Ga0209050_1000012 | |||
| 1004 | Ga0209050_1000210 | |||
| 1005 | Ga0209050_1004904 | |||
| 1006 | Ga0209256_1000066 | |||
| 1007 | Ga0209256_1000318 | |||
| 1008 | Ga0207426_1000067 | |||
| 1009 | Ga0207426_1000266 | |||
| 1010 | Ga0209051_1000019 | |||
| 1011 | Ga0209051_1000074 | |||
| 1012 | Ga0209051_1001472 | |||
| 1013 | Ga0209051_1003040 | |||
| 1014 | Ga0209051_1017090 | |||
| 1015 | Ga0209257_1000024 | |||
| 1016 | Ga0209257_1000072 | |||
| 1017 | Ga0209257_1004029 | |||
| 1018 | Ga0207697_10009122 | |||
| 1019 | Ga0207656_10152662 | |||
| 1020 | Ga0207655_1079783 | |||
| 1021 | Ga0207713_1016462 | |||
| 1022 | Ga0207682_10004300 | |||
| 1023 | Ga0207682_10014163 | |||
| 1024 | Ga0207682_10021127 | |||
| 1025 | Ga0207682_10034152 | |||
| 1026 | Ga0207682_10040471 | |||
| 1027 | Ga0207642_10003819 | |||
| 1028 | Ga0207642_10097159 | |||
| 1029 | Ga0207688_10053187 | |||
| 1030 | Ga0207680_10000628 | |||
| 1031 | Ga0207680_10010325 | |||
| 1032 | Ga0207645_10018671 | |||
| 1033 | Ga0207645_10019539 | |||
| 1034 | Ga0207645_10086866 | |||
| 1035 | Ga0207643_10070697 | |||
| 1036 | Ga0207643_10106003 | |||
| 1037 | Ga0207695_10360671 | |||
| 1038 | Ga0207671_10098311 | |||
| 1039 | Ga0207681_10001666 | |||
| 1040 | Ga0207681_10005868 | |||
| 1041 | Ga0207681_10045496 | |||
| 1042 | Ga0207681_10141502 | |||
| 1043 | Ga0207694_10157975 | |||
| 1044 | Ga0207694_10226237 | |||
| 1045 | Ga0207650_10000395 | |||
| 1046 | Ga0207650_10005656 | |||
| 1047 | Ga0207650_10056569 | |||
| 1048 | Ga0207650_10189814 | |||
| 1049 | Ga0207650_10295487 | |||
| 1050 | Ga0207659_10000361 | |||
| 1051 | Ga0207659_10001382 | |||
| 1052 | Ga0207659_10027036 | |||
| 1053 | Ga0207659_10109655 | |||
| 1054 | Ga0207644_10009812 | |||
| 1055 | Ga0207644_10021084 | |||
| 1056 | Ga0207644_10056053 | |||
| 1057 | Ga0207706_10031298 | |||
| 1058 | Ga0207706_10046097 | |||
| 1059 | Ga0207706_10092563 | |||
| 1060 | Ga0207706_10278116 | |||
| 1061 | Ga0207686_10018549 | |||
| 1062 | Ga0207686_10032970 | |||
| 1063 | Ga0207686_10101825 | |||
| 1064 | Ga0207709_10000112 | |||
| 1065 | Ga0207709_10000999 | |||
| 1066 | Ga0207709_10012395 | |||
| 1067 | Ga0207709_10088800 | |||
| 1068 | Ga0207709_10239737 | |||
| 1069 | Ga0207669_10008907 | |||
| 1070 | Ga0207669_10010328 | |||
| 1071 | Ga0207669_10011808 | |||
| 1072 | Ga0207669_10016396 | |||
| 1073 | Ga0207704_10003637 | |||
| 1074 | Ga0207704_10097920 | |||
| 1075 | Ga0207691_10000792 | |||
| 1076 | Ga0207691_10013268 | |||
| 1077 | Ga0207691_10047144 | |||
| 1078 | Ga0207691_10047772 | |||
| 1079 | Ga0207691_10054700 | |||
| 1080 | Ga0207691_10104190 | |||
| 1081 | Ga0207711_10004659 | |||
| 1082 | Ga0207711_10008644 | |||
| 1083 | Ga0207711_10021685 | |||
| 1084 | Ga0207711_10109609 | |||
| 1085 | Ga0207689_10006875 | |||
| 1086 | Ga0207689_10027313 | |||
| 1087 | Ga0207689_10041585 | |||
| 1088 | Ga0207689_10455466 | |||
| 1089 | Ga0207661_10039909 | |||
| 1090 | Ga0207679_10030948 | |||
| 1091 | Ga0207679_10239356 | |||
| 1092 | Ga0207667_10018380 | |||
| 1093 | Ga0207651_10000398 | |||
| 1094 | Ga0207651_10020813 | |||
| 1095 | Ga0207651_10155595 | |||
| 1096 | Ga0207712_10009514 | |||
| 1097 | Ga0207712_10027282 | |||
| 1098 | Ga0207668_10008172 | |||
| 1099 | Ga0207668_10045220 | |||
| 1100 | Ga0207668_10055915 | |||
| 1101 | Ga0207640_10043615 | |||
| 1102 | Ga0207640_10271795 | |||
| 1103 | Ga0207658_10002681 | |||
| 1104 | Ga0207658_10007158 | |||
| 1105 | Ga0207658_10070074 | |||
| 1106 | Ga0207658_10080443 | |||
| 1107 | Ga0207658_10241606 | |||
| 1108 | Ga0207677_10012056 | |||
| 1109 | Ga0207677_10054957 | |||
| 1110 | Ga0207677_10592005 | |||
| 1111 | Ga0207703_10008523 | |||
| 1112 | Ga0207703_10090385 | |||
| 1113 | Ga0207639_10107200 | |||
| 1114 | Ga0207639_10144464 | |||
| 1115 | Ga0207639_10370319 | |||
| 1116 | Ga0207678_10019463 | |||
| 1117 | Ga0207678_10127924 | |||
| 1118 | Ga0207708_10016701 | |||
| 1119 | Ga0207641_10004010 | |||
| 1120 | Ga0207641_10006561 | |||
| 1121 | Ga0207648_10002731 | |||
| 1122 | Ga0207648_10005525 | |||
| 1123 | Ga0207648_10020733 | |||
| 1124 | Ga0207648_10020894 | |||
| 1125 | Ga0207648_10043492 | |||
| 1126 | Ga0207648_10064840 | |||
| 1127 | Ga0207648_10065521 | |||
| 1128 | Ga0207676_10000082 | |||
| 1129 | Ga0207676_10013301 | |||
| 1130 | Ga0207676_10026597 | |||
| 1131 | Ga0207676_10032458 | |||
| 1132 | Ga0207674_10060789 | |||
| 1133 | Ga0207674_10079187 | |||
| 1134 | Ga0207675_100012003 | |||
| 1135 | Ga0207675_100034565 | |||
| 1136 | Ga0207683_10008053 | |||
| 1137 | Ga0207683_10008094 | |||
| 1138 | Ga0207683_10050736 | |||
| 1139 | Ga0207683_10060353 | |||
| 1140 | Ga0207683_10102470 | |||
| 1141 | Ga0207683_10156837 | |||
| 1142 | Ga0207698_10004335 | |||
| 1143 | Ga0207698_10118371 | |||
| 1144 | Ga0207698_10137730 | |||
| 1145 | Ga0209371_1000363 | |||
| 1146 | Ga0209371_1002523 | |||
| 1147 | Ga0209371_1002974 | |||
| 1148 | Ga0209371_1003137 | |||
| 1149 | Ga0209282_1000047 | |||
| 1150 | Ga0268266_10035509 | |||
| 1151 | Ga0268265_10010659 | |||
| 1152 | Ga0268264_10004490 | |||
| 1153 | Ga0268264_10009726 | |||
| 1154 | Ga0268264_10103159 | |||
| 1155 | Ga0268264_10106096 | |||
| 1156 | Ga0307515_10000034 | |||
| 1157 | Ga0268256_1000310 | |||
| 1158 | Ga0268256_1002626 | |||
| 1159 | Ga0268256_1008491 | |||
| 1160 | Ga0316176_1073913 | |||
| 1161 | Ga0314311_1007068 | |||
| 1162 | Ga0316178_1083134 | |||
| 1163 | Ga0316183_1021165 | |||
| 1164 | Ga0316181_1009424 | |||
| 1165 | Ga0316182_1260907 | |||
| 1166 | Ga0316182_1320483 | |||
| 1167 | Ga0265327_10001420 | |||
| 1168 | Ga0307513_10064270 | |||
| 1169 | Ga0307408_100000048 | |||
| 1170 | Ga0307408_100113357 | |||
| 1171 | Ga0307514_10000241 | |||
| 1172 | Ga0307405_10011663 | |||
| 1173 | Ga0307405_10410872 | |||
| 1174 | Ga0307406_10000575 | |||
| 1175 | Ga0307406_10018312 | |||
| 1176 | Ga0307416_100029109 | |||
| 1177 | Ga0307416_100213790 | |||
| 1178 | Ga0307414_10272388 | |||
| 1179 | Ga0307507_10200504 | |||
| 1180 | Ga0395899_0006393 | |||
| 1181 | Ga0395900_0007035 | |||
| 1182 | Ga0395900_0273614 | |||
| 1183 | Ga0395900_0424486 | |||
| 1184 | Ga0395898_0005299 | |||
| 1185 | Ga0395905_0004239 | |||
| 1186 | Ga0395905_0134957 | |||
| 1187 | Ga0395905_0234994 | |||
| 1188 | Ga0395901_0034987 | |||
| 1189 | Ga0436365_0619898 | |||
| 1190 | Ga0436361_0335889 | |||
| 1191 | Ga0439436_0011989 | |||
| 1192 | Ga0451797_0267875 | |||
| 1193 | Ga0439442_002996 | |||
| 1194 | Ga0439452_000068 | |||
| 1195 | Ga0450911_000137 | |||
| 1196 | Ga0450923_005756 | |||
| 1197 | Ga0450898_006422 | |||
| 1198 | Ga0450898_013362 | |||
| 1199 | Ga0450906_015339 | |||
| 1200 | Ga0450910_015556 | |||
| 1201 | Ga0439434_0007810 | |||
| 1202 | Ga0439464_0013440 | |||
| 1203 | Ga0439464_0045304 | |||
| 1204 | Ga0450918_001088 | |||
| 1205 | Ga0450893_0016946 | |||
| 1206 | Ga0495627_034134 | |||
| 1207 | Ga0495590_0005754 | |||
| 1208 | Ga0495638_0028297 | |||
| 1209 | Ga0495639_0038848 | |||
| 1210 | Ga0495584_0090492 | |||
| 1211 | Ga0495610_0029518 | |||
| 1212 | Ga0495616_0000820 | |||
| 1213 | Ga0495620_0103668 | |||
| 1214 | Ga0495631_0001019 | |||
| 1215 | Ga0495637_0021953 | |||
| 1216 | Ga0495643_0008246 | |||
| 1217 | Ga0495643_0119533 | |||
| 1218 | Ga0495666_0029775 | |||
| 1219 | Ga0495654_0014840 | |||
| 1220 | Ga0495598_0010884 | |||
| 1221 | Ga0495621_0021875 | |||
| 1222 | Ga0495621_0058383 | |||
| 1223 | Ga0495597_0000271 | |||
| 1224 | Ga0495597_0003723 | |||
| 1225 | Ga0495597_0105947 | |||
| 1226 | Ga0495668_0051859 | |||
| 1227 | Ga0495625_0092173 | |||
| 1228 | Ga0495625_0184002 | |||
| 1229 | Ga0495661_0002118 | |||
| 1230 | Ga0495658_0139595 | |||
| 1231 | Ga0495604_0013867 | |||
| 1232 | Ga0495676_0001369 | |||
| 1233 | Ga0495687_000196 | |||
| 1234 | Ga0495687_004760 | |||
| 1235 | Ga0495593_0001089 | |||
| 1236 | Ga0495602_0071967 | |||
| 1237 | Ga0496101_0001615 | |||
| 1238 | Ga0496101_0010104 | |||
| 1239 | Ga0496102_0008762 | |||
| 1240 | Ga0496103_0109038 | |||
| 1241 | Ga0496104_0172719 | |||
| 1242 | Ga0496104_0517631 | |||
| 1243 | Ga0496105_0004091 | |||
| 1244 | Ga0496106_0077556 | |||
| 1245 | Ga0496107_0153890 | |||
| 1246 | Ga0496108_0034003 | |||
| 1247 | Ga0496108_0182242 | |||
| 1248 | Ga0496108_0255587 | |||
| 1249 | Ga0496110_0090050 | |||
| 1250 | Ga0496110_0121084 | |||
| 1251 | Ga0496114_0178959 | |||
| 1252 | Ga0496116_0000304 | |||
| 1253 | Ga0496116_0000729 | |||
| 1254 | Ga0496116_0005690 | |||
| 1255 | Ga0496116_0019405 | |||
| 1256 | Ga0496116_0088476 | |||
| 1257 | Ga0496117_0000758 | |||
| 1258 | Ga0496117_0005654 | |||
| 1259 | Ga0496117_0041815 | |||
| 1260 | Ga0496117_0113630 | |||
| 1261 | Ga0496118_0000287 | |||
| 1262 | Ga0496118_0014822 | |||
| 1263 | Ga0496118_0037928 | |||
| 1264 | Ga0496118_0076429 | |||
| 1265 | Ga0496119_0000005 | |||
| 1266 | Ga0496119_0010495 | |||
| 1267 | Ga0496119_0050293 | |||
| 1268 | Ga0496120_0000005 | |||
| 1269 | Ga0496120_0005639 | |||
| 1270 | Ga0496121_0000094 | |||
| 1271 | Ga0496121_0013192 | |||
| 1272 | Ga0496121_0016763 | |||
| 1273 | Ga0496121_0021214 | |||
| 1274 | Ga0496121_0181333 | |||
| 1275 | Ga0496122_0000063 | |||
| 1276 | Ga0496122_0011015 | |||
| 1277 | Ga0496122_0017450 | |||
| 1278 | Ga0496122_0083990 | |||
| 1279 | Ga0496122_0184009 | |||
| 1280 | Ga0496123_0000117 | |||
| 1281 | Ga0496123_0008799 | |||
| 1282 | Ga0496123_0026419 | |||
| 1283 | Ga0496123_0042578 | |||
| 1284 | Ga0496123_0085380 | |||
| 1285 | Ga0496124_0005381 | |||
| 1286 | Ga0496124_0012275 | |||
| 1287 | Ga0496124_0015120 | |||
| 1288 | Ga0496124_0022970 | |||
| 1289 | Ga0496124_0059047 | |||
| 1290 | Ga0496124_0133445 | |||
| 1291 | Ga0496124_0177633 | |||
| 1292 | Ga0496124_0255353 | |||
| 1293 | Ga0496125_0000095 | |||
| 1294 | Ga0496125_0001090 | |||
| 1295 | Ga0496125_0018519 | |||
| 1296 | Ga0496125_0020531 | |||
| 1297 | Ga0496125_0024806 | |||
| 1298 | Ga0496125_0031462 | |||
| 1299 | Ga0496125_0034095 | |||
| 1300 | Ga0496125_0098857 | |||
| 1301 | Ga0496126_0028596 | |||
| 1302 | Ga0496126_0031309 | |||
| 1303 | Ga0496126_0100799 | |||
| 1304 | Ga0496126_0156078 | |||
| 1305 | Ga0501072_0253641 | |||
| 1306 | Ga0501223_003419 | |||
| 1307 | Ga0501249_001925 | |||
| 1308 | Ga0501225_0003451 | |||
| 1309 | Ga0501035_0123926 | |||
| 1310 | Ga0501044_0115367 | |||
| 1311 | nmdc:mga03683_63052_c1 | |||
| 1312 | nmdc:mga03683_71584_c1 | |||
| 1313 | nmdc:mga03n38_53556_c1 | |||
| 1314 | nmdc:mga00v17_114866_c1 | |||
| 1315 | nmdc:mga00v17_32654_c1 | |||
| 1316 | nmdc:mga00v17_55685_c1 | |||
| 1317 | nmdc:mga00v17_8339_c1 | |||
| 1318 | nmdc:mga0yw44_2633_c1 | |||
| 1319 | nmdc:mga0yw44_341726_c1 | |||
| 1320 | nmdc:mga0k408_150105_c1 | |||
| 1321 | nmdc:mga0k408_2956_c1 | |||
| 1322 | nmdc:mga0k408_33655_c1 | |||
| 1323 | nmdc:mga0k408_3371_c1 | |||
| 1324 | nmdc:mga0k408_40214_c1 | |||
| 1325 | nmdc:mga0k408_4893_c1 | |||
| 1326 | nmdc:mga06z11_22419_c1 | |||
| 1327 | nmdc:mga07m45_111501_c1 | |||
| 1328 | nmdc:mga07m45_14094_c1 | |||
| 1329 | nmdc:mga07m45_401_c1 | |||
| 1330 | nmdc:mga07m45_4350_c1 | |||
| 1331 | nmdc:mga07m45_9111_c1 | |||
| 1332 | nmdc:mga09592_279_c1 | |||
| 1333 | nmdc:mga0qj67_25028_c1 | |||
| 1334 | Ga0500643_004351 | |||
| 1335 | Ga0500643_004392 | |||
| 1336 | Ga0500644_0033838 | |||
| 1337 | Ga0500651_0014707 | |||
| 1338 | Ga0500566_0048225 | |||
| 1339 | Ga0500562_003136 | |||
| 1340 | Ga0500562_019951 | |||
| 1341 | Ga0500571_000027 | |||
| 1342 | Ga0500608_002433 | |||
| 1343 | Ga0500608_035318 | |||
| 1344 | Ga0500655_000333 | |||
| 1345 | Ga0500658_0000114 | |||
| 1346 | Ga0500658_0000684 | |||
| 1347 | Ga0500559_0014205 | |||
| 1348 | Ga0500568_0002311 | |||
| 1349 | Ga0500574_009494 | |||
| 1350 | Ga0500634_0001368 | |||
| 1351 | Ga0500634_0008187 | |||
| 1352 | Ga0500638_001743 | |||
| 1353 | Ga0500636_0001401 | |||
| 1354 | 2548500900 | |||
| 1355 | 2599626028 | |||
| 1356 | 2599674890 | |||
| 1357 | 2599683784 | |||
| 1358 | 2599695613 | |||
| 1359 | 2599903528 | |||
| 1360 | 2599926831 | |||
| 1361 | 2643866599 | |||
| 1362 | 2643991420 | |||
| 1363 | 2644062805 | |||
| 1364 | 2644076700 | |||
| 1365 | 2644296347 | |||
| 1366 | 2644400135 | |||
| 1367 | 2644647695 | |||
| 1368 | 2650896069 | |||
| 1369 | 2686356759 | |||
| 1370 | 2722883298 | |||
| 1371 | 2738720865 | |||
| 1372 | 2739244520 | |||
| 1373 | 2739248378 | |||
| 1374 | 2739280064 | |||
| 1375 | 2809127268 | |||
| 1376 | 2816474016 | |||
| 1377 | 2819600298 | |||
| 1378 | 2831271908 | |||
| 1379 | 2838059746 | |||
| 1380 | 2839143756 | |||
| 1381 | 2842682371 | |||
| 1382 | 2842719146 | |||
| 1383 | 2847798650 | |||
| 1384 | 2881104736 | |||
| 1385 | 2899928527 | |||
| 1386 | 2904453654 | |||
| 1387 | 2904459050 | |||
| 1388 | 2904483817 | |||
| 1389 | 2904549625 | |||
| 1390 | 2919705136 | |||
| 1391 | 2928041452 | |||
| 1392 | 2928048294 | |||
| 1393 | 2928055519 | |||
| 1394 | 2928056134 | |||
| 1395 | 2928066386 | |||
| 1396 | 2928076199 | |||
| 1397 | 2928086211 | |||
| 1398 | 2929166625 | |||
| 1399 | 2929524279 | |||
| 1400 | 2939606343 | |||
| 1401 | 2941484464 | |||
| 1402 | 2954768038 | |||
| 1403 | 2974323296 | |||
| 1404 | 2984497869 | |||
| 1405 | 2990265372 | |||
| 1406 | 2990712212 | |||
| 1407 | 8048749446 | |||
| 1408 | 8055228530 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ris-assembly1.cif.gz_A | crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate | 0.9173 | 44 | 305 |
| 8dk0-assembly1.cif.gz_A | crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma-valerolactone | 0.9173 | 44 | 305 |
| 7riz-assembly1.cif.gz_A | crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline | 0.9113 | 44 | 305 |
| 7plc-assembly4.cif.gz_D | caulobacter crescentus xylonolactonase with d-xylose, p21 space group | 0.876 | 43 | 305 |
| 4gna-assembly1.cif.gz_A | mouse smp30/gnl-xylitol complex | 0.8727 | 44 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54ZP3_33_320_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8848 | 44 | 306 | 2.120.10.30 |
| af_Q6TLF6_1_295_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8755 | 44 | 306 | 2.120.10.30 |
| 5xfeA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8584 | 44 | 305 | 2.120.10.30 |
| 3e5zB00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.855 | 43 | 301 | 2.120.10.30 |
| 2dg0A00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.8531 | 7 | 306 | 2.120.10.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V3SE48-F1-model_v4 | deleted | 0.9875 | 1 | 310 |
|
| AF-A0A257JG88-F1-model_v4 | Gluconolactonase | 0.9865 | 154 | 302 |
GO:0016787
GO:0046872 |
| AF-D4XJB0-F1-model_v4 | SMP-30/Gluconolaconase/LRE-like region | 0.9827 | 11 | 302 |
GO:0016787
GO:0046872 |
| AF-A0A246NCY1-F1-model_v4 | Gluconolactonase | 0.981 | 1 | 310 |
GO:0016787
GO:0046872 |
| AF-H1S0X3-F1-model_v4 | Gluconolactonase | 0.9802 | 173 | 302 |
GO:0016787
GO:0046872 |