F476376

General Info

Members Datasets Scaffolds Average Seq Length
704 348 1408 308

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0148827|Ga0495676_0148827_18_878
Length 286
Sequence MFLLSPPQILELNMFSRMPNAFRRADRCEWGDANRGGAVVDSFLEGPVLDGIGNLYVTDVPWGRIFRIDPAGEWRLIAEYAGDRQTLLIADYQNGLMRLDIRTGDVQPYLMRRNSERFKGVNDLCIDKAGNVYFTDQGQTGLHDPTGRLYRLRQDGRLDLLLSNVPSPNGVVLSTDERVAFVAVTRGNCVWRVPLLADGGVSKVGQFFTSYGPGGPDGLAVDANGRLYVANPGLGYVWVLNARAEPVLVLRGTPGASLTNIVLSQDGSRIYVTDSSQGAVLFADIR

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
118 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
185 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
186 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
187 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
188 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
189 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
190 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
208 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
211 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
212 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
213 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
214 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
215 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
219 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
220 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
267 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
282 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
285 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
286 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
287 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
288 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
289 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
290 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
291 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
292 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
293 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 2547132374 Acidovorax radicis N35 Isolate Unclassified
296 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
297 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
298 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
299 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
300 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
301 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
302 2643221570 Acidovorax sp. Root568 Isolate Unclassified
303 2643221596 Acidovorax sp. Root70 Isolate Unclassified
304 2643221609 Acidovorax sp. Root217 Isolate Unclassified
305 2643221611 Acidovorax sp. Root219 Isolate Unclassified
306 2643221652 Acidovorax sp. Root402 Isolate Unclassified
307 2643221672 Variovorax sp. Root434 Isolate Unclassified
308 2643221717 Acidovorax sp. Root267 Isolate Unclassified
309 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
310 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
311 2721755523 Delftia sp. HK171 Isolate Unclassified
312 2738541277 Variovorax sp. GV051 Isolate Unclassified
313 2738543012 Acidovorax sp. CF301 Isolate Unclassified
314 2738543013 Variovorax sp. BT01 Isolate Unclassified
315 2738543019 Variovorax sp. GV040 Isolate Unclassified
316 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
317 2816332133 Acidovorax radicis 2721A Isolate Unclassified
318 2818991446 Variovorax sp. 1180 Isolate Unclassified
319 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
320 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
321 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
322 2842677519 Variovorax sp. R-72495 Isolate Unclassified
323 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
324 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
325 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
326 2899924645 Variovorax sp. 369 Isolate Unclassified
327 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
328 2904456579 Variovorax sp. 2002 Isolate Unclassified
329 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
330 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
331 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
332 2928037797 Variovorax sp. 1126 Isolate Unclassified
333 2928044640 Variovorax sp. 1128 Isolate Unclassified
334 2928051484 Variovorax sp. 1133 Isolate Unclassified
335 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
336 2928070936 Variovorax gossypii 1167 Isolate Unclassified
337 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
338 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
339 2929520902 Variovorax beijingensis 502 Isolate Unclassified
340 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
341 2941479691
342 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
343 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
344 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
345 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
346 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
347 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
348 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.19
Metatranscriptomes 0
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 20.88
Nodule 0.57
Rhizoplane 3.12
Rhizosphere 61.51
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0148827 3300047321 Bacteria 1669
2 JGI24739J22299_10000552 3300001989 Bacteria 13402
3 JGI25152J39213_1004142 3300002773 Bacteria 4678
4 JGI25150J39212_1000775 3300002774 Bacteria 10994
5 JGI25159J45721_1001723 3300002987 Bacteria 8831
6 JGI25151J46595_10001812 3300003187 Bacteria 13795
7 JGI25151J46595_10007029 3300003187 Bacteria 5568
8 JGI25153J46596_10004018 3300003215 Bacteria 8023
9 rootH1_10004795 3300003316 Bacteria 4693
10 rootH2_10062676 3300003320 Bacteria 4187
11 rootL2_10002392 3300003322 Bacteria 54339
12 rootL2_10002696 3300003322 Bacteria 25570
13 rootH1_10015486 3300003323 Bacteria 2203
14 JGI25160J50197_1005064 3300003354 Bacteria 5568
15 JGI25160J50197_1005195 3300003354 Bacteria 5461
16 JGI25161J50226_1001404 3300003374 Bacteria 7320
17 JGI25161J50226_1002166 3300003374 Bacteria 5240
18 Ga0055542_1000127 3300003762 Bacteria 100078
19 Ga0055529_1001542 3300003763 Bacteria 6569
20 Ga0055526_1007653 3300003771 Bacteria 5568
21 Ga0055526_1012185 3300003771 Bacteria 3779
22 Ga0055537_1002831 3300003773 Bacteria 5568
23 Ga0055524_1005618 3300003775 Bacteria 5568
24 Ga0055524_1005619 3300003775 Bacteria 5568
25 Ga0055536_1001127 3300003781 Bacteria 16744
26 Ga0055536_1002533 3300003781 Bacteria 10234
27 Ga0055536_1007829 3300003781 Bacteria 4711
28 Ga0055534_1002993 3300003784 Bacteria 5568
29 Ga0055534_1004483 3300003784 Bacteria 4032
30 Ga0055528_1005990 3300003790 Bacteria 5568
31 Ga0055530_10000503 3300003791 Bacteria 33931
32 Ga0055530_10009571 3300003791 Bacteria 3704
33 Ga0055540_1000142 3300003792 Bacteria 71685
34 Ga0055540_1001148 3300003792 Bacteria 16490
35 Ga0055540_1002310 3300003792 Bacteria 10231
36 Ga0055540_1023554 3300003792 Bacteria 1548
37 Ga0055531_10000424 3300003794 Bacteria 40020
38 Ga0055531_10001995 3300003794 Bacteria 14183
39 Ga0058692_1001362 3300003856 Bacteria 9061
40 Ga0058692_1002854 3300003856 Bacteria 5634
41 Ga0055543_1000926 3300004625 Bacteria 13662
42 Ga0065165_1002808 3300005262 Bacteria 13662
43 Ga0065714_10068311 3300005288 Bacteria 4822
44 Ga0065704_10081506 3300005289 Bacteria 3749
45 Ga0070676_10004601 3300005328 Bacteria 7274
46 Ga0070676_10255136 3300005328 Bacteria 1172
47 Ga0070690_100009433 3300005330 Bacteria 5653
48 Ga0070690_100047880 3300005330 Bacteria 2721
49 Ga0070670_100039904 3300005331 Bacteria 4037
50 Ga0070670_100309315 3300005331 Bacteria 1383
51 Ga0070670_100368063 3300005331 Bacteria 1265
52 Ga0070677_10014435 3300005333 Bacteria 2780
53 Ga0070677_10016655 3300005333 Bacteria 2620
54 Ga0070677_10030919 3300005333 Bacteria 2042
55 Ga0068869_100011077 3300005334 Bacteria 5906
56 Ga0068869_100012518 3300005334 Bacteria 5610
57 Ga0068869_100031362 3300005334 Bacteria 3739
58 Ga0068869_100216971 3300005334 Bacteria 1515
59 Ga0070666_10020203 3300005335 Bacteria 4304
60 Ga0070666_10039876 3300005335 Bacteria 3132
61 Ga0070666_10181550 3300005335 Bacteria 1476
62 Ga0068868_100037908 3300005338 Bacteria 3739
63 Ga0068868_100056382 3300005338 Bacteria 3103
64 Ga0068868_100067906 3300005338 Bacteria 2838
65 Ga0070689_100027295 3300005340 Bacteria 4304
66 Ga0070668_100005095 3300005347 Bacteria 9732
67 Ga0070668_100168716 3300005347 Bacteria 1780
68 Ga0070669_100003928 3300005353 Bacteria 10759
69 Ga0070669_100039927 3300005353 Bacteria 3411
70 Ga0070675_100000867 3300005354 Bacteria 21513
71 Ga0070675_100002412 3300005354 Bacteria 13936
72 Ga0070675_100081791 3300005354 Bacteria 2694
73 Ga0070671_100007799 3300005355 Bacteria 8551
74 Ga0070671_100042525 3300005355 Bacteria 3777
75 Ga0070671_100048851 3300005355 Bacteria 3520
76 Ga0070671_100364888 3300005355 Bacteria 1233
77 Ga0070674_100002652 3300005356 Bacteria 9908
78 Ga0070674_100004011 3300005356 Bacteria 8342
79 Ga0070674_100014171 3300005356 Bacteria 4950
80 Ga0070674_100025028 3300005356 Bacteria 3879
81 Ga0070674_100034062 3300005356 Bacteria 3397
82 Ga0070674_100184332 3300005356 Bacteria 1601
83 Ga0070673_100000636 3300005364 Bacteria 19252
84 Ga0070673_100003720 3300005364 Bacteria 9557
85 Ga0070673_100040145 3300005364 Bacteria 3588
86 Ga0070673_100048465 3300005364 Bacteria 3312
87 Ga0070673_100057850 3300005364 Bacteria 3064
88 Ga0070688_100045989 3300005365 Bacteria 2701
89 Ga0070667_100003829 3300005367 Bacteria 12785
90 Ga0070667_100006773 3300005367 Bacteria 9515
91 Ga0070667_100025932 3300005367 Bacteria 4875
92 Ga0070667_100050962 3300005367 Bacteria 3489
93 Ga0070667_100163180 3300005367 Bacteria 1964
94 Ga0070667_100181353 3300005367 Bacteria 1862
95 Ga0070700_100243249 3300005441 Unclassified 1287
96 Ga0070663_100262258 3300005455 Bacteria 1371
97 Ga0070678_100028216 3300005456 Bacteria 3824
98 Ga0070678_100147670 3300005456 Bacteria 1890
99 Ga0070662_100009155 3300005457 Bacteria 6466
100 Ga0070662_100037335 3300005457 Bacteria 3445
101 Ga0070662_100067213 3300005457 Bacteria 2632
102 Ga0068867_100002629 3300005459 Bacteria 12667
103 Ga0068867_100016573 3300005459 Bacteria 5233
104 Ga0068867_100019670 3300005459 Bacteria 4810
105 Ga0068867_100072857 3300005459 Bacteria 2572
106 Ga0068867_100260904 3300005459 Bacteria 1412
107 Ga0068853_100088254 3300005539 Bacteria 2722
108 Ga0068853_100308470 3300005539 Bacteria 1464
109 Ga0068853_100395500 3300005539 Bacteria 1293
110 Ga0070672_100010747 3300005543 Bacteria 6360
111 Ga0070672_100014574 3300005543 Bacteria 5574
112 Ga0070672_100031629 3300005543 Bacteria 3985
113 Ga0070672_100036062 3300005543 Bacteria 3765
114 Ga0070672_100043078 3300005543 Bacteria 3478
115 Ga0070672_100066213 3300005543 Bacteria 2860
116 Ga0070686_100074145 3300005544 Bacteria 2236
117 Ga0070665_100028335 3300005548 Bacteria 5641
118 Ga0070665_100579392 3300005548 Bacteria 1135
119 Ga0070664_100040055 3300005564 Bacteria 3949
120 Ga0070664_100066038 3300005564 Bacteria 3089
121 Ga0068857_100048003 3300005577 Bacteria 3791
122 Ga0068857_100124186 3300005577 Bacteria 2325
123 Ga0068852_100048760 3300005616 Bacteria 3620
124 Ga0068852_100052408 3300005616 Bacteria 3506
125 Ga0068852_100113707 3300005616 Bacteria 2465
126 Ga0068859_100059297 3300005617 Bacteria 3856
127 Ga0068859_100077867 3300005617 Bacteria 3356
128 Ga0068864_100001800 3300005618 Bacteria 17594
129 Ga0068864_100005187 3300005618 Bacteria 10671
130 Ga0068864_100071025 3300005618 Bacteria 3031
131 Ga0068866_10010784 3300005718 Bacteria 3929
132 Ga0068866_10047177 3300005718 Bacteria 2171
133 Ga0068861_100001031 3300005719 Bacteria 17061
134 Ga0068861_100006400 3300005719 Bacteria 8023
135 Ga0068851_10026313 3300005834 Bacteria 2858
136 Ga0068851_10032297 3300005834 Bacteria 2605
137 Ga0068851_10083326 3300005834 Bacteria 1673
138 Ga0068851_10106335 3300005834 Bacteria 1494
139 Ga0068870_10114408 3300005840 Bacteria 1545
140 Ga0068863_100001722 3300005841 Bacteria 21666
141 Ga0068863_100006998 3300005841 Bacteria 11056
142 Ga0068863_100044836 3300005841 Bacteria 4196
143 Ga0068858_100010139 3300005842 Bacteria 8944
144 Ga0068858_100034855 3300005842 Bacteria 4668
145 Ga0068858_100035822 3300005842 Bacteria 4602
146 Ga0068860_100001567 3300005843 Bacteria 24631
147 Ga0068860_100052678 3300005843 Bacteria 3870
148 Ga0068860_100135208 3300005843 Bacteria 2367
149 Ga0068862_100025291 3300005844 Bacteria 4985
150 Ga0068862_100438050 3300005844 Bacteria 1230
151 Ga0075365_10047672 3300006038 Bacteria 2817
152 Ga0075364_10001315 3300006051 Bacteria 13365
153 Ga0075364_10005633 3300006051 Bacteria 7303
154 Ga0075364_10048211 3300006051 Bacteria 2775
155 Ga0075364_10176634 3300006051 Bacteria 1444
156 Ga0075432_10033182 3300006058 Bacteria 1790
157 Ga0075362_10006037 3300006177 Bacteria 4485
158 Ga0075362_10007293 3300006177 Bacteria 4179
159 Ga0075362_10035060 3300006177 Bacteria 2189
160 Ga0075367_10033860 3300006178 Bacteria 2947
161 Ga0075367_10161354 3300006178 Bacteria 1394
162 Ga0075369_10005814 3300006186 Bacteria 4633
163 Ga0075369_10018982 3300006186 Bacteria 2804
164 Ga0075369_10038661 3300006186 Bacteria 2036
165 Ga0075366_10004402 3300006195 Bacteria 7560
166 Ga0075366_10004730 3300006195 Bacteria 7333
167 Ga0075366_10005398 3300006195 Bacteria 6926
168 Ga0075366_10016652 3300006195 Bacteria 4226
169 Ga0075366_10185094 3300006195 Bacteria 1265
170 Ga0097621_100020094 3300006237 Bacteria 5143
171 Ga0097621_100030205 3300006237 Bacteria 4287
172 Ga0075370_10000362 3300006353 Bacteria 16636
173 Ga0075370_10002990 3300006353 Bacteria 7953
174 Ga0075370_10018538 3300006353 Bacteria 3778
175 Ga0075370_10042180 3300006353 Bacteria 2577
176 Ga0068871_100017041 3300006358 Bacteria 5488
177 Ga0068871_100075544 3300006358 Bacteria 2782
178 Ga0075430_100069041 3300006846 Bacteria 2965
179 Ga0075429_100003836 3300006880 Bacteria 12839
180 Ga0068865_100022269 3300006881 Bacteria 4131
181 Ga0068865_100025301 3300006881 Bacteria 3903
182 Ga0097620_100059296 3300006931 Bacteria 3856
183 Ga0097620_100077866 3300006931 Bacteria 3356
184 Ga0099826_10000023 3300006948 Bacteria 154989
185 Ga0099826_10007158 3300006948 Bacteria 8204
186 Ga0105251_10002295 3300009011 Bacteria 15155
187 Ga0105244_10003718 3300009036 Bacteria 10769
188 Ga0105244_10010700 3300009036 Bacteria 5546
189 Ga0105244_10059140 3300009036 Bacteria 1932
190 Ga0105250_10022124 3300009092 Bacteria 2565
191 Ga0105240_10084452 3300009093 Bacteria 3893
192 Ga0105243_10001727 3300009148 Bacteria 18819
193 Ga0105243_10005672 3300009148 Bacteria 9716
194 Ga0105243_10034866 3300009148 Bacteria 3900
195 Ga0105243_10224972 3300009148 Bacteria 1661
196 Ga0105243_10290919 3300009148 Bacteria 1476
197 Ga0105243_10458779 3300009148 Bacteria 1198
198 Ga0105241_10332306 3300009174 Bacteria 1314
199 Ga0105242_10012717 3300009176 Bacteria 6482
200 Ga0105242_10035627 3300009176 Bacteria 3990
201 Ga0105242_10090084 3300009176 Bacteria 2579
202 Ga0105242_10129670 3300009176 Bacteria 2175
203 Ga0105242_10137976 3300009176 Bacteria 2113
204 Ga0105248_10026525 3300009177 Bacteria 6445
205 Ga0105248_10063935 3300009177 Bacteria 4131
206 Ga0105248_10100638 3300009177 Bacteria 3257
207 Ga0105248_10172139 3300009177 Bacteria 2441
208 Ga0105237_10017444 3300009545 Bacteria 7441
209 Ga0105237_10113208 3300009545 Bacteria 2705
210 Ga0105238_10357550 3300009551 Bacteria 1449
211 Ga0105249_10009014 3300009553 Bacteria 8717
212 Ga0105249_10024652 3300009553 Bacteria 5407
213 Ga0105249_10251733 3300009553 Bacteria 1751
214 Ga0105249_10547546 3300009553 Bacteria 1207
215 Ga0105239_10754298 3300010375 Bacteria 1114
216 Ga0105246_10071291 3300011119 Bacteria 2446
217 Ga0157371_10103405 3300013102 Bacteria 2021
218 Ga0157370_10000355 3300013104 Bacteria 58228
219 Ga0157370_10005163 3300013104 Bacteria 14724
220 Ga0157370_10053102 3300013104 Bacteria 3866
221 Ga0157369_10370154 3300013105 Bacteria 1487
222 Ga0157374_10219804 3300013296 Bacteria 1864
223 Ga0157374_10359856 3300013296 Bacteria 1447
224 Ga0157374_10669180 3300013296 Bacteria 1050
225 Ga0157378_10007266 3300013297 Bacteria 9673
226 Ga0157378_10032465 3300013297 Bacteria 4613
227 Ga0163162_10004491 3300013306 Bacteria 13443
228 Ga0163162_10035520 3300013306 Bacteria 4965
229 Ga0163162_10293408 3300013306 Bacteria 1758
230 Ga0157372_10454691 3300013307 Bacteria 1492
231 Ga0157375_10008158 3300013308 Bacteria 9165
232 Ga0157375_10077926 3300013308 Bacteria 3346
233 Ga0157375_10082197 3300013308 Bacteria 3262
234 Ga0157375_10087913 3300013308 Bacteria 3161
235 Ga0163163_10004780 3300014325 Bacteria 11624
236 Ga0157380_10002852 3300014326 Bacteria 11733
237 Ga0157380_10014614 3300014326 Bacteria 5748
238 Ga0157380_10056853 3300014326 Bacteria 3113
239 Ga0157380_10077947 3300014326 Bacteria 2702
240 Ga0157380_10173652 3300014326 Bacteria 1886
241 Ga0182008_10000256 3300014497 Bacteria 41427
242 Ga0182008_10002592 3300014497 Bacteria 11226
243 Ga0182008_10022441 3300014497 Bacteria 3233
244 Ga0182008_10022563 3300014497 Bacteria 3223
245 Ga0182008_10064590 3300014497 Bacteria 1802
246 Ga0182008_10077486 3300014497 Bacteria 1636
247 Ga0182008_10119892 3300014497 Bacteria 1307
248 Ga0157379_10021478 3300014968 Bacteria 5714
249 Ga0157379_10046143 3300014968 Bacteria 3889
250 Ga0157379_10070070 3300014968 Bacteria 3137
251 Ga0157379_10123835 3300014968 Bacteria 2326
252 Ga0157376_10018109 3300014969 Bacteria 5390
253 Ga0157376_10022136 3300014969 Bacteria 4948
254 Ga0182006_1006572 3300015261 Bacteria 5390
255 Ga0182006_1008663 3300015261 Bacteria 4605
256 Ga0182007_10004924 3300015262 Bacteria 5957
257 Ga0182007_10015558 3300015262 Bacteria 2833
258 Ga0182007_10041432 3300015262 Bacteria 1535
259 Ga0163161_10000201 3300017792 Bacteria 54704
260 Ga0163161_10058971 3300017792 Bacteria 2791
261 Ga0163161_10065023 3300017792 Bacteria 2661
262 Ga0163161_10072444 3300017792 Bacteria 2523
263 Ga0213876_10060896 3300021384 Bacteria 1992
264 Ga0209436_102685 3300025208 Bacteria 5149
265 Ga0209436_105024 3300025208 Bacteria 3141
266 Ga0209672_100172 3300025228 Bacteria 54226
267 Ga0209147_100934 3300025229 Bacteria 12979
268 Ga0209258_100078 3300025242 Bacteria 263996
269 Ga0209258_102336 3300025242 Bacteria 5018
270 Ga0207425_1000220 3300025245 Bacteria 44993
271 Ga0207425_1011013 3300025245 Bacteria 2179
272 Ga0209148_1000086 3300025254 Bacteria 263996
273 Ga0209129_1000707 3300025258 Bacteria 21656
274 Ga0209129_1000904 3300025258 Bacteria 18153
275 Ga0209129_1001750 3300025258 Bacteria 11652
276 Ga0209565_1000193 3300025263 Bacteria 73374
277 Ga0209565_1006038 3300025263 Bacteria 3452
278 Ga0209673_1000168 3300025273 Bacteria 135126
279 Ga0209673_1000355 3300025273 Bacteria 83197
280 Ga0209130_1000810 3300025284 Bacteria 26474
281 Ga0209130_1001236 3300025284 Bacteria 17939
282 Ga0209130_1001907 3300025284 Bacteria 11762
283 Ga0209675_1001053 3300025291 Bacteria 17100
284 Ga0209675_1001228 3300025291 Bacteria 15436
285 Ga0209675_1007200 3300025291 Bacteria 4309
286 Ga0209676_1000103 3300025292 Bacteria 226908
287 Ga0209676_1000152 3300025292 Bacteria 166700
288 Ga0209676_1010674 3300025292 Bacteria 3790
289 Ga0209676_1023532 3300025292 Bacteria 2014
290 Ga0209025_1000201 3300025294 Bacteria 145890
291 Ga0209025_1000839 3300025294 Bacteria 48717
292 Ga0209025_1014376 3300025294 Bacteria 4872
293 Ga0209025_1045127 3300025294 Bacteria 1832
294 Ga0209564_1000289 3300025295 Bacteria 101976
295 Ga0209564_1000391 3300025295 Bacteria 78565
296 Ga0209758_1000034 3300025297 Bacteria 467637
297 Ga0209758_1007283 3300025297 Bacteria 7592
298 Ga0209758_1020465 3300025297 Bacteria 3129
299 Ga0209050_1000012 3300025298 Bacteria 813717
300 Ga0209050_1000210 3300025298 Bacteria 129834
301 Ga0209050_1004904 3300025298 Bacteria 8747
302 Ga0209256_1000066 3300025299 Bacteria 247534
303 Ga0209256_1000318 3300025299 Bacteria 82840
304 Ga0207426_1000067 3300025302 Bacteria 342108
305 Ga0207426_1000266 3300025302 Bacteria 109895
306 Ga0209051_1000019 3300025303 Bacteria 511268
307 Ga0209051_1000074 3300025303 Bacteria 208667
308 Ga0209051_1001472 3300025303 Bacteria 19909
309 Ga0209051_1003040 3300025303 Bacteria 11347
310 Ga0209051_1017090 3300025303 Bacteria 3253
311 Ga0209257_1000024 3300025304 Bacteria 726068
312 Ga0209257_1000072 3300025304 Bacteria 332791
313 Ga0209257_1004029 3300025304 Bacteria 11815
314 Ga0207697_10009122 3300025315 Bacteria 4299
315 Ga0207656_10152662 3300025321 Bacteria 1095
316 Ga0207655_1079783 3300025728 Bacteria 1185
317 Ga0207713_1016462 3300025735 Bacteria 3750
318 Ga0207682_10004300 3300025893 Bacteria 5985
319 Ga0207682_10014163 3300025893 Bacteria 3108
320 Ga0207682_10021127 3300025893 Bacteria 2560
321 Ga0207682_10034152 3300025893 Bacteria 2050
322 Ga0207682_10040471 3300025893 Bacteria 1899
323 Ga0207642_10003819 3300025899 Bacteria 4805
324 Ga0207642_10097159 3300025899 Bacteria 1470
325 Ga0207688_10053187 3300025901 Bacteria 2270
326 Ga0207680_10000628 3300025903 Bacteria 16642
327 Ga0207680_10010325 3300025903 Bacteria 4667
328 Ga0207645_10018671 3300025907 Bacteria 4555
329 Ga0207645_10019539 3300025907 Bacteria 4441
330 Ga0207645_10086866 3300025907 Bacteria 2009
331 Ga0207643_10070697 3300025908 Bacteria 2008
332 Ga0207643_10106003 3300025908 Bacteria 1652
333 Ga0207695_10360671 3300025913 Bacteria 1340
334 Ga0207671_10098311 3300025914 Bacteria 2214
335 Ga0207681_10001666 3300025923 Bacteria 14298
336 Ga0207681_10005868 3300025923 Bacteria 7529
337 Ga0207681_10045496 3300025923 Bacteria 2947
338 Ga0207681_10141502 3300025923 Bacteria 1792
339 Ga0207694_10157975 3300025924 Bacteria 1830
340 Ga0207694_10226237 3300025924 Bacteria 1527
341 Ga0207650_10000395 3300025925 Bacteria 39717
342 Ga0207650_10005656 3300025925 Bacteria 8537
343 Ga0207650_10056569 3300025925 Bacteria 2915
344 Ga0207650_10189814 3300025925 Bacteria 1641
345 Ga0207650_10295487 3300025925 Bacteria 1322
346 Ga0207659_10000361 3300025926 Bacteria 27251
347 Ga0207659_10001382 3300025926 Bacteria 14474
348 Ga0207659_10027036 3300025926 Bacteria 3879
349 Ga0207659_10109655 3300025926 Bacteria 2096
350 Ga0207644_10009812 3300025931 Bacteria 6295
351 Ga0207644_10021084 3300025931 Bacteria 4436
352 Ga0207644_10056053 3300025931 Bacteria 2843
353 Ga0207706_10031298 3300025933 Bacteria 4740
354 Ga0207706_10046097 3300025933 Bacteria 3860
355 Ga0207706_10092563 3300025933 Bacteria 2658
356 Ga0207706_10278116 3300025933 Bacteria 1460
357 Ga0207686_10018549 3300025934 Bacteria 3941
358 Ga0207686_10032970 3300025934 Bacteria 3087
359 Ga0207686_10101825 3300025934 Bacteria 1919
360 Ga0207709_10000112 3300025935 Bacteria 127357
361 Ga0207709_10000999 3300025935 Bacteria 21008
362 Ga0207709_10012395 3300025935 Bacteria 4698
363 Ga0207709_10088800 3300025935 Bacteria 2014
364 Ga0207709_10239737 3300025935 Bacteria 1318
365 Ga0207669_10008907 3300025937 Bacteria 4742
366 Ga0207669_10010328 3300025937 Bacteria 4490
367 Ga0207669_10011808 3300025937 Bacteria 4267
368 Ga0207669_10016396 3300025937 Bacteria 3763
369 Ga0207704_10003637 3300025938 Bacteria 7002
370 Ga0207704_10097920 3300025938 Bacteria 1947
371 Ga0207691_10000792 3300025940 Bacteria 31429
372 Ga0207691_10013268 3300025940 Bacteria 7892
373 Ga0207691_10047144 3300025940 Bacteria 3956
374 Ga0207691_10047772 3300025940 Bacteria 3926
375 Ga0207691_10054700 3300025940 Bacteria 3640
376 Ga0207691_10104190 3300025940 Bacteria 2529
377 Ga0207711_10004659 3300025941 Bacteria 11645
378 Ga0207711_10008644 3300025941 Bacteria 8516
379 Ga0207711_10021685 3300025941 Bacteria 5366
380 Ga0207711_10109609 3300025941 Bacteria 2454
381 Ga0207689_10006875 3300025942 Bacteria 10003
382 Ga0207689_10027313 3300025942 Bacteria 4778
383 Ga0207689_10041585 3300025942 Bacteria 3803
384 Ga0207689_10455466 3300025942 Bacteria 1070
385 Ga0207661_10039909 3300025944 Bacteria 3687
386 Ga0207679_10030948 3300025945 Bacteria 3742
387 Ga0207679_10239356 3300025945 Bacteria 1537
388 Ga0207667_10018380 3300025949 Bacteria 7841
389 Ga0207651_10000398 3300025960 Bacteria 18449
390 Ga0207651_10020813 3300025960 Bacteria 3969
391 Ga0207651_10155595 3300025960 Unclassified 1785
392 Ga0207712_10009514 3300025961 Bacteria 6149
393 Ga0207712_10027282 3300025961 Bacteria 3812
394 Ga0207668_10008172 3300025972 Bacteria 6229
395 Ga0207668_10045220 3300025972 Bacteria 3001
396 Ga0207668_10055915 3300025972 Bacteria 2746
397 Ga0207640_10043615 3300025981 Bacteria 2868
398 Ga0207640_10271795 3300025981 Bacteria 1326
399 Ga0207658_10002681 3300025986 Bacteria 12869
400 Ga0207658_10007158 3300025986 Bacteria 7602
401 Ga0207658_10070074 3300025986 Bacteria 2652
402 Ga0207658_10080443 3300025986 Bacteria 2496
403 Ga0207658_10241606 3300025986 Bacteria 1530
404 Ga0207677_10012056 3300026023 Bacteria 4951
405 Ga0207677_10054957 3300026023 Bacteria 2720
406 Ga0207677_10592005 3300026023 Bacteria 972
407 Ga0207703_10008523 3300026035 Bacteria 8096
408 Ga0207703_10090385 3300026035 Bacteria 2573
409 Ga0207639_10107200 3300026041 Bacteria 2269
410 Ga0207639_10144464 3300026041 Bacteria 1986
411 Ga0207639_10370319 3300026041 Bacteria 1284
412 Ga0207678_10019463 3300026067 Bacteria 5963
413 Ga0207678_10127924 3300026067 Bacteria 2167
414 Ga0207708_10016701 3300026075 Bacteria 5524
415 Ga0207641_10004010 3300026088 Bacteria 12847
416 Ga0207641_10006561 3300026088 Bacteria 9779
417 Ga0207648_10002731 3300026089 Bacteria 18746
418 Ga0207648_10005525 3300026089 Bacteria 12740
419 Ga0207648_10020733 3300026089 Bacteria 5917
420 Ga0207648_10020894 3300026089 Bacteria 5894
421 Ga0207648_10043492 3300026089 Bacteria 3942
422 Ga0207648_10064840 3300026089 Bacteria 3184
423 Ga0207648_10065521 3300026089 Bacteria 3167
424 Ga0207676_10000082 3300026095 Bacteria 92500
425 Ga0207676_10013301 3300026095 Bacteria 5912
426 Ga0207676_10026597 3300026095 Bacteria 4303
427 Ga0207676_10032458 3300026095 Bacteria 3935
428 Ga0207674_10060789 3300026116 Bacteria 3820
429 Ga0207674_10079187 3300026116 Bacteria 3291
430 Ga0207675_100012003 3300026118 Bacteria 8096
431 Ga0207675_100034565 3300026118 Bacteria 4713
432 Ga0207683_10008053 3300026121 Bacteria 9012
433 Ga0207683_10008094 3300026121 Bacteria 8989
434 Ga0207683_10050736 3300026121 Bacteria 3635
435 Ga0207683_10060353 3300026121 Bacteria 3333
436 Ga0207683_10102470 3300026121 Bacteria 2556
437 Ga0207683_10156837 3300026121 Bacteria 2056
438 Ga0207698_10004335 3300026142 Bacteria 8638
439 Ga0207698_10118371 3300026142 Bacteria 2237
440 Ga0207698_10137730 3300026142 Bacteria 2097
441 Ga0209371_1000363 3300027312 Bacteria 48923
442 Ga0209371_1002523 3300027312 Bacteria 10127
443 Ga0209371_1002974 3300027312 Bacteria 8803
444 Ga0209371_1003137 3300027312 Bacteria 8401
445 Ga0209282_1000047 3300027666 Bacteria 114735
446 Ga0268266_10035509 3300028379 Bacteria 4240
447 Ga0268265_10010659 3300028380 Bacteria 6208
448 Ga0268264_10004490 3300028381 Bacteria 11902
449 Ga0268264_10009726 3300028381 Bacteria 7960
450 Ga0268264_10103159 3300028381 Bacteria 2483
451 Ga0268264_10106096 3300028381 Bacteria 2452
452 Ga0307515_10000034 3300028794 Bacteria 344640
453 Ga0268256_1000310 3300030500 Bacteria 48923
454 Ga0268256_1002626 3300030500 Bacteria 8931
455 Ga0268256_1008491 3300030500 Bacteria 3512
456 Ga0316176_1073913 3300030732 Bacteria 2487
457 Ga0314311_1007068 3300030733 Bacteria 7871
458 Ga0316178_1083134 3300030735 Bacteria 7166
459 Ga0316183_1021165 3300030742 Bacteria 12700
460 Ga0316181_1009424 3300030744 Bacteria 6953
461 Ga0316182_1260907 3300030745 Bacteria 2818
462 Ga0316182_1320483 3300030745 Bacteria 3947
463 Ga0265327_10001420 3300031251 Bacteria 30486
464 Ga0307513_10064270 3300031456 Bacteria 3868
465 Ga0307408_100000048 3300031548 Bacteria 165579
466 Ga0307408_100113357 3300031548 Bacteria 2087
467 Ga0307514_10000241 3300031649 Bacteria 142059
468 Ga0307405_10011663 3300031731 Bacteria 4620
469 Ga0307405_10410872 3300031731 Bacteria 1062
470 Ga0307406_10000575 3300031901 Bacteria 21150
471 Ga0307406_10018312 3300031901 Bacteria 4089
472 Ga0307416_100029109 3300032002 Bacteria 4121
473 Ga0307416_100213790 3300032002 Bacteria 1842
474 Ga0307414_10272388 3300032004 Bacteria 1418
475 Ga0307507_10200504 3300033179 Bacteria 1381
476 Ga0395899_0006393 3300037312 Bacteria 9127
477 Ga0395900_0007035 3300037418 Bacteria 11650
478 Ga0395900_0273614 3300037418 Bacteria 1683
479 Ga0395900_0424486 3300037418 Bacteria 1290
480 Ga0395898_0005299 3300037466 Bacteria 13946
481 Ga0395905_0004239 3300037471 Bacteria 14986
482 Ga0395905_0134957 3300037471 Bacteria 2321
483 Ga0395905_0234994 3300037471 Bacteria 1713
484 Ga0395901_0034987 3300038443 Bacteria 5189
485 Ga0436365_0619898 3300039437 Bacteria 2566
486 Ga0436361_0335889 3300039447 Bacteria 24833
487 Ga0439436_0011989 3300041404 Bacteria 2632
488 Ga0451797_0267875 3300041453 Bacteria 1758
489 Ga0439442_002996 3300042002 Bacteria 3333
490 Ga0439452_000068 3300042010 Bacteria 90768
491 Ga0450911_000137 3300042115 Bacteria 29337
492 Ga0450923_005756 3300042125 Bacteria 2020
493 Ga0450898_006422 3300042134 Bacteria 1804
494 Ga0450898_013362 3300042134 Bacteria 1367
495 Ga0450906_015339 3300042145 Bacteria 1393
496 Ga0450910_015556 3300042147 Bacteria 1120
497 Ga0439434_0007810 3300042435 Bacteria 3136
498 Ga0439464_0013440 3300042439 Bacteria 2192
499 Ga0439464_0045304 3300042439 Bacteria 1262
500 Ga0450918_001088 3300042531 Bacteria 5593
501 Ga0450893_0016946 3300042532 Bacteria 1236
502 Ga0495627_034134 3300046453 Bacteria 1591
503 Ga0495590_0005754 3300046457 Bacteria 4871
504 Ga0495638_0028297 3300046460 Bacteria 3620
505 Ga0495639_0038848 3300046475 Bacteria 2138
506 Ga0495584_0090492 3300046491 Bacteria 1543
507 Ga0495610_0029518 3300046512 Bacteria 2886
508 Ga0495616_0000820 3300046513 Bacteria 22673
509 Ga0495620_0103668 3300046515 Bacteria 1132
510 Ga0495631_0001019 3300046518 Bacteria 17402
511 Ga0495637_0021953 3300046520 Bacteria 2918
512 Ga0495643_0008246 3300046522 Bacteria 6618
513 Ga0495643_0119533 3300046522 Bacteria 1333
514 Ga0495666_0029775 3300046526 Bacteria 2685
515 Ga0495654_0014840 3300046530 Bacteria 4140
516 Ga0495598_0010884 3300046537 Bacteria 2191
517 Ga0495621_0021875 3300046539 Bacteria 2113
518 Ga0495621_0058383 3300046539 Bacteria 1395
519 Ga0495597_0000271 3300046542 Bacteria 47044
520 Ga0495597_0003723 3300046542 Bacteria 8703
521 Ga0495597_0105947 3300046542 Bacteria 1182
522 Ga0495668_0051859 3300046616 Bacteria 2271
523 Ga0495625_0092173 3300046660 Bacteria 2094
524 Ga0495625_0184002 3300046660 Bacteria 1387
525 Ga0495661_0002118 3300046665 Bacteria 15560
526 Ga0495658_0139595 3300046683 Bacteria 1481
527 Ga0495604_0013867 3300047317 Bacteria 6428
528 Ga0495676_0001369 3300047321 Bacteria 20985
529 Ga0495687_000196 3300047443 Bacteria 87053
530 Ga0495687_004760 3300047443 Bacteria 8966
531 Ga0495593_0001089 3300047673 Bacteria 15869
532 Ga0495602_0071967 3300048088 Bacteria 2951
533 Ga0496101_0001615 3300048904 Bacteria 13560
534 Ga0496101_0010104 3300048904 Bacteria 6224
535 Ga0496102_0008762 3300048905 Bacteria 8674
536 Ga0496103_0109038 3300048906 Bacteria 1757
537 Ga0496104_0172719 3300048907 Bacteria 2072
538 Ga0496104_0517631 3300048907 Bacteria 1104
539 Ga0496105_0004091 3300048908 Bacteria 10927
540 Ga0496106_0077556 3300048909 Bacteria 2548
541 Ga0496107_0153890 3300048910 Bacteria 1702
542 Ga0496108_0034003 3300048911 Bacteria 4234
543 Ga0496108_0182242 3300048911 Bacteria 1819
544 Ga0496108_0255587 3300048911 Bacteria 1524
545 Ga0496110_0090050 3300048913 Bacteria 2743
546 Ga0496110_0121084 3300048913 Bacteria 2357
547 Ga0496114_0178959 3300048917 Bacteria 1851
548 Ga0496116_0000304 3300048919 Bacteria 82649
549 Ga0496116_0000729 3300048919 Bacteria 41969
550 Ga0496116_0005690 3300048919 Bacteria 11465
551 Ga0496116_0019405 3300048919 Bacteria 5206
552 Ga0496116_0088476 3300048919 Bacteria 1892
553 Ga0496117_0000758 3300048920 Bacteria 50906
554 Ga0496117_0005654 3300048920 Bacteria 13040
555 Ga0496117_0041815 3300048920 Bacteria 3352
556 Ga0496117_0113630 3300048920 Bacteria 1681
557 Ga0496118_0000287 3300048921 Bacteria 88069
558 Ga0496118_0014822 3300048921 Bacteria 7269
559 Ga0496118_0037928 3300048921 Bacteria 3870
560 Ga0496118_0076429 3300048921 Bacteria 2381
561 Ga0496119_0000005 3300048922 Bacteria 529799
562 Ga0496119_0010495 3300048922 Bacteria 7786
563 Ga0496119_0050293 3300048922 Bacteria 2570
564 Ga0496120_0000005 3300048923 Bacteria 529797
565 Ga0496120_0005639 3300048923 Bacteria 9917
566 Ga0496121_0000094 3300048924 Bacteria 212726
567 Ga0496121_0013192 3300048924 Bacteria 8906
568 Ga0496121_0016763 3300048924 Bacteria 7537
569 Ga0496121_0021214 3300048924 Bacteria 6375
570 Ga0496121_0181333 3300048924 Bacteria 1519
571 Ga0496122_0000063 3300048925 Bacteria 241378
572 Ga0496122_0011015 3300048925 Bacteria 9240
573 Ga0496122_0017450 3300048925 Bacteria 6710
574 Ga0496122_0083990 3300048925 Bacteria 2205
575 Ga0496122_0184009 3300048925 Bacteria 1242
576 Ga0496123_0000117 3300048926 Bacteria 161679
577 Ga0496123_0008799 3300048926 Bacteria 9206
578 Ga0496123_0026419 3300048926 Bacteria 4348
579 Ga0496123_0042578 3300048926 Bacteria 3132
580 Ga0496123_0085380 3300048926 Bacteria 1899
581 Ga0496124_0005381 3300048927 Bacteria 14451
582 Ga0496124_0012275 3300048927 Bacteria 8465
583 Ga0496124_0015120 3300048927 Bacteria 7418
584 Ga0496124_0022970 3300048927 Bacteria 5706
585 Ga0496124_0059047 3300048927 Bacteria 3223
586 Ga0496124_0133445 3300048927 Bacteria 1969
587 Ga0496124_0177633 3300048927 Bacteria 1642
588 Ga0496124_0255353 3300048927 Bacteria 1293
589 Ga0496125_0000095 3300048928 Bacteria 208094
590 Ga0496125_0001090 3300048928 Bacteria 41847
591 Ga0496125_0018519 3300048928 Bacteria 6613
592 Ga0496125_0020531 3300048928 Bacteria 6198
593 Ga0496125_0024806 3300048928 Bacteria 5505
594 Ga0496125_0031462 3300048928 Bacteria 4729
595 Ga0496125_0034095 3300048928 Bacteria 4492
596 Ga0496125_0098857 3300048928 Bacteria 2158
597 Ga0496126_0028596 3300048929 Bacteria 5310
598 Ga0496126_0031309 3300048929 Bacteria 5029
599 Ga0496126_0100799 3300048929 Bacteria 2527
600 Ga0496126_0156078 3300048929 Bacteria 1953
601 Ga0501072_0253641 3300049588 Bacteria 1401
602 Ga0501223_003419 3300049663 Bacteria 3462
603 Ga0501249_001925 3300049679 Bacteria 4220
604 Ga0501225_0003451 3300049705 Bacteria 4781
605 Ga0501035_0123926 3300049822 Bacteria 2257
606 Ga0501044_0115367 3300049823 Bacteria 2691
607 nmdc:mga03683_63052_c1 3300050489 Bacteria 1571
608 nmdc:mga03683_71584_c1 3300050489 Bacteria 1013
609 nmdc:mga03n38_53556_c1 3300050490 Bacteria 1810
610 nmdc:mga00v17_114866_c1 3300050491 Bacteria 1710
611 nmdc:mga00v17_32654_c1 3300050491 Bacteria 3078
612 nmdc:mga00v17_55685_c1 3300050491 Bacteria 2416
613 nmdc:mga00v17_8339_c1 3300050491 Bacteria 5576
614 nmdc:mga0yw44_2633_c1 3300050492 Bacteria 7729
615 nmdc:mga0yw44_341726_c1 3300050492 Bacteria 1007
616 nmdc:mga0k408_150105_c1 3300050493 Bacteria 1388
617 nmdc:mga0k408_2956_c1 3300050493 Bacteria 9007
618 nmdc:mga0k408_33655_c1 3300050493 Bacteria 2932
619 nmdc:mga0k408_3371_c1 3300050493 Bacteria 8464
620 nmdc:mga0k408_40214_c1 3300050493 Bacteria 2689
621 nmdc:mga0k408_4893_c1 3300050493 Bacteria 7104
622 nmdc:mga06z11_22419_c1 3300050494 Bacteria 2949
623 nmdc:mga07m45_111501_c1 3300050496 Bacteria 1576
624 nmdc:mga07m45_14094_c1 3300050496 Bacteria 4253
625 nmdc:mga07m45_401_c1 3300050496 Bacteria 17879
626 nmdc:mga07m45_4350_c1 3300050496 Bacteria 6929
627 nmdc:mga07m45_9111_c1 3300050496 Bacteria 5128
628 nmdc:mga09592_279_c1 3300050508 Bacteria 37141
629 nmdc:mga0qj67_25028_c1 3300050509 Bacteria 4607
630 Ga0500643_004351 3300053087 Bacteria 6447
631 Ga0500643_004392 3300053087 Bacteria 6398
632 Ga0500644_0033838 3300053088 Bacteria 1644
633 Ga0500651_0014707 3300053093 Bacteria 4791
634 Ga0500566_0048225 3300053094 Bacteria 2443
635 Ga0500562_003136 3300053108 Bacteria 4129
636 Ga0500562_019951 3300053108 Bacteria 1738
637 Ga0500571_000027 3300053110 Bacteria 51623
638 Ga0500608_002433 3300053122 Bacteria 6769
639 Ga0500608_035318 3300053122 Bacteria 2384
640 Ga0500655_000333 3300053133 Bacteria 10412
641 Ga0500658_0000114 3300053134 Bacteria 38111
642 Ga0500658_0000684 3300053134 Bacteria 13995
643 Ga0500559_0014205 3300053136 Bacteria 3365
644 Ga0500568_0002311 3300053139 Bacteria 11314
645 Ga0500574_009494 3300053141 Bacteria 2115
646 Ga0500634_0001368 3300053161 Bacteria 9389
647 Ga0500634_0008187 3300053161 Bacteria 5213
648 Ga0500638_001743 3300053162 Bacteria 7106
649 Ga0500636_0001401 3300053177 Bacteria 13118
650 2548500900 2547132374 Bacteria 5530232
651 2599626028 2599185214 Bacteria 8209958
652 2599674890 2599185226 Bacteria 8233575
653 2599683784 2599185227 Bacteria 8246414
654 2599695613 2599185229 Bacteria 8216126
655 2599903528 2599185292 Bacteria 6290804
656 2599926831 2599185299 Bacteria 4854625
657 2643866599 2643221570 Bacteria 5103772
658 2643991420 2643221596 Bacteria 5006805
659 2644062805 2643221609 Bacteria 6756331
660 2644076700 2643221611 Bacteria 6820941
661 2644296347 2643221652 Bacteria 5140275
662 2644400135 2643221672 Bacteria 6322190
663 2644647695 2643221717 Bacteria 5676132
664 2650896069 2648501693 Bacteria 5069560
665 2686356759 2684622997 Bacteria 4624240
666 2722883298 2721755523 Bacteria 6430384
667 2738720865 2738541277 Bacteria 7458140
668 2739244520 2738543012 Bacteria 7115078
669 2739248378 2738543013 Bacteria 5618633
670 2739280064 2738543019 Bacteria 7459457
671 2809127268 2808606414 Bacteria 4917181
672 2816474016 2816332133 Bacteria 7249298
673 2819600298 2818991446 Bacteria 7757362
674 2831271908 2831265667 Bacteria 7184833
675 2838059746 2838054893 Bacteria 7451788
676 2839143756 2839138175 Bacteria 6549354
677 2842682371 2842677519 Bacteria 5615038
678 2842719146 2842718218 Bacteria 4560148
679 2847798650 2847797336 Bacteria 5176640
680 2881104736 2881101125 Bacteria 4590519
681 2899928527 2899924645 Bacteria 7487985
682 2904453654 2904449895 Bacteria 6927402
683 2904459050 2904456579 Bacteria 6819253
684 2904483817 2904479285 Bacteria 5073931
685 2904549625 2904541872 Bacteria 8915136
686 2919705136 2919704043 Bacteria 5560311
687 2928041452 2928037797 Bacteria 7273642
688 2928048294 2928044640 Bacteria 7271509
689 2928055519 2928051484 Bacteria 7773759
690 2928056134 2928051484 Bacteria 7773759
691 2928066386 2928064002 Bacteria 7419480
692 2928076199 2928070936 Bacteria 8062541
693 2928086211 2928084124 Bacteria 7159212
694 2929166625 2929160207 Bacteria 9075316
695 2929524279 2929520902 Bacteria 6765052
696 2939606343 2939602548 Bacteria 4950493
697 2941484464
698 2954768038 2954767861 Bacteria 5535784
699 2974323296 2974320154 Bacteria 4571377
700 2984497869 2984494565 Bacteria 5000175
701 2990265372 2990261002 Bacteria 4919493
702 2990712212 2990710928 Bacteria 5002431
703 8048749446 8048746797 Bacteria 3557226
704 8055228530 8055225921 Bacteria 3341787
705 Ga0495676_0148827
706 JGI24739J22299_10000552
707 JGI25152J39213_1004142
708 JGI25150J39212_1000775
709 JGI25159J45721_1001723
710 JGI25151J46595_10001812
711 JGI25151J46595_10007029
712 JGI25153J46596_10004018
713 rootH1_10004795
714 rootH2_10062676
715 rootL2_10002392
716 rootL2_10002696
717 rootH1_10015486
718 JGI25160J50197_1005064
719 JGI25160J50197_1005195
720 JGI25161J50226_1001404
721 JGI25161J50226_1002166
722 Ga0055542_1000127
723 Ga0055529_1001542
724 Ga0055526_1007653
725 Ga0055526_1012185
726 Ga0055537_1002831
727 Ga0055524_1005618
728 Ga0055524_1005619
729 Ga0055536_1001127
730 Ga0055536_1002533
731 Ga0055536_1007829
732 Ga0055534_1002993
733 Ga0055534_1004483
734 Ga0055528_1005990
735 Ga0055530_10000503
736 Ga0055530_10009571
737 Ga0055540_1000142
738 Ga0055540_1001148
739 Ga0055540_1002310
740 Ga0055540_1023554
741 Ga0055531_10000424
742 Ga0055531_10001995
743 Ga0058692_1001362
744 Ga0058692_1002854
745 Ga0055543_1000926
746 Ga0065165_1002808
747 Ga0065714_10068311
748 Ga0065704_10081506
749 Ga0070676_10004601
750 Ga0070676_10255136
751 Ga0070690_100009433
752 Ga0070690_100047880
753 Ga0070670_100039904
754 Ga0070670_100309315
755 Ga0070670_100368063
756 Ga0070677_10014435
757 Ga0070677_10016655
758 Ga0070677_10030919
759 Ga0068869_100011077
760 Ga0068869_100012518
761 Ga0068869_100031362
762 Ga0068869_100216971
763 Ga0070666_10020203
764 Ga0070666_10039876
765 Ga0070666_10181550
766 Ga0068868_100037908
767 Ga0068868_100056382
768 Ga0068868_100067906
769 Ga0070689_100027295
770 Ga0070668_100005095
771 Ga0070668_100168716
772 Ga0070669_100003928
773 Ga0070669_100039927
774 Ga0070675_100000867
775 Ga0070675_100002412
776 Ga0070675_100081791
777 Ga0070671_100007799
778 Ga0070671_100042525
779 Ga0070671_100048851
780 Ga0070671_100364888
781 Ga0070674_100002652
782 Ga0070674_100004011
783 Ga0070674_100014171
784 Ga0070674_100025028
785 Ga0070674_100034062
786 Ga0070674_100184332
787 Ga0070673_100000636
788 Ga0070673_100003720
789 Ga0070673_100040145
790 Ga0070673_100048465
791 Ga0070673_100057850
792 Ga0070688_100045989
793 Ga0070667_100003829
794 Ga0070667_100006773
795 Ga0070667_100025932
796 Ga0070667_100050962
797 Ga0070667_100163180
798 Ga0070667_100181353
799 Ga0070700_100243249
800 Ga0070663_100262258
801 Ga0070678_100028216
802 Ga0070678_100147670
803 Ga0070662_100009155
804 Ga0070662_100037335
805 Ga0070662_100067213
806 Ga0068867_100002629
807 Ga0068867_100016573
808 Ga0068867_100019670
809 Ga0068867_100072857
810 Ga0068867_100260904
811 Ga0068853_100088254
812 Ga0068853_100308470
813 Ga0068853_100395500
814 Ga0070672_100010747
815 Ga0070672_100014574
816 Ga0070672_100031629
817 Ga0070672_100036062
818 Ga0070672_100043078
819 Ga0070672_100066213
820 Ga0070686_100074145
821 Ga0070665_100028335
822 Ga0070665_100579392
823 Ga0070664_100040055
824 Ga0070664_100066038
825 Ga0068857_100048003
826 Ga0068857_100124186
827 Ga0068852_100048760
828 Ga0068852_100052408
829 Ga0068852_100113707
830 Ga0068859_100059297
831 Ga0068859_100077867
832 Ga0068864_100001800
833 Ga0068864_100005187
834 Ga0068864_100071025
835 Ga0068866_10010784
836 Ga0068866_10047177
837 Ga0068861_100001031
838 Ga0068861_100006400
839 Ga0068851_10026313
840 Ga0068851_10032297
841 Ga0068851_10083326
842 Ga0068851_10106335
843 Ga0068870_10114408
844 Ga0068863_100001722
845 Ga0068863_100006998
846 Ga0068863_100044836
847 Ga0068858_100010139
848 Ga0068858_100034855
849 Ga0068858_100035822
850 Ga0068860_100001567
851 Ga0068860_100052678
852 Ga0068860_100135208
853 Ga0068862_100025291
854 Ga0068862_100438050
855 Ga0075365_10047672
856 Ga0075364_10001315
857 Ga0075364_10005633
858 Ga0075364_10048211
859 Ga0075364_10176634
860 Ga0075432_10033182
861 Ga0075362_10006037
862 Ga0075362_10007293
863 Ga0075362_10035060
864 Ga0075367_10033860
865 Ga0075367_10161354
866 Ga0075369_10005814
867 Ga0075369_10018982
868 Ga0075369_10038661
869 Ga0075366_10004402
870 Ga0075366_10004730
871 Ga0075366_10005398
872 Ga0075366_10016652
873 Ga0075366_10185094
874 Ga0097621_100020094
875 Ga0097621_100030205
876 Ga0075370_10000362
877 Ga0075370_10002990
878 Ga0075370_10018538
879 Ga0075370_10042180
880 Ga0068871_100017041
881 Ga0068871_100075544
882 Ga0075430_100069041
883 Ga0075429_100003836
884 Ga0068865_100022269
885 Ga0068865_100025301
886 Ga0097620_100059296
887 Ga0097620_100077866
888 Ga0099826_10000023
889 Ga0099826_10007158
890 Ga0105251_10002295
891 Ga0105244_10003718
892 Ga0105244_10010700
893 Ga0105244_10059140
894 Ga0105250_10022124
895 Ga0105240_10084452
896 Ga0105243_10001727
897 Ga0105243_10005672
898 Ga0105243_10034866
899 Ga0105243_10224972
900 Ga0105243_10290919
901 Ga0105243_10458779
902 Ga0105241_10332306
903 Ga0105242_10012717
904 Ga0105242_10035627
905 Ga0105242_10090084
906 Ga0105242_10129670
907 Ga0105242_10137976
908 Ga0105248_10026525
909 Ga0105248_10063935
910 Ga0105248_10100638
911 Ga0105248_10172139
912 Ga0105237_10017444
913 Ga0105237_10113208
914 Ga0105238_10357550
915 Ga0105249_10009014
916 Ga0105249_10024652
917 Ga0105249_10251733
918 Ga0105249_10547546
919 Ga0105239_10754298
920 Ga0105246_10071291
921 Ga0157371_10103405
922 Ga0157370_10000355
923 Ga0157370_10005163
924 Ga0157370_10053102
925 Ga0157369_10370154
926 Ga0157374_10219804
927 Ga0157374_10359856
928 Ga0157374_10669180
929 Ga0157378_10007266
930 Ga0157378_10032465
931 Ga0163162_10004491
932 Ga0163162_10035520
933 Ga0163162_10293408
934 Ga0157372_10454691
935 Ga0157375_10008158
936 Ga0157375_10077926
937 Ga0157375_10082197
938 Ga0157375_10087913
939 Ga0163163_10004780
940 Ga0157380_10002852
941 Ga0157380_10014614
942 Ga0157380_10056853
943 Ga0157380_10077947
944 Ga0157380_10173652
945 Ga0182008_10000256
946 Ga0182008_10002592
947 Ga0182008_10022441
948 Ga0182008_10022563
949 Ga0182008_10064590
950 Ga0182008_10077486
951 Ga0182008_10119892
952 Ga0157379_10021478
953 Ga0157379_10046143
954 Ga0157379_10070070
955 Ga0157379_10123835
956 Ga0157376_10018109
957 Ga0157376_10022136
958 Ga0182006_1006572
959 Ga0182006_1008663
960 Ga0182007_10004924
961 Ga0182007_10015558
962 Ga0182007_10041432
963 Ga0163161_10000201
964 Ga0163161_10058971
965 Ga0163161_10065023
966 Ga0163161_10072444
967 Ga0213876_10060896
968 Ga0209436_102685
969 Ga0209436_105024
970 Ga0209672_100172
971 Ga0209147_100934
972 Ga0209258_100078
973 Ga0209258_102336
974 Ga0207425_1000220
975 Ga0207425_1011013
976 Ga0209148_1000086
977 Ga0209129_1000707
978 Ga0209129_1000904
979 Ga0209129_1001750
980 Ga0209565_1000193
981 Ga0209565_1006038
982 Ga0209673_1000168
983 Ga0209673_1000355
984 Ga0209130_1000810
985 Ga0209130_1001236
986 Ga0209130_1001907
987 Ga0209675_1001053
988 Ga0209675_1001228
989 Ga0209675_1007200
990 Ga0209676_1000103
991 Ga0209676_1000152
992 Ga0209676_1010674
993 Ga0209676_1023532
994 Ga0209025_1000201
995 Ga0209025_1000839
996 Ga0209025_1014376
997 Ga0209025_1045127
998 Ga0209564_1000289
999 Ga0209564_1000391
1000 Ga0209758_1000034
1001 Ga0209758_1007283
1002 Ga0209758_1020465
1003 Ga0209050_1000012
1004 Ga0209050_1000210
1005 Ga0209050_1004904
1006 Ga0209256_1000066
1007 Ga0209256_1000318
1008 Ga0207426_1000067
1009 Ga0207426_1000266
1010 Ga0209051_1000019
1011 Ga0209051_1000074
1012 Ga0209051_1001472
1013 Ga0209051_1003040
1014 Ga0209051_1017090
1015 Ga0209257_1000024
1016 Ga0209257_1000072
1017 Ga0209257_1004029
1018 Ga0207697_10009122
1019 Ga0207656_10152662
1020 Ga0207655_1079783
1021 Ga0207713_1016462
1022 Ga0207682_10004300
1023 Ga0207682_10014163
1024 Ga0207682_10021127
1025 Ga0207682_10034152
1026 Ga0207682_10040471
1027 Ga0207642_10003819
1028 Ga0207642_10097159
1029 Ga0207688_10053187
1030 Ga0207680_10000628
1031 Ga0207680_10010325
1032 Ga0207645_10018671
1033 Ga0207645_10019539
1034 Ga0207645_10086866
1035 Ga0207643_10070697
1036 Ga0207643_10106003
1037 Ga0207695_10360671
1038 Ga0207671_10098311
1039 Ga0207681_10001666
1040 Ga0207681_10005868
1041 Ga0207681_10045496
1042 Ga0207681_10141502
1043 Ga0207694_10157975
1044 Ga0207694_10226237
1045 Ga0207650_10000395
1046 Ga0207650_10005656
1047 Ga0207650_10056569
1048 Ga0207650_10189814
1049 Ga0207650_10295487
1050 Ga0207659_10000361
1051 Ga0207659_10001382
1052 Ga0207659_10027036
1053 Ga0207659_10109655
1054 Ga0207644_10009812
1055 Ga0207644_10021084
1056 Ga0207644_10056053
1057 Ga0207706_10031298
1058 Ga0207706_10046097
1059 Ga0207706_10092563
1060 Ga0207706_10278116
1061 Ga0207686_10018549
1062 Ga0207686_10032970
1063 Ga0207686_10101825
1064 Ga0207709_10000112
1065 Ga0207709_10000999
1066 Ga0207709_10012395
1067 Ga0207709_10088800
1068 Ga0207709_10239737
1069 Ga0207669_10008907
1070 Ga0207669_10010328
1071 Ga0207669_10011808
1072 Ga0207669_10016396
1073 Ga0207704_10003637
1074 Ga0207704_10097920
1075 Ga0207691_10000792
1076 Ga0207691_10013268
1077 Ga0207691_10047144
1078 Ga0207691_10047772
1079 Ga0207691_10054700
1080 Ga0207691_10104190
1081 Ga0207711_10004659
1082 Ga0207711_10008644
1083 Ga0207711_10021685
1084 Ga0207711_10109609
1085 Ga0207689_10006875
1086 Ga0207689_10027313
1087 Ga0207689_10041585
1088 Ga0207689_10455466
1089 Ga0207661_10039909
1090 Ga0207679_10030948
1091 Ga0207679_10239356
1092 Ga0207667_10018380
1093 Ga0207651_10000398
1094 Ga0207651_10020813
1095 Ga0207651_10155595
1096 Ga0207712_10009514
1097 Ga0207712_10027282
1098 Ga0207668_10008172
1099 Ga0207668_10045220
1100 Ga0207668_10055915
1101 Ga0207640_10043615
1102 Ga0207640_10271795
1103 Ga0207658_10002681
1104 Ga0207658_10007158
1105 Ga0207658_10070074
1106 Ga0207658_10080443
1107 Ga0207658_10241606
1108 Ga0207677_10012056
1109 Ga0207677_10054957
1110 Ga0207677_10592005
1111 Ga0207703_10008523
1112 Ga0207703_10090385
1113 Ga0207639_10107200
1114 Ga0207639_10144464
1115 Ga0207639_10370319
1116 Ga0207678_10019463
1117 Ga0207678_10127924
1118 Ga0207708_10016701
1119 Ga0207641_10004010
1120 Ga0207641_10006561
1121 Ga0207648_10002731
1122 Ga0207648_10005525
1123 Ga0207648_10020733
1124 Ga0207648_10020894
1125 Ga0207648_10043492
1126 Ga0207648_10064840
1127 Ga0207648_10065521
1128 Ga0207676_10000082
1129 Ga0207676_10013301
1130 Ga0207676_10026597
1131 Ga0207676_10032458
1132 Ga0207674_10060789
1133 Ga0207674_10079187
1134 Ga0207675_100012003
1135 Ga0207675_100034565
1136 Ga0207683_10008053
1137 Ga0207683_10008094
1138 Ga0207683_10050736
1139 Ga0207683_10060353
1140 Ga0207683_10102470
1141 Ga0207683_10156837
1142 Ga0207698_10004335
1143 Ga0207698_10118371
1144 Ga0207698_10137730
1145 Ga0209371_1000363
1146 Ga0209371_1002523
1147 Ga0209371_1002974
1148 Ga0209371_1003137
1149 Ga0209282_1000047
1150 Ga0268266_10035509
1151 Ga0268265_10010659
1152 Ga0268264_10004490
1153 Ga0268264_10009726
1154 Ga0268264_10103159
1155 Ga0268264_10106096
1156 Ga0307515_10000034
1157 Ga0268256_1000310
1158 Ga0268256_1002626
1159 Ga0268256_1008491
1160 Ga0316176_1073913
1161 Ga0314311_1007068
1162 Ga0316178_1083134
1163 Ga0316183_1021165
1164 Ga0316181_1009424
1165 Ga0316182_1260907
1166 Ga0316182_1320483
1167 Ga0265327_10001420
1168 Ga0307513_10064270
1169 Ga0307408_100000048
1170 Ga0307408_100113357
1171 Ga0307514_10000241
1172 Ga0307405_10011663
1173 Ga0307405_10410872
1174 Ga0307406_10000575
1175 Ga0307406_10018312
1176 Ga0307416_100029109
1177 Ga0307416_100213790
1178 Ga0307414_10272388
1179 Ga0307507_10200504
1180 Ga0395899_0006393
1181 Ga0395900_0007035
1182 Ga0395900_0273614
1183 Ga0395900_0424486
1184 Ga0395898_0005299
1185 Ga0395905_0004239
1186 Ga0395905_0134957
1187 Ga0395905_0234994
1188 Ga0395901_0034987
1189 Ga0436365_0619898
1190 Ga0436361_0335889
1191 Ga0439436_0011989
1192 Ga0451797_0267875
1193 Ga0439442_002996
1194 Ga0439452_000068
1195 Ga0450911_000137
1196 Ga0450923_005756
1197 Ga0450898_006422
1198 Ga0450898_013362
1199 Ga0450906_015339
1200 Ga0450910_015556
1201 Ga0439434_0007810
1202 Ga0439464_0013440
1203 Ga0439464_0045304
1204 Ga0450918_001088
1205 Ga0450893_0016946
1206 Ga0495627_034134
1207 Ga0495590_0005754
1208 Ga0495638_0028297
1209 Ga0495639_0038848
1210 Ga0495584_0090492
1211 Ga0495610_0029518
1212 Ga0495616_0000820
1213 Ga0495620_0103668
1214 Ga0495631_0001019
1215 Ga0495637_0021953
1216 Ga0495643_0008246
1217 Ga0495643_0119533
1218 Ga0495666_0029775
1219 Ga0495654_0014840
1220 Ga0495598_0010884
1221 Ga0495621_0021875
1222 Ga0495621_0058383
1223 Ga0495597_0000271
1224 Ga0495597_0003723
1225 Ga0495597_0105947
1226 Ga0495668_0051859
1227 Ga0495625_0092173
1228 Ga0495625_0184002
1229 Ga0495661_0002118
1230 Ga0495658_0139595
1231 Ga0495604_0013867
1232 Ga0495676_0001369
1233 Ga0495687_000196
1234 Ga0495687_004760
1235 Ga0495593_0001089
1236 Ga0495602_0071967
1237 Ga0496101_0001615
1238 Ga0496101_0010104
1239 Ga0496102_0008762
1240 Ga0496103_0109038
1241 Ga0496104_0172719
1242 Ga0496104_0517631
1243 Ga0496105_0004091
1244 Ga0496106_0077556
1245 Ga0496107_0153890
1246 Ga0496108_0034003
1247 Ga0496108_0182242
1248 Ga0496108_0255587
1249 Ga0496110_0090050
1250 Ga0496110_0121084
1251 Ga0496114_0178959
1252 Ga0496116_0000304
1253 Ga0496116_0000729
1254 Ga0496116_0005690
1255 Ga0496116_0019405
1256 Ga0496116_0088476
1257 Ga0496117_0000758
1258 Ga0496117_0005654
1259 Ga0496117_0041815
1260 Ga0496117_0113630
1261 Ga0496118_0000287
1262 Ga0496118_0014822
1263 Ga0496118_0037928
1264 Ga0496118_0076429
1265 Ga0496119_0000005
1266 Ga0496119_0010495
1267 Ga0496119_0050293
1268 Ga0496120_0000005
1269 Ga0496120_0005639
1270 Ga0496121_0000094
1271 Ga0496121_0013192
1272 Ga0496121_0016763
1273 Ga0496121_0021214
1274 Ga0496121_0181333
1275 Ga0496122_0000063
1276 Ga0496122_0011015
1277 Ga0496122_0017450
1278 Ga0496122_0083990
1279 Ga0496122_0184009
1280 Ga0496123_0000117
1281 Ga0496123_0008799
1282 Ga0496123_0026419
1283 Ga0496123_0042578
1284 Ga0496123_0085380
1285 Ga0496124_0005381
1286 Ga0496124_0012275
1287 Ga0496124_0015120
1288 Ga0496124_0022970
1289 Ga0496124_0059047
1290 Ga0496124_0133445
1291 Ga0496124_0177633
1292 Ga0496124_0255353
1293 Ga0496125_0000095
1294 Ga0496125_0001090
1295 Ga0496125_0018519
1296 Ga0496125_0020531
1297 Ga0496125_0024806
1298 Ga0496125_0031462
1299 Ga0496125_0034095
1300 Ga0496125_0098857
1301 Ga0496126_0028596
1302 Ga0496126_0031309
1303 Ga0496126_0100799
1304 Ga0496126_0156078
1305 Ga0501072_0253641
1306 Ga0501223_003419
1307 Ga0501249_001925
1308 Ga0501225_0003451
1309 Ga0501035_0123926
1310 Ga0501044_0115367
1311 nmdc:mga03683_63052_c1
1312 nmdc:mga03683_71584_c1
1313 nmdc:mga03n38_53556_c1
1314 nmdc:mga00v17_114866_c1
1315 nmdc:mga00v17_32654_c1
1316 nmdc:mga00v17_55685_c1
1317 nmdc:mga00v17_8339_c1
1318 nmdc:mga0yw44_2633_c1
1319 nmdc:mga0yw44_341726_c1
1320 nmdc:mga0k408_150105_c1
1321 nmdc:mga0k408_2956_c1
1322 nmdc:mga0k408_33655_c1
1323 nmdc:mga0k408_3371_c1
1324 nmdc:mga0k408_40214_c1
1325 nmdc:mga0k408_4893_c1
1326 nmdc:mga06z11_22419_c1
1327 nmdc:mga07m45_111501_c1
1328 nmdc:mga07m45_14094_c1
1329 nmdc:mga07m45_401_c1
1330 nmdc:mga07m45_4350_c1
1331 nmdc:mga07m45_9111_c1
1332 nmdc:mga09592_279_c1
1333 nmdc:mga0qj67_25028_c1
1334 Ga0500643_004351
1335 Ga0500643_004392
1336 Ga0500644_0033838
1337 Ga0500651_0014707
1338 Ga0500566_0048225
1339 Ga0500562_003136
1340 Ga0500562_019951
1341 Ga0500571_000027
1342 Ga0500608_002433
1343 Ga0500608_035318
1344 Ga0500655_000333
1345 Ga0500658_0000114
1346 Ga0500658_0000684
1347 Ga0500559_0014205
1348 Ga0500568_0002311
1349 Ga0500574_009494
1350 Ga0500634_0001368
1351 Ga0500634_0008187
1352 Ga0500638_001743
1353 Ga0500636_0001401
1354 2548500900
1355 2599626028
1356 2599674890
1357 2599683784
1358 2599695613
1359 2599903528
1360 2599926831
1361 2643866599
1362 2643991420
1363 2644062805
1364 2644076700
1365 2644296347
1366 2644400135
1367 2644647695
1368 2650896069
1369 2686356759
1370 2722883298
1371 2738720865
1372 2739244520
1373 2739248378
1374 2739280064
1375 2809127268
1376 2816474016
1377 2819600298
1378 2831271908
1379 2838059746
1380 2839143756
1381 2842682371
1382 2842719146
1383 2847798650
1384 2881104736
1385 2899928527
1386 2904453654
1387 2904459050
1388 2904483817
1389 2904549625
1390 2919705136
1391 2928041452
1392 2928048294
1393 2928055519
1394 2928056134
1395 2928066386
1396 2928076199
1397 2928086211
1398 2929166625
1399 2929524279
1400 2939606343
1401 2941484464
1402 2954768038
1403 2974323296
1404 2984497869
1405 2990265372
1406 2990712212
1407 8048749446
1408 8055228530

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

43

276

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ris-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate 0.9173 44 305
8dk0-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma-valerolactone 0.9173 44 305
7riz-assembly1.cif.gz_A crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline 0.9113 44 305
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.876 43 305
4gna-assembly1.cif.gz_A mouse smp30/gnl-xylitol complex 0.8727 44 306
ID Description Score Start End Superfamily
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8848 44 306 2.120.10.30
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8755 44 306 2.120.10.30
5xfeA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8584 44 305 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.855 43 301 2.120.10.30
2dg0A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8531 7 306 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2V3SE48-F1-model_v4 deleted 0.9875 1 310
AF-A0A257JG88-F1-model_v4 Gluconolactonase 0.9865 154 302 GO:0016787
GO:0046872
AF-D4XJB0-F1-model_v4 SMP-30/Gluconolaconase/LRE-like region 0.9827 11 302 GO:0016787
GO:0046872
AF-A0A246NCY1-F1-model_v4 Gluconolactonase 0.981 1 310 GO:0016787
GO:0046872
AF-H1S0X3-F1-model_v4 Gluconolactonase 0.9802 173 302 GO:0016787
GO:0046872

Map