F476374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 326 | 688 | 244 |
Family's Representative Sequence
| Representative Sequence | 3300046691|Ga0495670_0000028|Ga0495670_0000028_19659_20504 |
| Length | 281 |
| Sequence | MLSASCDAHWSDVCCLTGFPQAGKAPVAFRGAIPYIGAMHLRAEAIILSVRAHGEHGAVVRALTESDGLQPGYVRGGRSRALRPVLQPANLVLGEWRSRTEDQLAGLTVELIHSRAPMFGEPLPAAAFEWATALTAATLPDAQPYPRLYSALDGVLAAIEAAPAARGWAVALVRYELLLLAELGFGLDLEHCAATGRNDDLAFVSPKSGIAVSRLGAEGYEKRLLALPRFLFEGGEADWDDILAGLKLTGHFLERDLLIGKGADTLAARARLVDRLLRAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 5 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 6 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 7 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 8 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 9 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 10 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 11 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 12 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 13 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 14 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 15 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 16 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 17 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 26 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 27 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 28 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 29 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 30 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 31 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 32 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 35 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 216 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 222 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 226 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 229 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 284 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 285 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 297 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 306 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 315 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 316 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 321 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 324 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.59 |
| Metatranscriptomes | 0.14 |
| Isolates | 2.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 8.95 |
| Nodule | 0 |
| Rhizoplane | 4.97 |
| Rhizosphere | 76.28 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 9.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1489105 | 2162886007 | Bacteria | 7422 |
| 2 | JGI24736J21556_1002251 | 3300001904 | Bacteria | 3412 |
| 3 | JGI24741J21665_1000549 | 3300001915 | Bacteria | 11447 |
| 4 | JGI24752J21851_1001710 | 3300001976 | Bacteria | 2943 |
| 5 | JGI24740J21852_10004963 | 3300001979 | Bacteria | 5657 |
| 6 | JGI24740J21852_10005015 | 3300001979 | Bacteria | 5624 |
| 7 | JGI24739J22299_10011325 | 3300001989 | Bacteria | 3294 |
| 8 | JGI24737J22298_10002940 | 3300001990 | Bacteria | 6039 |
| 9 | JGI24737J22298_10005153 | 3300001990 | Bacteria | 4525 |
| 10 | JGI24735J21928_10001689 | 3300002067 | Bacteria | 7795 |
| 11 | JGI24735J21928_10002252 | 3300002067 | Bacteria | 6743 |
| 12 | JGI24735J21928_10003032 | 3300002067 | Bacteria | 5764 |
| 13 | JGI24735J21928_10010004 | 3300002067 | Bacteria | 3035 |
| 14 | JGI24735J21928_10015767 | 3300002067 | Bacteria | 2352 |
| 15 | JGI24735J21928_10050673 | 3300002067 | Bacteria | 1199 |
| 16 | JGI24750J21931_1000042 | 3300002070 | Bacteria | 16868 |
| 17 | JGI24748J21848_1000063 | 3300002074 | Bacteria | 40664 |
| 18 | JGI24738J21930_10001001 | 3300002075 | Bacteria | 8087 |
| 19 | JGI24738J21930_10001487 | 3300002075 | Bacteria | 6511 |
| 20 | JGI24744J21845_10002202 | 3300002077 | Bacteria | 3961 |
| 21 | JGI24034J26672_10000007 | 3300002239 | Bacteria | 224370 |
| 22 | JGI25150J39212_1002132 | 3300002774 | Bacteria | 5113 |
| 23 | JGI25165J46597_1000145 | 3300003214 | Bacteria | 116948 |
| 24 | JGI25153J46596_10000028 | 3300003215 | Bacteria | 209842 |
| 25 | rootH2_10161563 | 3300003320 | Bacteria | 1182 |
| 26 | rootH2_10235635 | 3300003320 | Bacteria | 2669 |
| 27 | rootL2_10107312 | 3300003322 | Bacteria | 1065 |
| 28 | rootH1_10190613 | 3300003323 | Bacteria | 1084 |
| 29 | Ga0055526_1000478 | 3300003771 | Bacteria | 31736 |
| 30 | Ga0055537_1001154 | 3300003773 | Bacteria | 11291 |
| 31 | Ga0055524_1000457 | 3300003775 | Bacteria | 33415 |
| 32 | Ga0055530_10041505 | 3300003791 | Bacteria | 1122 |
| 33 | Ga0055540_1001446 | 3300003792 | Bacteria | 14141 |
| 34 | Ga0055540_1001525 | 3300003792 | Bacteria | 13634 |
| 35 | Ga0055531_10000384 | 3300003794 | Bacteria | 42713 |
| 36 | Ga0065165_1002862 | 3300005262 | Bacteria | 13339 |
| 37 | Ga0065165_1003940 | 3300005262 | Bacteria | 9774 |
| 38 | Ga0065165_1031534 | 3300005262 | Bacteria | 1674 |
| 39 | Ga0065165_1044517 | 3300005262 | Bacteria | 1298 |
| 40 | Ga0065704_10007250 | 3300005289 | Bacteria | 4185 |
| 41 | Ga0065704_10072419 | 3300005289 | Bacteria | 8555 |
| 42 | Ga0065707_10082875 | 3300005295 | Bacteria | 11637 |
| 43 | Ga0070658_10000033 | 3300005327 | Bacteria | 147380 |
| 44 | Ga0070658_10037857 | 3300005327 | Bacteria | 3889 |
| 45 | Ga0070658_10160501 | 3300005327 | Bacteria | 1886 |
| 46 | Ga0070676_10411414 | 3300005328 | Bacteria | 943 |
| 47 | Ga0070676_10503058 | 3300005328 | Bacteria | 860 |
| 48 | Ga0070690_100000110 | 3300005330 | Bacteria | 42574 |
| 49 | Ga0070690_100019099 | 3300005330 | Bacteria | 4153 |
| 50 | Ga0070670_100000075 | 3300005331 | Bacteria | 97494 |
| 51 | Ga0070670_100050727 | 3300005331 | Bacteria | 3565 |
| 52 | Ga0070670_100085590 | 3300005331 | Bacteria | 2708 |
| 53 | Ga0070670_100111155 | 3300005331 | Bacteria | 2361 |
| 54 | Ga0070670_100169856 | 3300005331 | Bacteria | 1891 |
| 55 | Ga0068869_100191317 | 3300005334 | Bacteria | 1609 |
| 56 | Ga0070666_10000417 | 3300005335 | Bacteria | 26409 |
| 57 | Ga0070666_10003441 | 3300005335 | Bacteria | 9590 |
| 58 | Ga0070660_100002857 | 3300005339 | Bacteria | 11892 |
| 59 | Ga0070660_100011482 | 3300005339 | Bacteria | 6296 |
| 60 | Ga0070660_100054688 | 3300005339 | Bacteria | 3083 |
| 61 | Ga0070660_100063008 | 3300005339 | Bacteria | 2882 |
| 62 | Ga0070660_100073995 | 3300005339 | Bacteria | 2665 |
| 63 | Ga0070660_100090135 | 3300005339 | Bacteria | 2417 |
| 64 | Ga0070660_100092582 | 3300005339 | Bacteria | 2386 |
| 65 | Ga0070660_100135012 | 3300005339 | Bacteria | 1977 |
| 66 | Ga0070660_100173181 | 3300005339 | Bacteria | 1744 |
| 67 | Ga0070661_100130953 | 3300005344 | Bacteria | 1884 |
| 68 | Ga0070661_100199930 | 3300005344 | Bacteria | 1527 |
| 69 | Ga0070661_100254965 | 3300005344 | Bacteria | 1355 |
| 70 | Ga0070661_100274167 | 3300005344 | Bacteria | 1307 |
| 71 | Ga0070692_10018735 | 3300005345 | Bacteria | 3333 |
| 72 | Ga0070668_100089004 | 3300005347 | Bacteria | 2431 |
| 73 | Ga0070669_100000332 | 3300005353 | Bacteria | 36750 |
| 74 | Ga0070669_100037676 | 3300005353 | Bacteria | 3508 |
| 75 | Ga0070675_100001516 | 3300005354 | Bacteria | 17164 |
| 76 | Ga0070675_100146846 | 3300005354 | Bacteria | 2020 |
| 77 | Ga0070671_100022882 | 3300005355 | Bacteria | 5107 |
| 78 | Ga0070671_100055455 | 3300005355 | Bacteria | 3297 |
| 79 | Ga0070671_100061130 | 3300005355 | Bacteria | 3137 |
| 80 | Ga0070671_100073726 | 3300005355 | Bacteria | 2851 |
| 81 | Ga0070671_100099761 | 3300005355 | Bacteria | 2436 |
| 82 | Ga0070674_100021920 | 3300005356 | Bacteria | 4112 |
| 83 | Ga0070674_100092379 | 3300005356 | Bacteria | 2187 |
| 84 | Ga0070673_100002629 | 3300005364 | Bacteria | 10985 |
| 85 | Ga0070659_100002258 | 3300005366 | Bacteria | 13727 |
| 86 | Ga0070659_100022028 | 3300005366 | Bacteria | 4862 |
| 87 | Ga0070659_100057141 | 3300005366 | Bacteria | 3076 |
| 88 | Ga0070659_100062359 | 3300005366 | Bacteria | 2947 |
| 89 | Ga0070659_100115132 | 3300005366 | Bacteria | 2173 |
| 90 | Ga0070659_100181006 | 3300005366 | Bacteria | 1730 |
| 91 | Ga0070659_100204838 | 3300005366 | Bacteria | 1625 |
| 92 | Ga0070659_100271573 | 3300005366 | Bacteria | 1409 |
| 93 | Ga0070659_100433901 | 3300005366 | Bacteria | 1112 |
| 94 | Ga0070659_100676045 | 3300005366 | Bacteria | 891 |
| 95 | Ga0070667_100000039 | 3300005367 | Bacteria | 170228 |
| 96 | Ga0070667_100259304 | 3300005367 | Bacteria | 1556 |
| 97 | Ga0070663_100004890 | 3300005455 | Bacteria | 7910 |
| 98 | Ga0070663_100132933 | 3300005455 | Bacteria | 1891 |
| 99 | Ga0070663_100181416 | 3300005455 | Bacteria | 1633 |
| 100 | Ga0070678_100001866 | 3300005456 | Bacteria | 11366 |
| 101 | Ga0070678_100004810 | 3300005456 | Bacteria | 7707 |
| 102 | Ga0070662_100006444 | 3300005457 | Bacteria | 7564 |
| 103 | Ga0070662_100011803 | 3300005457 | Bacteria | 5773 |
| 104 | Ga0070662_100168906 | 3300005457 | Bacteria | 1716 |
| 105 | Ga0070681_10102501 | 3300005458 | Bacteria | 2807 |
| 106 | Ga0068867_100005781 | 3300005459 | Bacteria | 8775 |
| 107 | Ga0068867_100006557 | 3300005459 | Bacteria | 8220 |
| 108 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 109 | Ga0068853_100008364 | 3300005539 | Bacteria | 8308 |
| 110 | Ga0068853_100048683 | 3300005539 | Bacteria | 3642 |
| 111 | Ga0068853_100552448 | 3300005539 | Bacteria | 1091 |
| 112 | Ga0068853_100614750 | 3300005539 | Bacteria | 1033 |
| 113 | Ga0068853_100842060 | 3300005539 | Unclassified | 879 |
| 114 | Ga0070672_100018490 | 3300005543 | Bacteria | 5039 |
| 115 | Ga0070672_100059421 | 3300005543 | Bacteria | 3008 |
| 116 | Ga0070672_100250539 | 3300005543 | Bacteria | 1491 |
| 117 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 118 | Ga0070693_100096773 | 3300005547 | Bacteria | 1790 |
| 119 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 120 | Ga0070665_100138494 | 3300005548 | Bacteria | 2437 |
| 121 | Ga0070665_100139592 | 3300005548 | Bacteria | 2427 |
| 122 | Ga0068855_100117343 | 3300005563 | Bacteria | 3049 |
| 123 | Ga0068855_100131931 | 3300005563 | Bacteria | 2853 |
| 124 | Ga0068855_100526948 | 3300005563 | Bacteria | 1281 |
| 125 | Ga0070664_100014603 | 3300005564 | Bacteria | 6408 |
| 126 | Ga0070664_100044891 | 3300005564 | Bacteria | 3732 |
| 127 | Ga0068857_100003501 | 3300005577 | Bacteria | 13108 |
| 128 | Ga0068857_100018632 | 3300005577 | Bacteria | 6092 |
| 129 | Ga0068857_100235716 | 3300005577 | Bacteria | 1674 |
| 130 | Ga0068857_100244914 | 3300005577 | Bacteria | 1642 |
| 131 | Ga0068857_100392160 | 3300005577 | Bacteria | 1291 |
| 132 | Ga0068854_100016231 | 3300005578 | Bacteria | 4959 |
| 133 | Ga0068854_100025435 | 3300005578 | Bacteria | 4062 |
| 134 | Ga0068854_100067438 | 3300005578 | Bacteria | 2607 |
| 135 | Ga0068856_100016269 | 3300005614 | Bacteria | 7197 |
| 136 | Ga0068856_100036758 | 3300005614 | Bacteria | 4802 |
| 137 | Ga0068856_100064590 | 3300005614 | Bacteria | 3617 |
| 138 | Ga0068856_100246893 | 3300005614 | Bacteria | 1800 |
| 139 | Ga0068852_100068729 | 3300005616 | Bacteria | 3102 |
| 140 | Ga0068852_100199080 | 3300005616 | Bacteria | 1895 |
| 141 | Ga0068852_100454952 | 3300005616 | Bacteria | 1268 |
| 142 | Ga0068852_101093151 | 3300005616 | Bacteria | 817 |
| 143 | Ga0068859_100005488 | 3300005617 | Bacteria | 12913 |
| 144 | Ga0068859_100022537 | 3300005617 | Bacteria | 6316 |
| 145 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 146 | Ga0068864_100157801 | 3300005618 | Bacteria | 2060 |
| 147 | Ga0068864_100503707 | 3300005618 | Bacteria | 1165 |
| 148 | Ga0068861_100000321 | 3300005719 | Bacteria | 26985 |
| 149 | Ga0068861_100000965 | 3300005719 | Bacteria | 17524 |
| 150 | Ga0068851_10008938 | 3300005834 | Bacteria | 4646 |
| 151 | Ga0068851_10027735 | 3300005834 | Bacteria | 2792 |
| 152 | Ga0068851_10103684 | 3300005834 | Bacteria | 1511 |
| 153 | Ga0068863_100000033 | 3300005841 | Bacteria | 170238 |
| 154 | Ga0068863_100000280 | 3300005841 | Bacteria | 52729 |
| 155 | Ga0068863_100007192 | 3300005841 | Bacteria | 10917 |
| 156 | Ga0068863_100019160 | 3300005841 | Bacteria | 6550 |
| 157 | Ga0068858_100007900 | 3300005842 | Bacteria | 10254 |
| 158 | Ga0068858_100069059 | 3300005842 | Bacteria | 3275 |
| 159 | Ga0068858_100243409 | 3300005842 | Bacteria | 1707 |
| 160 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 161 | Ga0068860_100112898 | 3300005843 | Bacteria | 2598 |
| 162 | Ga0068862_100000040 | 3300005844 | Bacteria | 167832 |
| 163 | Ga0068862_100000308 | 3300005844 | Bacteria | 53687 |
| 164 | Ga0068862_100009087 | 3300005844 | Bacteria | 8225 |
| 165 | Ga0068862_100266217 | 3300005844 | Bacteria | 1566 |
| 166 | Ga0068862_100361141 | 3300005844 | Bacteria | 1350 |
| 167 | Ga0081455_10160295 | 3300005937 | Bacteria | 1725 |
| 168 | Ga0075368_10000033 | 3300006042 | Bacteria | 32184 |
| 169 | Ga0075367_10000481 | 3300006178 | Bacteria | 14919 |
| 170 | Ga0097621_100048516 | 3300006237 | Bacteria | 3445 |
| 171 | Ga0075370_10066614 | 3300006353 | Bacteria | 2055 |
| 172 | Ga0068871_100562537 | 3300006358 | Bacteria | 1034 |
| 173 | Ga0075430_100059109 | 3300006846 | Bacteria | 3222 |
| 174 | Ga0075431_100151201 | 3300006847 | Bacteria | 2390 |
| 175 | Ga0075431_100366551 | 3300006847 | Bacteria | 1446 |
| 176 | Ga0075429_100161451 | 3300006880 | Bacteria | 1963 |
| 177 | Ga0068865_100004177 | 3300006881 | Bacteria | 8697 |
| 178 | Ga0097620_100005488 | 3300006931 | Bacteria | 12913 |
| 179 | Ga0097620_100022537 | 3300006931 | Bacteria | 6316 |
| 180 | Ga0105251_10001444 | 3300009011 | Bacteria | 20434 |
| 181 | Ga0105251_10017044 | 3300009011 | Bacteria | 3903 |
| 182 | Ga0105240_10007666 | 3300009093 | Bacteria | 15628 |
| 183 | Ga0105240_10026155 | 3300009093 | Bacteria | 7658 |
| 184 | Ga0105240_10098942 | 3300009093 | Bacteria | 3551 |
| 185 | Ga0105240_10128458 | 3300009093 | Bacteria | 3043 |
| 186 | Ga0105240_10873625 | 3300009093 | Bacteria | 969 |
| 187 | Ga0105245_10001867 | 3300009098 | Bacteria | 19148 |
| 188 | Ga0105247_10214021 | 3300009101 | Bacteria | 1301 |
| 189 | Ga0114129_10841433 | 3300009147 | Bacteria | 1167 |
| 190 | Ga0105243_10104131 | 3300009148 | Bacteria | 2361 |
| 191 | Ga0105241_10008072 | 3300009174 | Bacteria | 7745 |
| 192 | Ga0105241_10217538 | 3300009174 | Bacteria | 1604 |
| 193 | Ga0105242_10064796 | 3300009176 | Bacteria | 3013 |
| 194 | Ga0105248_10000021 | 3300009177 | Bacteria | 276159 |
| 195 | Ga0105248_10124883 | 3300009177 | Bacteria | 2903 |
| 196 | Ga0105248_10394403 | 3300009177 | Bacteria | 1558 |
| 197 | Ga0105248_10982508 | 3300009177 | Bacteria | 954 |
| 198 | Ga0105237_10009418 | 3300009545 | Bacteria | 10463 |
| 199 | Ga0105237_10013028 | 3300009545 | Bacteria | 8731 |
| 200 | Ga0105237_10050016 | 3300009545 | Bacteria | 4201 |
| 201 | Ga0105237_10054292 | 3300009545 | Bacteria | 4015 |
| 202 | Ga0105238_10065766 | 3300009551 | Bacteria | 3627 |
| 203 | Ga0105238_10120716 | 3300009551 | Bacteria | 2600 |
| 204 | Ga0105238_10421674 | 3300009551 | Bacteria | 1329 |
| 205 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 206 | Ga0105249_10002603 | 3300009553 | Bacteria | 15632 |
| 207 | Ga0105249_10325529 | 3300009553 | Bacteria | 1549 |
| 208 | Ga0105249_10807819 | 3300009553 | Bacteria | 1002 |
| 209 | Ga0105148_100202 | 3300009978 | Bacteria | 8692 |
| 210 | Ga0105239_10000461 | 3300010375 | Bacteria | 59449 |
| 211 | Ga0105246_10176826 | 3300011119 | Bacteria | 1640 |
| 212 | Ga0157373_10121323 | 3300013100 | Bacteria | 1837 |
| 213 | Ga0157373_10389734 | 3300013100 | Bacteria | 997 |
| 214 | Ga0157373_10492926 | 3300013100 | Bacteria | 884 |
| 215 | Ga0157371_10085604 | 3300013102 | Bacteria | 2233 |
| 216 | Ga0157371_10149242 | 3300013102 | Unclassified | 1667 |
| 217 | Ga0157371_10169826 | 3300013102 | Bacteria | 1558 |
| 218 | Ga0157371_10177025 | 3300013102 | Bacteria | 1525 |
| 219 | Ga0157370_10000008 | 3300013104 | Bacteria | 240668 |
| 220 | Ga0157370_10002308 | 3300013104 | Bacteria | 23086 |
| 221 | Ga0157370_10024209 | 3300013104 | Bacteria | 6016 |
| 222 | Ga0157369_10031631 | 3300013105 | Bacteria | 5825 |
| 223 | Ga0157369_10112395 | 3300013105 | Bacteria | 2893 |
| 224 | Ga0157369_10816810 | 3300013105 | Bacteria | 957 |
| 225 | Ga0157374_10004197 | 3300013296 | Bacteria | 12105 |
| 226 | Ga0157374_10067557 | 3300013296 | Bacteria | 3361 |
| 227 | Ga0157374_10372050 | 3300013296 | Bacteria | 1422 |
| 228 | Ga0163162_10096754 | 3300013306 | Bacteria | 3040 |
| 229 | Ga0163162_10202484 | 3300013306 | Bacteria | 2114 |
| 230 | Ga0163162_10204173 | 3300013306 | Bacteria | 2105 |
| 231 | Ga0157372_10018134 | 3300013307 | Bacteria | 7567 |
| 232 | Ga0157372_10404374 | 3300013307 | Bacteria | 1591 |
| 233 | Ga0163163_10081360 | 3300014325 | Bacteria | 3241 |
| 234 | Ga0163163_10120063 | 3300014325 | Bacteria | 2662 |
| 235 | Ga0163163_10159477 | 3300014325 | Bacteria | 2301 |
| 236 | Ga0157380_10000440 | 3300014326 | Bacteria | 25347 |
| 237 | Ga0157380_10034756 | 3300014326 | Bacteria | 3890 |
| 238 | Ga0157379_10003144 | 3300014968 | Bacteria | 13972 |
| 239 | Ga0157379_10036117 | 3300014968 | Bacteria | 4407 |
| 240 | Ga0157379_10121240 | 3300014968 | Bacteria | 2352 |
| 241 | Ga0157376_10130417 | 3300014969 | Bacteria | 2242 |
| 242 | Ga0163161_10000202 | 3300017792 | Bacteria | 54518 |
| 243 | Ga0163161_10017029 | 3300017792 | Bacteria | 5082 |
| 244 | Ga0163161_10355841 | 3300017792 | Bacteria | 1165 |
| 245 | Ga0163161_10406912 | 3300017792 | Unclassified | 1092 |
| 246 | Ga0206353_11760290 | 3300020082 | Bacteria | 11326 |
| 247 | Ga0213876_10033404 | 3300021384 | Bacteria | 2713 |
| 248 | Ga0213875_10000721 | 3300021388 | Bacteria | 25266 |
| 249 | Ga0207672_1001024 | 3300025223 | Bacteria | 2658 |
| 250 | Ga0207427_100545 | 3300025231 | Bacteria | 19253 |
| 251 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 252 | Ga0207425_1004365 | 3300025245 | Bacteria | 4275 |
| 253 | Ga0209026_1002632 | 3300025250 | Bacteria | 6543 |
| 254 | Ga0209148_1000338 | 3300025254 | Bacteria | 62960 |
| 255 | Ga0209129_1000825 | 3300025258 | Bacteria | 19506 |
| 256 | Ga0209233_1000207 | 3300025261 | Bacteria | 117152 |
| 257 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 258 | Ga0209565_1000056 | 3300025263 | Bacteria | 200189 |
| 259 | Ga0209455_1000480 | 3300025272 | Bacteria | 29756 |
| 260 | Ga0209455_1018960 | 3300025272 | Bacteria | 1401 |
| 261 | Ga0209673_1001497 | 3300025273 | Bacteria | 21703 |
| 262 | Ga0209025_1000296 | 3300025294 | Bacteria | 111440 |
| 263 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 264 | Ga0209758_1002418 | 3300025297 | Bacteria | 19122 |
| 265 | Ga0209758_1066833 | 3300025297 | Bacteria | 1153 |
| 266 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 267 | Ga0209050_1000196 | 3300025298 | Bacteria | 135678 |
| 268 | Ga0209050_1008839 | 3300025298 | Bacteria | 5283 |
| 269 | Ga0209050_1016183 | 3300025298 | Bacteria | 3071 |
| 270 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 271 | Ga0209051_1000153 | 3300025303 | Bacteria | 131166 |
| 272 | Ga0209257_1000228 | 3300025304 | Bacteria | 133390 |
| 273 | Ga0209257_1003469 | 3300025304 | Bacteria | 13472 |
| 274 | Ga0209257_1004247 | 3300025304 | Bacteria | 11310 |
| 275 | Ga0209257_1004769 | 3300025304 | Bacteria | 10121 |
| 276 | Ga0207697_10016147 | 3300025315 | Bacteria | 3079 |
| 277 | Ga0207656_10049933 | 3300025321 | Bacteria | 1805 |
| 278 | Ga0207713_1007763 | 3300025735 | Bacteria | 6265 |
| 279 | Ga0207710_10166100 | 3300025900 | Unclassified | 1077 |
| 280 | Ga0207688_10032718 | 3300025901 | Bacteria | 2875 |
| 281 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 282 | Ga0207647_10001622 | 3300025904 | Bacteria | 17295 |
| 283 | Ga0207647_10104017 | 3300025904 | Bacteria | 1683 |
| 284 | Ga0207647_10135199 | 3300025904 | Bacteria | 1447 |
| 285 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 286 | Ga0207705_10000027 | 3300025909 | Bacteria | 248863 |
| 287 | Ga0207705_10007714 | 3300025909 | Bacteria | 7913 |
| 288 | Ga0207705_10011424 | 3300025909 | Bacteria | 6428 |
| 289 | Ga0207705_10042116 | 3300025909 | Bacteria | 3278 |
| 290 | Ga0207705_10117758 | 3300025909 | Bacteria | 1968 |
| 291 | Ga0207705_10192064 | 3300025909 | Bacteria | 1545 |
| 292 | Ga0207705_10194448 | 3300025909 | Bacteria | 1535 |
| 293 | Ga0207654_10001661 | 3300025911 | Bacteria | 11622 |
| 294 | Ga0207654_10049270 | 3300025911 | Bacteria | 2415 |
| 295 | Ga0207695_10000641 | 3300025913 | Bacteria | 69705 |
| 296 | Ga0207695_10006576 | 3300025913 | Bacteria | 15034 |
| 297 | Ga0207695_10024580 | 3300025913 | Bacteria | 6771 |
| 298 | Ga0207695_10077765 | 3300025913 | Bacteria | 3369 |
| 299 | Ga0207695_10098637 | 3300025913 | Bacteria | 2921 |
| 300 | Ga0207695_10134453 | 3300025913 | Bacteria | 2427 |
| 301 | Ga0207671_10002738 | 3300025914 | Bacteria | 18433 |
| 302 | Ga0207671_10203960 | 3300025914 | Bacteria | 1545 |
| 303 | Ga0207657_10008853 | 3300025919 | Bacteria | 10181 |
| 304 | Ga0207657_10065116 | 3300025919 | Bacteria | 3108 |
| 305 | Ga0207657_10065750 | 3300025919 | Bacteria | 3090 |
| 306 | Ga0207657_10066709 | 3300025919 | Bacteria | 3062 |
| 307 | Ga0207657_10103427 | 3300025919 | Bacteria | 2361 |
| 308 | Ga0207657_10189101 | 3300025919 | Bacteria | 1662 |
| 309 | Ga0207657_10227301 | 3300025919 | Bacteria | 1493 |
| 310 | Ga0207657_10254383 | 3300025919 | Bacteria | 1399 |
| 311 | Ga0207649_10010061 | 3300025920 | Bacteria | 5189 |
| 312 | Ga0207649_10050916 | 3300025920 | Bacteria | 2563 |
| 313 | Ga0207649_10126732 | 3300025920 | Bacteria | 1729 |
| 314 | Ga0207649_10312385 | 3300025920 | Bacteria | 1152 |
| 315 | Ga0207649_10325948 | 3300025920 | Bacteria | 1130 |
| 316 | Ga0207649_10352238 | 3300025920 | Bacteria | 1090 |
| 317 | Ga0207681_10000076 | 3300025923 | Bacteria | 89353 |
| 318 | Ga0207694_10001461 | 3300025924 | Bacteria | 20212 |
| 319 | Ga0207694_10028824 | 3300025924 | Bacteria | 4234 |
| 320 | Ga0207694_10039527 | 3300025924 | Bacteria | 3630 |
| 321 | Ga0207650_10000069 | 3300025925 | Bacteria | 138442 |
| 322 | Ga0207650_10026743 | 3300025925 | Bacteria | 4120 |
| 323 | Ga0207650_10033961 | 3300025925 | Bacteria | 3698 |
| 324 | Ga0207650_10061262 | 3300025925 | Bacteria | 2809 |
| 325 | Ga0207650_10157802 | 3300025925 | Bacteria | 1795 |
| 326 | Ga0207659_10059191 | 3300025926 | Bacteria | 2753 |
| 327 | Ga0207687_10003098 | 3300025927 | Bacteria | 11274 |
| 328 | Ga0207644_10003422 | 3300025931 | Bacteria | 10247 |
| 329 | Ga0207644_10067193 | 3300025931 | Bacteria | 2612 |
| 330 | Ga0207644_10072418 | 3300025931 | Bacteria | 2523 |
| 331 | Ga0207644_10073678 | 3300025931 | Bacteria | 2504 |
| 332 | Ga0207644_10081104 | 3300025931 | Bacteria | 2396 |
| 333 | Ga0207644_10225803 | 3300025931 | Bacteria | 1486 |
| 334 | Ga0207690_10003689 | 3300025932 | Bacteria | 9111 |
| 335 | Ga0207690_10007350 | 3300025932 | Bacteria | 6539 |
| 336 | Ga0207690_10040990 | 3300025932 | Bacteria | 3031 |
| 337 | Ga0207690_10043362 | 3300025932 | Bacteria | 2960 |
| 338 | Ga0207690_10093263 | 3300025932 | Bacteria | 2133 |
| 339 | Ga0207690_10099311 | 3300025932 | Bacteria | 2075 |
| 340 | Ga0207690_10129291 | 3300025932 | Bacteria | 1846 |
| 341 | Ga0207690_10161495 | 3300025932 | Bacteria | 1671 |
| 342 | Ga0207690_10205312 | 3300025932 | Bacteria | 1499 |
| 343 | Ga0207690_10314363 | 3300025932 | Bacteria | 1229 |
| 344 | Ga0207706_10001442 | 3300025933 | Bacteria | 23791 |
| 345 | Ga0207706_10018968 | 3300025933 | Bacteria | 6185 |
| 346 | Ga0207706_10043654 | 3300025933 | Bacteria | 3972 |
| 347 | Ga0207706_10160806 | 3300025933 | Bacteria | 1974 |
| 348 | Ga0207706_10246139 | 3300025933 | Bacteria | 1562 |
| 349 | Ga0207706_10511476 | 3300025933 | Bacteria | 1036 |
| 350 | Ga0207706_10643802 | 3300025933 | Bacteria | 908 |
| 351 | Ga0207686_10028588 | 3300025934 | Bacteria | 3279 |
| 352 | Ga0207709_10105314 | 3300025935 | Bacteria | 1874 |
| 353 | Ga0207669_10055566 | 3300025937 | Bacteria | 2398 |
| 354 | Ga0207669_10078646 | 3300025937 | Bacteria | 2102 |
| 355 | Ga0207691_10000631 | 3300025940 | Bacteria | 34819 |
| 356 | Ga0207691_10037826 | 3300025940 | Bacteria | 4466 |
| 357 | Ga0207711_10000025 | 3300025941 | Bacteria | 289972 |
| 358 | Ga0207711_10010871 | 3300025941 | Bacteria | 7565 |
| 359 | Ga0207711_10016625 | 3300025941 | Bacteria | 6110 |
| 360 | Ga0207689_10087928 | 3300025942 | Bacteria | 2553 |
| 361 | Ga0207689_10100100 | 3300025942 | Bacteria | 2381 |
| 362 | Ga0207679_10005299 | 3300025945 | Bacteria | 8090 |
| 363 | Ga0207679_10016820 | 3300025945 | Bacteria | 4862 |
| 364 | Ga0207679_10196654 | 3300025945 | Bacteria | 1681 |
| 365 | Ga0207667_10004663 | 3300025949 | Bacteria | 16793 |
| 366 | Ga0207667_10044332 | 3300025949 | Bacteria | 4714 |
| 367 | Ga0207667_10219943 | 3300025949 | Bacteria | 1946 |
| 368 | Ga0207667_10277086 | 3300025949 | Bacteria | 1714 |
| 369 | Ga0207651_10008206 | 3300025960 | Bacteria | 5624 |
| 370 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 371 | Ga0207712_10002020 | 3300025961 | Bacteria | 13317 |
| 372 | Ga0207712_10134447 | 3300025961 | Bacteria | 1889 |
| 373 | Ga0207668_10135614 | 3300025972 | Bacteria | 1885 |
| 374 | Ga0207640_10018490 | 3300025981 | Bacteria | 4097 |
| 375 | Ga0207640_10158364 | 3300025981 | Bacteria | 1672 |
| 376 | Ga0207640_10228286 | 3300025981 | Bacteria | 1430 |
| 377 | Ga0207658_10000652 | 3300025986 | Bacteria | 30347 |
| 378 | Ga0207658_10003067 | 3300025986 | Bacteria | 11944 |
| 379 | Ga0207658_10202436 | 3300025986 | Bacteria | 1658 |
| 380 | Ga0207677_10087570 | 3300026023 | Bacteria | 2255 |
| 381 | Ga0207703_10010176 | 3300026035 | Bacteria | 7372 |
| 382 | Ga0207703_10054384 | 3300026035 | Bacteria | 3255 |
| 383 | Ga0207639_10071982 | 3300026041 | Bacteria | 2706 |
| 384 | Ga0207639_10315558 | 3300026041 | Unclassified | 1386 |
| 385 | Ga0207639_10401778 | 3300026041 | Bacteria | 1234 |
| 386 | Ga0207639_10787962 | 3300026041 | Bacteria | 885 |
| 387 | Ga0207678_10001799 | 3300026067 | Bacteria | 19627 |
| 388 | Ga0207678_10004357 | 3300026067 | Bacteria | 12713 |
| 389 | Ga0207678_10045975 | 3300026067 | Bacteria | 3775 |
| 390 | Ga0207678_10241115 | 3300026067 | Bacteria | 1548 |
| 391 | Ga0207702_10002022 | 3300026078 | Bacteria | 19645 |
| 392 | Ga0207702_10008254 | 3300026078 | Bacteria | 8801 |
| 393 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 394 | Ga0207641_10000414 | 3300026088 | Bacteria | 49835 |
| 395 | Ga0207641_10005204 | 3300026088 | Bacteria | 11123 |
| 396 | Ga0207648_10001344 | 3300026089 | Bacteria | 27279 |
| 397 | Ga0207648_10062609 | 3300026089 | Bacteria | 3243 |
| 398 | Ga0207676_10000353 | 3300026095 | Bacteria | 39309 |
| 399 | Ga0207676_10009609 | 3300026095 | Bacteria | 6885 |
| 400 | Ga0207676_10077831 | 3300026095 | Bacteria | 2684 |
| 401 | Ga0207676_10646159 | 3300026095 | Bacteria | 1020 |
| 402 | Ga0207674_10000291 | 3300026116 | Bacteria | 63446 |
| 403 | Ga0207674_10010820 | 3300026116 | Bacteria | 10286 |
| 404 | Ga0207674_10042500 | 3300026116 | Bacteria | 4694 |
| 405 | Ga0207674_10114135 | 3300026116 | Unclassified | 2674 |
| 406 | Ga0207674_10246853 | 3300026116 | Bacteria | 1732 |
| 407 | Ga0207674_10251420 | 3300026116 | Bacteria | 1715 |
| 408 | Ga0207675_100000227 | 3300026118 | Bacteria | 53090 |
| 409 | Ga0207675_100000998 | 3300026118 | Bacteria | 28040 |
| 410 | Ga0207683_10004993 | 3300026121 | Bacteria | 11396 |
| 411 | Ga0207683_10010089 | 3300026121 | Bacteria | 8060 |
| 412 | Ga0207698_10001499 | 3300026142 | Bacteria | 13593 |
| 413 | Ga0207698_10038110 | 3300026142 | Bacteria | 3548 |
| 414 | Ga0207698_10079015 | 3300026142 | Bacteria | 2644 |
| 415 | Ga0207698_10095930 | 3300026142 | Bacteria | 2443 |
| 416 | Ga0207698_10130366 | 3300026142 | Bacteria | 2147 |
| 417 | Ga0207698_10304513 | 3300026142 | Bacteria | 1485 |
| 418 | Ga0209813_10000041 | 3300027866 | Bacteria | 53753 |
| 419 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 420 | Ga0268266_10116025 | 3300028379 | Bacteria | 2378 |
| 421 | Ga0268266_10194973 | 3300028379 | Bacteria | 1851 |
| 422 | Ga0268266_10376461 | 3300028379 | Bacteria | 1338 |
| 423 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 424 | Ga0268265_10002814 | 3300028380 | Bacteria | 12797 |
| 425 | Ga0268265_10239805 | 3300028380 | Bacteria | 1599 |
| 426 | Ga0268265_10315647 | 3300028380 | Bacteria | 1413 |
| 427 | Ga0268264_10000074 | 3300028381 | Bacteria | 259555 |
| 428 | Ga0268264_10754480 | 3300028381 | Bacteria | 970 |
| 429 | Ga0307408_100036711 | 3300031548 | Bacteria | 3446 |
| 430 | Ga0307408_100453026 | 3300031548 | Bacteria | 1113 |
| 431 | Ga0307405_10038560 | 3300031731 | Bacteria | 2881 |
| 432 | Ga0307413_10004075 | 3300031824 | Bacteria | 6286 |
| 433 | Ga0307413_10028063 | 3300031824 | Bacteria | 3128 |
| 434 | Ga0307413_10119107 | 3300031824 | Bacteria | 1784 |
| 435 | Ga0307410_10000281 | 3300031852 | Bacteria | 19663 |
| 436 | Ga0307410_10019341 | 3300031852 | Bacteria | 4141 |
| 437 | Ga0307410_10035705 | 3300031852 | Bacteria | 3231 |
| 438 | Ga0307406_10020481 | 3300031901 | Bacteria | 3895 |
| 439 | Ga0307406_10149122 | 3300031901 | Bacteria | 1666 |
| 440 | Ga0307406_10229868 | 3300031901 | Bacteria | 1384 |
| 441 | Ga0307407_10001856 | 3300031903 | Bacteria | 7945 |
| 442 | Ga0307407_10004947 | 3300031903 | Bacteria | 5730 |
| 443 | Ga0307407_10209618 | 3300031903 | Bacteria | 1311 |
| 444 | Ga0307412_10000453 | 3300031911 | Bacteria | 24741 |
| 445 | Ga0307412_10005872 | 3300031911 | Bacteria | 6914 |
| 446 | Ga0307412_10132167 | 3300031911 | Bacteria | 1814 |
| 447 | Ga0307409_100013771 | 3300031995 | Bacteria | 5225 |
| 448 | Ga0307409_100065828 | 3300031995 | Bacteria | 2854 |
| 449 | Ga0307409_100277011 | 3300031995 | Bacteria | 1548 |
| 450 | Ga0307416_100009701 | 3300032002 | Bacteria | 6321 |
| 451 | Ga0307416_100033727 | 3300032002 | Bacteria | 3885 |
| 452 | Ga0307416_100069334 | 3300032002 | Bacteria | 2917 |
| 453 | Ga0307416_100225252 | 3300032002 | Bacteria | 1802 |
| 454 | Ga0307414_10000248 | 3300032004 | Bacteria | 33977 |
| 455 | Ga0307414_10004115 | 3300032004 | Bacteria | 7856 |
| 456 | Ga0307414_10008487 | 3300032004 | Bacteria | 5829 |
| 457 | Ga0307414_10018719 | 3300032004 | Bacteria | 4272 |
| 458 | Ga0307414_10373356 | 3300032004 | Bacteria | 1231 |
| 459 | Ga0307411_10004182 | 3300032005 | Bacteria | 6861 |
| 460 | Ga0307411_10012924 | 3300032005 | Bacteria | 4580 |
| 461 | Ga0307411_10021318 | 3300032005 | Bacteria | 3789 |
| 462 | Ga0307411_10076900 | 3300032005 | Bacteria | 2283 |
| 463 | Ga0307411_10079644 | 3300032005 | Bacteria | 2250 |
| 464 | Ga0307411_10106071 | 3300032005 | Bacteria | 1999 |
| 465 | Ga0307415_100272494 | 3300032126 | Bacteria | 1387 |
| 466 | Ga0373932_0041935 | 3300035112 | Bacteria | 1325 |
| 467 | Ga0373932_0045385 | 3300035112 | Bacteria | 1285 |
| 468 | Ga0395899_0000251 | 3300037312 | Bacteria | 71228 |
| 469 | Ga0395899_0001062 | 3300037312 | Bacteria | 24783 |
| 470 | Ga0395899_0001983 | 3300037312 | Bacteria | 16840 |
| 471 | Ga0395900_0000084 | 3300037418 | Bacteria | 172593 |
| 472 | Ga0395900_0022623 | 3300037418 | Bacteria | 6433 |
| 473 | Ga0395900_0025014 | 3300037418 | Bacteria | 6110 |
| 474 | Ga0395900_0479610 | 3300037418 | Bacteria | 1196 |
| 475 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 476 | Ga0395898_0002422 | 3300037466 | Bacteria | 22069 |
| 477 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 478 | Ga0395905_0000762 | 3300037471 | Bacteria | 42402 |
| 479 | Ga0395905_0031744 | 3300037471 | Bacteria | 4969 |
| 480 | Ga0395905_0073303 | 3300037471 | Bacteria | 3209 |
| 481 | Ga0395905_0234336 | 3300037471 | Bacteria | 1716 |
| 482 | Ga0395905_0528582 | 3300037471 | Bacteria | 1080 |
| 483 | Ga0436364_0322209 | 3300037853 | Bacteria | 1693 |
| 484 | Ga0436364_0462751 | 3300037853 | Bacteria | 45616 |
| 485 | Ga0395901_0008794 | 3300038443 | Bacteria | 10217 |
| 486 | Ga0395901_0009640 | 3300038443 | Bacteria | 9795 |
| 487 | Ga0395901_0069324 | 3300038443 | Bacteria | 3673 |
| 488 | Ga0436365_0695304 | 3300039437 | Bacteria | 6007 |
| 489 | Ga0436365_1474733 | 3300039437 | Bacteria | 4043 |
| 490 | Ga0436363_0379517 | 3300039450 | Bacteria | 4119 |
| 491 | Ga0436363_1509936 | 3300039450 | Bacteria | 1603 |
| 492 | Ga0439436_0007826 | 3300041404 | Bacteria | 3285 |
| 493 | Ga0439461_0000239 | 3300041410 | Bacteria | 7764 |
| 494 | Ga0439461_0006785 | 3300041410 | Bacteria | 2002 |
| 495 | Ga0439465_0000177 | 3300041413 | Bacteria | 16347 |
| 496 | Ga0439465_0012688 | 3300041413 | Bacteria | 2635 |
| 497 | Ga0451806_431010 | 3300041462 | Bacteria | 9494 |
| 498 | Ga0451804_1038976 | 3300041463 | Bacteria | 1919 |
| 499 | Ga0451807_1283003 | 3300041486 | Bacteria | 5402 |
| 500 | Ga0439431_0000207 | 3300041997 | Bacteria | 11634 |
| 501 | Ga0439431_0006020 | 3300041997 | Bacteria | 2677 |
| 502 | Ga0439442_002361 | 3300042002 | Bacteria | 3702 |
| 503 | Ga0439445_0000060 | 3300042004 | Bacteria | 16616 |
| 504 | Ga0439448_0001841 | 3300042005 | Bacteria | 5615 |
| 505 | Ga0439432_017104 | 3300042006 | Bacteria | 2436 |
| 506 | Ga0439455_0007574 | 3300042012 | Bacteria | 2300 |
| 507 | Ga0439462_0000195 | 3300042015 | Bacteria | 10446 |
| 508 | Ga0439446_0074395 | 3300042156 | Bacteria | 1044 |
| 509 | Ga0439458_0000436 | 3300042157 | Bacteria | 10507 |
| 510 | Ga0439434_0003840 | 3300042435 | Bacteria | 4392 |
| 511 | Ga0439434_0007436 | 3300042435 | Bacteria | 3209 |
| 512 | Ga0439464_0044684 | 3300042439 | Bacteria | 1269 |
| 513 | Ga0466972_0010895 | 3300044658 | Bacteria | 4562 |
| 514 | Ga0466972_0068978 | 3300044658 | Bacteria | 1689 |
| 515 | Ga0466965_0084296 | 3300044683 | Bacteria | 1610 |
| 516 | Ga0466961_0221293 | 3300044693 | Bacteria | 1166 |
| 517 | Ga0466963_0005621 | 3300044694 | Bacteria | 7355 |
| 518 | Ga0466963_0014337 | 3300044694 | Bacteria | 4886 |
| 519 | Ga0466963_0087573 | 3300044694 | Bacteria | 2117 |
| 520 | Ga0466971_0013927 | 3300044719 | Bacteria | 3535 |
| 521 | Ga0466971_0131759 | 3300044719 | Bacteria | 1161 |
| 522 | Ga0466968_0042644 | 3300044735 | Bacteria | 1919 |
| 523 | Ga0466970_0050313 | 3300044765 | Bacteria | 2222 |
| 524 | Ga0466957_0016826 | 3300044842 | Bacteria | 4279 |
| 525 | Ga0466957_0206908 | 3300044842 | Bacteria | 1291 |
| 526 | Ga0466960_0003085 | 3300044901 | Bacteria | 6375 |
| 527 | Ga0466960_0035587 | 3300044901 | Bacteria | 2328 |
| 528 | Ga0466958_0012119 | 3300045836 | Bacteria | 4875 |
| 529 | Ga0466958_0187392 | 3300045836 | Bacteria | 1314 |
| 530 | Ga0466958_0301418 | 3300045836 | Bacteria | 1029 |
| 531 | Ga0466967_0007703 | 3300045976 | Bacteria | 7804 |
| 532 | Ga0466967_0050831 | 3300045976 | Bacteria | 3630 |
| 533 | Ga0495617_029351 | 3300046452 | Bacteria | 1849 |
| 534 | Ga0495627_006278 | 3300046453 | Bacteria | 4670 |
| 535 | Ga0495627_051928 | 3300046453 | Bacteria | 1231 |
| 536 | Ga0495583_0001401 | 3300046506 | Bacteria | 24579 |
| 537 | Ga0495606_0094008 | 3300046507 | Bacteria | 1838 |
| 538 | Ga0495610_0000206 | 3300046512 | Bacteria | 65469 |
| 539 | Ga0495610_0049660 | 3300046512 | Bacteria | 2053 |
| 540 | Ga0495616_0000189 | 3300046513 | Bacteria | 51610 |
| 541 | Ga0495632_0001899 | 3300046519 | Bacteria | 16723 |
| 542 | Ga0495637_0029360 | 3300046520 | Bacteria | 2448 |
| 543 | Ga0495643_0000162 | 3300046522 | Bacteria | 106672 |
| 544 | Ga0495648_0000038 | 3300046524 | Bacteria | 191612 |
| 545 | Ga0495663_0018160 | 3300046525 | Bacteria | 2001 |
| 546 | Ga0495663_0024238 | 3300046525 | Bacteria | 1762 |
| 547 | Ga0495654_0180699 | 3300046530 | Bacteria | 914 |
| 548 | Ga0495621_0007456 | 3300046539 | Bacteria | 3240 |
| 549 | Ga0495622_0093923 | 3300046557 | Bacteria | 1377 |
| 550 | Ga0495633_0130434 | 3300046558 | Bacteria | 1163 |
| 551 | Ga0495625_0257602 | 3300046660 | Bacteria | 1130 |
| 552 | Ga0495670_0000028 | 3300046691 | Bacteria | 90085 |
| 553 | Ga0495671_0000034 | 3300046692 | Bacteria | 195385 |
| 554 | Ga0495671_0000062 | 3300046692 | Bacteria | 106672 |
| 555 | Ga0495671_0003910 | 3300046692 | Bacteria | 9038 |
| 556 | Ga0495636_0163863 | 3300047318 | Bacteria | 1003 |
| 557 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 558 | Ga0495673_0084474 | 3300047469 | Bacteria | 1309 |
| 559 | Ga0495681_0000106 | 3300047470 | Bacteria | 72369 |
| 560 | Ga0495681_0008636 | 3300047470 | Bacteria | 6361 |
| 561 | Ga0495686_0000366 | 3300047472 | Bacteria | 73243 |
| 562 | Ga0495686_0000986 | 3300047472 | Bacteria | 34762 |
| 563 | Ga0495686_0071813 | 3300047472 | Bacteria | 2129 |
| 564 | Ga0496100_0001542 | 3300048903 | Bacteria | 11314 |
| 565 | Ga0496100_0029233 | 3300048903 | Bacteria | 3407 |
| 566 | Ga0496101_0003699 | 3300048904 | Bacteria | 9538 |
| 567 | Ga0496102_0067110 | 3300048905 | Bacteria | 3289 |
| 568 | Ga0496102_0088970 | 3300048905 | Bacteria | 2856 |
| 569 | Ga0496102_0156222 | 3300048905 | Bacteria | 2144 |
| 570 | Ga0496102_0270111 | 3300048905 | Bacteria | 1603 |
| 571 | Ga0496103_0003725 | 3300048906 | Bacteria | 9269 |
| 572 | Ga0496103_0041637 | 3300048906 | Bacteria | 2824 |
| 573 | Ga0496103_0140695 | 3300048906 | Bacteria | 1543 |
| 574 | Ga0496104_0137687 | 3300048907 | Bacteria | 2345 |
| 575 | Ga0496104_0853155 | 3300048907 | Unclassified | 816 |
| 576 | Ga0496105_0171707 | 3300048908 | Bacteria | 1777 |
| 577 | Ga0496106_0121516 | 3300048909 | Bacteria | 2042 |
| 578 | Ga0496106_0205599 | 3300048909 | Bacteria | 1568 |
| 579 | Ga0496107_0018156 | 3300048910 | Bacteria | 4949 |
| 580 | Ga0496107_0090106 | 3300048910 | Unclassified | 2240 |
| 581 | Ga0496108_0013686 | 3300048911 | Bacteria | 6623 |
| 582 | Ga0496108_0032889 | 3300048911 | Bacteria | 4308 |
| 583 | Ga0496108_0156763 | 3300048911 | Bacteria | 1966 |
| 584 | Ga0496109_0178660 | 3300048912 | Bacteria | 1993 |
| 585 | Ga0496109_0579378 | 3300048912 | Bacteria | 1058 |
| 586 | Ga0496110_0016041 | 3300048913 | Bacteria | 6247 |
| 587 | Ga0496110_0023804 | 3300048913 | Bacteria | 5212 |
| 588 | Ga0496110_0219553 | 3300048913 | Bacteria | 1728 |
| 589 | Ga0496111_0022461 | 3300048914 | Bacteria | 4418 |
| 590 | Ga0496111_0125943 | 3300048914 | Bacteria | 1893 |
| 591 | Ga0496112_0105543 | 3300048915 | Bacteria | 2787 |
| 592 | Ga0496113_0015706 | 3300048916 | Bacteria | 5214 |
| 593 | Ga0496114_0174873 | 3300048917 | Bacteria | 1873 |
| 594 | Ga0496115_0003674 | 3300048918 | Bacteria | 11044 |
| 595 | Ga0496116_0121765 | 3300048919 | Bacteria | 1508 |
| 596 | Ga0496117_0012393 | 3300048920 | Bacteria | 7520 |
| 597 | Ga0496117_0014638 | 3300048920 | Bacteria | 6746 |
| 598 | Ga0496117_0040062 | 3300048920 | Bacteria | 3451 |
| 599 | Ga0496117_0047279 | 3300048920 | Bacteria | 3087 |
| 600 | Ga0496117_0063203 | 3300048920 | Bacteria | 2532 |
| 601 | Ga0496118_0002436 | 3300048921 | Bacteria | 25049 |
| 602 | Ga0496118_0023982 | 3300048921 | Bacteria | 5279 |
| 603 | Ga0496118_0027239 | 3300048921 | Bacteria | 4843 |
| 604 | Ga0496118_0098454 | 3300048921 | Bacteria | 1986 |
| 605 | Ga0496118_0116649 | 3300048921 | Bacteria | 1754 |
| 606 | Ga0496118_0163339 | 3300048921 | Bacteria | 1373 |
| 607 | Ga0496119_0102222 | 3300048922 | Bacteria | 1607 |
| 608 | Ga0496120_0071098 | 3300048923 | Bacteria | 1911 |
| 609 | Ga0496120_0233981 | 3300048923 | Bacteria | 871 |
| 610 | Ga0496121_0000175 | 3300048924 | Bacteria | 142910 |
| 611 | Ga0496121_0000650 | 3300048924 | Bacteria | 65007 |
| 612 | Ga0496121_0040635 | 3300048924 | Bacteria | 4077 |
| 613 | Ga0496121_0048915 | 3300048924 | Bacteria | 3592 |
| 614 | Ga0496121_0050973 | 3300048924 | Bacteria | 3490 |
| 615 | Ga0496121_0099521 | 3300048924 | Bacteria | 2247 |
| 616 | Ga0496121_0126821 | 3300048924 | Bacteria | 1917 |
| 617 | Ga0496122_0026729 | 3300048925 | Bacteria | 4964 |
| 618 | Ga0496122_0028593 | 3300048925 | Bacteria | 4724 |
| 619 | Ga0496122_0135922 | 3300048925 | Bacteria | 1549 |
| 620 | Ga0496123_0050545 | 3300048926 | Bacteria | 2776 |
| 621 | Ga0496123_0081779 | 3300048926 | Bacteria | 1961 |
| 622 | Ga0496123_0163235 | 3300048926 | Bacteria | 1185 |
| 623 | Ga0496123_0175105 | 3300048926 | Bacteria | 1127 |
| 624 | Ga0496124_0000129 | 3300048927 | Bacteria | 156648 |
| 625 | Ga0496124_0006227 | 3300048927 | Bacteria | 13070 |
| 626 | Ga0496124_0007123 | 3300048927 | Bacteria | 11972 |
| 627 | Ga0496124_0089345 | 3300048927 | Bacteria | 2516 |
| 628 | Ga0496124_0113648 | 3300048927 | Bacteria | 2175 |
| 629 | Ga0496124_0166013 | 3300048927 | Bacteria | 1716 |
| 630 | Ga0496124_0214970 | 3300048927 | Bacteria | 1451 |
| 631 | Ga0496124_0239613 | 3300048927 | Bacteria | 1350 |
| 632 | Ga0496124_0363207 | 3300048927 | Bacteria | 1019 |
| 633 | Ga0496125_0000445 | 3300048928 | Bacteria | 75404 |
| 634 | Ga0496125_0007177 | 3300048928 | Bacteria | 11883 |
| 635 | Ga0496125_0017604 | 3300048928 | Bacteria | 6808 |
| 636 | Ga0496125_0105320 | 3300048928 | Bacteria | 2062 |
| 637 | Ga0496125_0113688 | 3300048928 | Bacteria | 1952 |
| 638 | Ga0496125_0142321 | 3300048928 | Bacteria | 1665 |
| 639 | Ga0496125_0277712 | 3300048928 | Bacteria | 1040 |
| 640 | Ga0496126_0046922 | 3300048929 | Bacteria | 3958 |
| 641 | Ga0496126_0077467 | 3300048929 | Bacteria | 2947 |
| 642 | Ga0496126_0149598 | 3300048929 | Bacteria | 2002 |
| 643 | Ga0496126_0202533 | 3300048929 | Bacteria | 1675 |
| 644 | Ga0501033_0140763 | 3300049570 | Bacteria | 1744 |
| 645 | Ga0501034_0069690 | 3300049571 | Bacteria | 3528 |
| 646 | Ga0501043_0108214 | 3300049579 | Bacteria | 2184 |
| 647 | Ga0501047_0147011 | 3300049581 | Bacteria | 2233 |
| 648 | Ga0501047_0191251 | 3300049581 | Bacteria | 1910 |
| 649 | Ga0501211_005276 | 3300049658 | Bacteria | 1296 |
| 650 | Ga0501223_000066 | 3300049663 | Bacteria | 33567 |
| 651 | Ga0501223_000317 | 3300049663 | Bacteria | 12000 |
| 652 | Ga0501224_000076 | 3300049664 | Bacteria | 10275 |
| 653 | Ga0501233_000558 | 3300049668 | Bacteria | 6046 |
| 654 | Ga0501233_011054 | 3300049668 | Bacteria | 1789 |
| 655 | Ga0501235_003738 | 3300049669 | Bacteria | 3285 |
| 656 | Ga0501235_041828 | 3300049669 | Bacteria | 1049 |
| 657 | Ga0501225_0000137 | 3300049705 | Bacteria | 22173 |
| 658 | Ga0501225_0000228 | 3300049705 | Bacteria | 17699 |
| 659 | Ga0501225_0008682 | 3300049705 | Bacteria | 2909 |
| 660 | Ga0501234_000767 | 3300049707 | Bacteria | 4989 |
| 661 | Ga0501035_0294576 | 3300049822 | Bacteria | 1369 |
| 662 | Ga0501044_0090163 | 3300049823 | Bacteria | 3094 |
| 663 | Ga0501226_000183 | 3300049853 | Bacteria | 10218 |
| 664 | nmdc:mga06z11_9_c1 | 3300050494 | Bacteria | 109982 |
| 665 | nmdc:mga04h51_12_c1 | 3300050495 | Bacteria | 83117 |
| 666 | nmdc:mga07m45_101835_c1 | 3300050496 | Bacteria | 1649 |
| 667 | nmdc:mga05p37_27409_c1 | 3300050507 | Bacteria | 6934 |
| 668 | nmdc:mga05p37_844348_c1 | 3300050507 | Bacteria | 995 |
| 669 | nmdc:mga09592_115513_c1 | 3300050508 | Bacteria | 2303 |
| 670 | nmdc:mga06r32_10890_c1 | 3300050510 | Bacteria | 8189 |
| 671 | Ga0500643_023449 | 3300053087 | Bacteria | 1971 |
| 672 | Ga0500643_070832 | 3300053087 | Bacteria | 967 |
| 673 | Ga0500566_0007362 | 3300053094 | Bacteria | 6519 |
| 674 | Ga0500562_029007 | 3300053108 | Bacteria | 1455 |
| 675 | Ga0500592_000050 | 3300053116 | Bacteria | 35179 |
| 676 | Ga0500594_0001614 | 3300053118 | Bacteria | 4902 |
| 677 | Ga0500595_015056 | 3300053119 | Bacteria | 2913 |
| 678 | Ga0500658_0048476 | 3300053134 | Bacteria | 1727 |
| 679 | Ga0500559_0144605 | 3300053136 | Bacteria | 1114 |
| 680 | Ga0500573_0000366 | 3300053140 | Bacteria | 19207 |
| 681 | Ga0500573_0170376 | 3300053140 | Bacteria | 1178 |
| 682 | Ga0500577_0061655 | 3300053142 | Bacteria | 1444 |
| 683 | Ga0500616_0105036 | 3300053153 | Bacteria | 1374 |
| 684 | Ga0500624_000084 | 3300053157 | Bacteria | 47961 |
| 685 | Ga0500627_0000452 | 3300053158 | Bacteria | 11132 |
| 686 | Ga0500627_0000938 | 3300053158 | Bacteria | 7861 |
| 687 | Ga0500645_005027 | 3300053730 | Bacteria | 4952 |
| 688 | Ga0466962_0005982 | 3300061719 | Bacteria | 5846 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050496 | nmdc:mga07m45_101835_c1 | nmdc:mga07m45_101835_c1_19_663 | 195 |
| 2 | 3300005339 | Ga0070660_100063008 | Ga0070660_1000630082 | 209 |
| 3 | 3300025933 | Ga0207706_10160806 | Ga0207706_101608061 | 209 |
| 4 | 3300042005 | Ga0439448_0001841 | Ga0439448_0001841_2434_3168 | 209 |
| 5 | 3300042012 | Ga0439455_0007574 | Ga0439455_0007574_548_1282 | 209 |
| 6 | 3300042157 | Ga0439458_0000436 | Ga0439458_0000436_667_1401 | 209 |
| 7 | 3300005366 | Ga0070659_100433901 | Ga0070659_1004339011 | 219 |
| 8 | 3300006353 | Ga0075370_10066614 | Ga0075370_100666142 | 225 |
| 9 | 3300005327 | Ga0070658_10037857 | Ga0070658_100378574 | 226 |
| 10 | 3300005339 | Ga0070660_100011482 | Ga0070660_1000114822 | 226 |
| 11 | 3300025272 | Ga0209455_1000480 | Ga0209455_100048010 | 226 |
| 12 | 3300025919 | Ga0207657_10227301 | Ga0207657_102273012 | 226 |
| 13 | 3300005937 | Ga0081455_10160295 | Ga0081455_101602952 | 229 |
| 14 | 3300026142 | Ga0207698_10095930 | Ga0207698_100959302 | 231 |
| 15 | 3300026041 | Ga0207639_10401778 | Ga0207639_104017782 | 235 |
| 16 | 3300044694 | Ga0466963_0005621 | Ga0466963_0005621_4672_5409 | 235 |
| 17 | 3300044719 | Ga0466971_0131759 | Ga0466971_0131759_320_1057 | 235 |
| 18 | 3300045836 | Ga0466958_0187392 | Ga0466958_0187392_532_1269 | 235 |
| 19 | 3300003320 | rootH2_10235635 | rootH2_102356352 | 236 |
| 20 | 3300039450 | Ga0436363_0379517 | Ga0436363_0379517_822_1544 | 237 |
| 21 | 3300006846 | Ga0075430_100059109 | Ga0075430_1000591094 | 238 |
| 22 | 3300006847 | Ga0075431_100151201 | Ga0075431_1001512014 | 238 |
| 23 | 3300006847 | Ga0075431_100366551 | Ga0075431_1003665513 | 238 |
| 24 | 3300006880 | Ga0075429_100161451 | Ga0075429_1001614512 | 238 |
| 25 | 3300009147 | Ga0114129_10841433 | Ga0114129_108414332 | 238 |
| 26 | 3300013306 | Ga0163162_10096754 | Ga0163162_100967542 | 238 |
| 27 | 3300050507 | nmdc:mga05p37_27409_c1 | nmdc:mga05p37_27409_c1_5388_6119 | 238 |
| 28 | 3300050507 | nmdc:mga05p37_844348_c1 | nmdc:mga05p37_844348_c1_73_804 | 238 |
| 29 | 3300050508 | nmdc:mga09592_115513_c1 | nmdc:mga09592_115513_c1_259_990 | 238 |
| 30 | 3300050510 | nmdc:mga06r32_10890_c1 | nmdc:mga06r32_10890_c1_832_1563 | 238 |
| 31 | iso_pu_bacteria | 2599185359 | 2600228822 | 239 |
| 32 | iso_pu_bacteria | 2643221622 | 2644125801 | 239 |
| 33 | iso_pu_bacteria | 2818991466 | 2819714649 | 239 |
| 34 | iso_pu_bacteria | 2879163058 | 2879165271 | 239 |
| 35 | iso_pu_bacteria | 2885427238 | 2885428503 | 239 |
| 36 | iso_pu_bacteria | 2928027323 | 2928030398 | 239 |
| 37 | iso_pu_bacteria | 2928526807 | 2928529152 | 239 |
| 38 | iso_pu_bacteria | 2928968154 | 2928968696 | 239 |
| 39 | iso_pu_bacteria | 2984555340 | 2984557324 | 239 |
| 40 | iso_pu_bacteria | 2512564014 | 2512644916 | 240 |
| 41 | iso_pu_bacteria | 2808606401 | 2809064386 | 240 |
| 42 | iso_pu_bacteria | 2808606404 | 2809080449 | 240 |
| 43 | iso_pu_bacteria | 2808606405 | 2809084718 | 240 |
| 44 | iso_pu_bacteria | 2880518877 | 2880519159 | 240 |
| 45 | 3300001976 | JGI24752J21851_1001710 | JGI24752J21851_10017102 | 242 |
| 46 | 3300003323 | rootH1_10190613 | rootH1_101906131 | 242 |
| 47 | 3300005331 | Ga0070670_100000075 | Ga0070670_10000007585 | 242 |
| 48 | 3300005345 | Ga0070692_10018735 | Ga0070692_100187354 | 242 |
| 49 | 3300005347 | Ga0070668_100089004 | Ga0070668_1000890043 | 242 |
| 50 | 3300005355 | Ga0070671_100099761 | Ga0070671_1000997613 | 242 |
| 51 | 3300005367 | Ga0070667_100000039 | Ga0070667_10000003959 | 242 |
| 52 | 3300005367 | Ga0070667_100259304 | Ga0070667_1002593042 | 242 |
| 53 | 3300005548 | Ga0070665_100138494 | Ga0070665_1001384943 | 242 |
| 54 | 3300005563 | Ga0068855_100526948 | Ga0068855_1005269481 | 242 |
| 55 | 3300005616 | Ga0068852_100199080 | Ga0068852_1001990802 | 242 |
| 56 | 3300005618 | Ga0068864_100000016 | Ga0068864_100000016199 | 242 |
| 57 | 3300005841 | Ga0068863_100000033 | Ga0068863_10000003353 | 242 |
| 58 | 3300005844 | Ga0068862_100000040 | Ga0068862_10000004052 | 242 |
| 59 | 3300005844 | Ga0068862_100009087 | Ga0068862_1000090872 | 242 |
| 60 | 3300009011 | Ga0105251_10001444 | Ga0105251_100014448 | 242 |
| 61 | 3300009177 | Ga0105248_10000021 | Ga0105248_10000021165 | 242 |
| 62 | 3300009177 | Ga0105248_10982508 | Ga0105248_109825081 | 242 |
| 63 | 3300014325 | Ga0163163_10120063 | Ga0163163_101200633 | 242 |
| 64 | 3300025735 | Ga0207713_1007763 | Ga0207713_10077632 | 242 |
| 65 | 3300025925 | Ga0207650_10000069 | Ga0207650_10000069125 | 242 |
| 66 | 3300025931 | Ga0207644_10225803 | Ga0207644_102258032 | 242 |
| 67 | 3300025941 | Ga0207711_10000025 | Ga0207711_10000025131 | 242 |
| 68 | 3300025972 | Ga0207668_10135614 | Ga0207668_101356141 | 242 |
| 69 | 3300025986 | Ga0207658_10000652 | Ga0207658_1000065223 | 242 |
| 70 | 3300025986 | Ga0207658_10202436 | Ga0207658_102024362 | 242 |
| 71 | 3300026088 | Ga0207641_10000002 | Ga0207641_1000000252 | 242 |
| 72 | 3300026095 | Ga0207676_10000353 | Ga0207676_100003532 | 242 |
| 73 | 3300026142 | Ga0207698_10304513 | Ga0207698_103045132 | 242 |
| 74 | 3300028379 | Ga0268266_10194973 | Ga0268266_101949732 | 242 |
| 75 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003939 | 242 |
| 76 | 3300044842 | Ga0466957_0206908 | Ga0466957_0206908_25_753 | 242 |
| 77 | 3300048906 | Ga0496103_0041637 | Ga0496103_0041637_1422_2150 | 242 |
| 78 | 3300048920 | Ga0496117_0040062 | Ga0496117_0040062_1975_2703 | 242 |
| 79 | 3300048921 | Ga0496118_0002436 | Ga0496118_0002436_9885_10613 | 242 |
| 80 | 3300048921 | Ga0496118_0023982 | Ga0496118_0023982_2345_3073 | 242 |
| 81 | 3300048924 | Ga0496121_0099521 | Ga0496121_0099521_197_925 | 242 |
| 82 | 3300048926 | Ga0496123_0163235 | Ga0496123_0163235_354_1082 | 242 |
| 83 | 3300049668 | Ga0501233_011054 | Ga0501233_011054_509_1243 | 242 |
| 84 | 3300049822 | Ga0501035_0294576 | Ga0501035_0294576_570_1298 | 242 |
| 85 | 3300053087 | Ga0500643_070832 | Ga0500643_070832_200_928 | 242 |
| 86 | 3300001979 | JGI24740J21852_10004963 | JGI24740J21852_100049634 | 243 |
| 87 | 3300001989 | JGI24739J22299_10011325 | JGI24739J22299_100113253 | 243 |
| 88 | 3300001990 | JGI24737J22298_10005153 | JGI24737J22298_100051534 | 243 |
| 89 | 3300002067 | JGI24735J21928_10001689 | JGI24735J21928_100016893 | 243 |
| 90 | 3300002067 | JGI24735J21928_10003032 | JGI24735J21928_100030326 | 243 |
| 91 | 3300002067 | JGI24735J21928_10015767 | JGI24735J21928_100157673 | 243 |
| 92 | 3300002067 | JGI24735J21928_10050673 | JGI24735J21928_100506732 | 243 |
| 93 | 3300002070 | JGI24750J21931_1000042 | JGI24750J21931_10000429 | 243 |
| 94 | 3300002074 | JGI24748J21848_1000063 | JGI24748J21848_100006338 | 243 |
| 95 | 3300002075 | JGI24738J21930_10001001 | JGI24738J21930_100010013 | 243 |
| 96 | 3300002075 | JGI24738J21930_10001487 | JGI24738J21930_100014874 | 243 |
| 97 | 3300002239 | JGI24034J26672_10000007 | JGI24034J26672_1000000715 | 243 |
| 98 | 3300002774 | JGI25150J39212_1002132 | JGI25150J39212_10021324 | 243 |
| 99 | 3300003214 | JGI25165J46597_1000145 | JGI25165J46597_100014568 | 243 |
| 100 | 3300003215 | JGI25153J46596_10000028 | JGI25153J46596_10000028148 | 243 |
| 101 | 3300003320 | rootH2_10161563 | rootH2_101615632 | 243 |
| 102 | 3300003322 | rootL2_10107312 | rootL2_101073122 | 243 |
| 103 | 3300003771 | Ga0055526_1000478 | Ga0055526_100047821 | 243 |
| 104 | 3300003773 | Ga0055537_1001154 | Ga0055537_10011547 | 243 |
| 105 | 3300003775 | Ga0055524_1000457 | Ga0055524_100045730 | 243 |
| 106 | 3300003791 | Ga0055530_10041505 | Ga0055530_100415052 | 243 |
| 107 | 3300003792 | Ga0055540_1001446 | Ga0055540_10014461 | 243 |
| 108 | 3300003792 | Ga0055540_1001525 | Ga0055540_100152516 | 243 |
| 109 | 3300003794 | Ga0055531_10000384 | Ga0055531_1000038437 | 243 |
| 110 | 3300005262 | Ga0065165_1002862 | Ga0065165_100286214 | 243 |
| 111 | 3300005262 | Ga0065165_1003940 | Ga0065165_10039403 | 243 |
| 112 | 3300005262 | Ga0065165_1031534 | Ga0065165_10315342 | 243 |
| 113 | 3300005262 | Ga0065165_1044517 | Ga0065165_10445172 | 243 |
| 114 | 3300005295 | Ga0065707_10082875 | Ga0065707_100828757 | 243 |
| 115 | 3300005327 | Ga0070658_10000033 | Ga0070658_1000003327 | 243 |
| 116 | 3300005327 | Ga0070658_10160501 | Ga0070658_101605012 | 243 |
| 117 | 3300005328 | Ga0070676_10411414 | Ga0070676_104114142 | 243 |
| 118 | 3300005328 | Ga0070676_10503058 | Ga0070676_105030581 | 243 |
| 119 | 3300005330 | Ga0070690_100000110 | Ga0070690_10000011022 | 243 |
| 120 | 3300005330 | Ga0070690_100019099 | Ga0070690_1000190993 | 243 |
| 121 | 3300005331 | Ga0070670_100085590 | Ga0070670_1000855903 | 243 |
| 122 | 3300005331 | Ga0070670_100111155 | Ga0070670_1001111552 | 243 |
| 123 | 3300005331 | Ga0070670_100169856 | Ga0070670_1001698562 | 243 |
| 124 | 3300005334 | Ga0068869_100191317 | Ga0068869_1001913172 | 243 |
| 125 | 3300005335 | Ga0070666_10000417 | Ga0070666_100004178 | 243 |
| 126 | 3300005335 | Ga0070666_10003441 | Ga0070666_100034414 | 243 |
| 127 | 3300005339 | Ga0070660_100002857 | Ga0070660_10000285710 | 243 |
| 128 | 3300005339 | Ga0070660_100073995 | Ga0070660_1000739953 | 243 |
| 129 | 3300005339 | Ga0070660_100090135 | Ga0070660_1000901351 | 243 |
| 130 | 3300005339 | Ga0070660_100092582 | Ga0070660_1000925822 | 243 |
| 131 | 3300005339 | Ga0070660_100135012 | Ga0070660_1001350123 | 243 |
| 132 | 3300005339 | Ga0070660_100173181 | Ga0070660_1001731812 | 243 |
| 133 | 3300005344 | Ga0070661_100130953 | Ga0070661_1001309531 | 243 |
| 134 | 3300005344 | Ga0070661_100199930 | Ga0070661_1001999302 | 243 |
| 135 | 3300005344 | Ga0070661_100254965 | Ga0070661_1002549652 | 243 |
| 136 | 3300005344 | Ga0070661_100274167 | Ga0070661_1002741672 | 243 |
| 137 | 3300005353 | Ga0070669_100000332 | Ga0070669_10000033221 | 243 |
| 138 | 3300005354 | Ga0070675_100146846 | Ga0070675_1001468462 | 243 |
| 139 | 3300005355 | Ga0070671_100022882 | Ga0070671_1000228824 | 243 |
| 140 | 3300005355 | Ga0070671_100055455 | Ga0070671_1000554552 | 243 |
| 141 | 3300005355 | Ga0070671_100073726 | Ga0070671_1000737263 | 243 |
| 142 | 3300005356 | Ga0070674_100092379 | Ga0070674_1000923793 | 243 |
| 143 | 3300005364 | Ga0070673_100002629 | Ga0070673_1000026295 | 243 |
| 144 | 3300005366 | Ga0070659_100002258 | Ga0070659_1000022584 | 243 |
| 145 | 3300005366 | Ga0070659_100022028 | Ga0070659_1000220282 | 243 |
| 146 | 3300005366 | Ga0070659_100057141 | Ga0070659_1000571412 | 243 |
| 147 | 3300005366 | Ga0070659_100062359 | Ga0070659_1000623594 | 243 |
| 148 | 3300005366 | Ga0070659_100115132 | Ga0070659_1001151322 | 243 |
| 149 | 3300005366 | Ga0070659_100181006 | Ga0070659_1001810062 | 243 |
| 150 | 3300005366 | Ga0070659_100271573 | Ga0070659_1002715732 | 243 |
| 151 | 3300005366 | Ga0070659_100676045 | Ga0070659_1006760451 | 243 |
| 152 | 3300005455 | Ga0070663_100132933 | Ga0070663_1001329332 | 243 |
| 153 | 3300005455 | Ga0070663_100181416 | Ga0070663_1001814162 | 243 |
| 154 | 3300005456 | Ga0070678_100001866 | Ga0070678_10000186610 | 243 |
| 155 | 3300005457 | Ga0070662_100006444 | Ga0070662_1000064442 | 243 |
| 156 | 3300005457 | Ga0070662_100011803 | Ga0070662_1000118032 | 243 |
| 157 | 3300005457 | Ga0070662_100168906 | Ga0070662_1001689062 | 243 |
| 158 | 3300005458 | Ga0070681_10102501 | Ga0070681_101025011 | 243 |
| 159 | 3300005459 | Ga0068867_100005781 | Ga0068867_1000057817 | 243 |
| 160 | 3300005459 | Ga0068867_100006557 | Ga0068867_1000065572 | 243 |
| 161 | 3300005466 | Ga0070685_10000036 | Ga0070685_1000003681 | 243 |
| 162 | 3300005539 | Ga0068853_100008364 | Ga0068853_1000083642 | 243 |
| 163 | 3300005539 | Ga0068853_100552448 | Ga0068853_1005524481 | 243 |
| 164 | 3300005539 | Ga0068853_100614750 | Ga0068853_1006147502 | 243 |
| 165 | 3300005539 | Ga0068853_100842060 | Ga0068853_1008420601 | 243 |
| 166 | 3300005543 | Ga0070672_100018490 | Ga0070672_1000184904 | 243 |
| 167 | 3300005543 | Ga0070672_100250539 | Ga0070672_1002505392 | 243 |
| 168 | 3300005544 | Ga0070686_100000045 | Ga0070686_10000004584 | 243 |
| 169 | 3300005547 | Ga0070693_100096773 | Ga0070693_1000967732 | 243 |
| 170 | 3300005548 | Ga0070665_100000042 | Ga0070665_100000042205 | 243 |
| 171 | 3300005548 | Ga0070665_100139592 | Ga0070665_1001395922 | 243 |
| 172 | 3300005563 | Ga0068855_100117343 | Ga0068855_1001173433 | 243 |
| 173 | 3300005563 | Ga0068855_100131931 | Ga0068855_1001319312 | 243 |
| 174 | 3300005564 | Ga0070664_100014603 | Ga0070664_1000146034 | 243 |
| 175 | 3300005577 | Ga0068857_100018632 | Ga0068857_1000186326 | 243 |
| 176 | 3300005577 | Ga0068857_100235716 | Ga0068857_1002357161 | 243 |
| 177 | 3300005577 | Ga0068857_100244914 | Ga0068857_1002449142 | 243 |
| 178 | 3300005577 | Ga0068857_100392160 | Ga0068857_1003921602 | 243 |
| 179 | 3300005578 | Ga0068854_100016231 | Ga0068854_1000162313 | 243 |
| 180 | 3300005578 | Ga0068854_100025435 | Ga0068854_1000254354 | 243 |
| 181 | 3300005578 | Ga0068854_100067438 | Ga0068854_1000674383 | 243 |
| 182 | 3300005614 | Ga0068856_100016269 | Ga0068856_1000162696 | 243 |
| 183 | 3300005614 | Ga0068856_100036758 | Ga0068856_1000367582 | 243 |
| 184 | 3300005614 | Ga0068856_100064590 | Ga0068856_1000645903 | 243 |
| 185 | 3300005614 | Ga0068856_100246893 | Ga0068856_1002468932 | 243 |
| 186 | 3300005616 | Ga0068852_100068729 | Ga0068852_1000687292 | 243 |
| 187 | 3300005616 | Ga0068852_100454952 | Ga0068852_1004549522 | 243 |
| 188 | 3300005616 | Ga0068852_101093151 | Ga0068852_1010931511 | 243 |
| 189 | 3300005617 | Ga0068859_100005488 | Ga0068859_1000054889 | 243 |
| 190 | 3300005617 | Ga0068859_100022537 | Ga0068859_1000225373 | 243 |
| 191 | 3300005618 | Ga0068864_100157801 | Ga0068864_1001578012 | 243 |
| 192 | 3300005719 | Ga0068861_100000321 | Ga0068861_10000032127 | 243 |
| 193 | 3300005719 | Ga0068861_100000965 | Ga0068861_1000009653 | 243 |
| 194 | 3300005834 | Ga0068851_10008938 | Ga0068851_100089382 | 243 |
| 195 | 3300005834 | Ga0068851_10027735 | Ga0068851_100277353 | 243 |
| 196 | 3300005841 | Ga0068863_100000280 | Ga0068863_10000028014 | 243 |
| 197 | 3300005841 | Ga0068863_100007192 | Ga0068863_1000071924 | 243 |
| 198 | 3300005841 | Ga0068863_100019160 | Ga0068863_1000191606 | 243 |
| 199 | 3300005842 | Ga0068858_100007900 | Ga0068858_1000079002 | 243 |
| 200 | 3300005842 | Ga0068858_100069059 | Ga0068858_1000690592 | 243 |
| 201 | 3300005843 | Ga0068860_100000182 | Ga0068860_10000018285 | 243 |
| 202 | 3300005843 | Ga0068860_100112898 | Ga0068860_1001128981 | 243 |
| 203 | 3300005844 | Ga0068862_100000308 | Ga0068862_10000030823 | 243 |
| 204 | 3300005844 | Ga0068862_100266217 | Ga0068862_1002662172 | 243 |
| 205 | 3300005844 | Ga0068862_100361141 | Ga0068862_1003611412 | 243 |
| 206 | 3300006237 | Ga0097621_100048516 | Ga0097621_1000485162 | 243 |
| 207 | 3300006358 | Ga0068871_100562537 | Ga0068871_1005625371 | 243 |
| 208 | 3300006881 | Ga0068865_100004177 | Ga0068865_1000041772 | 243 |
| 209 | 3300006931 | Ga0097620_100005488 | Ga0097620_1000054885 | 243 |
| 210 | 3300006931 | Ga0097620_100022537 | Ga0097620_1000225373 | 243 |
| 211 | 3300009093 | Ga0105240_10007666 | Ga0105240_100076665 | 243 |
| 212 | 3300009093 | Ga0105240_10026155 | Ga0105240_100261557 | 243 |
| 213 | 3300009093 | Ga0105240_10098942 | Ga0105240_100989423 | 243 |
| 214 | 3300009093 | Ga0105240_10128458 | Ga0105240_101284582 | 243 |
| 215 | 3300009098 | Ga0105245_10001867 | Ga0105245_1000186720 | 243 |
| 216 | 3300009101 | Ga0105247_10214021 | Ga0105247_102140212 | 243 |
| 217 | 3300009148 | Ga0105243_10104131 | Ga0105243_101041313 | 243 |
| 218 | 3300009174 | Ga0105241_10217538 | Ga0105241_102175382 | 243 |
| 219 | 3300009176 | Ga0105242_10064796 | Ga0105242_100647963 | 243 |
| 220 | 3300009177 | Ga0105248_10124883 | Ga0105248_101248832 | 243 |
| 221 | 3300009177 | Ga0105248_10394403 | Ga0105248_103944032 | 243 |
| 222 | 3300009545 | Ga0105237_10009418 | Ga0105237_1000941812 | 243 |
| 223 | 3300009545 | Ga0105237_10050016 | Ga0105237_100500164 | 243 |
| 224 | 3300009545 | Ga0105237_10054292 | Ga0105237_100542922 | 243 |
| 225 | 3300009551 | Ga0105238_10065766 | Ga0105238_100657662 | 243 |
| 226 | 3300009551 | Ga0105238_10120716 | Ga0105238_101207162 | 243 |
| 227 | 3300009551 | Ga0105238_10421674 | Ga0105238_104216742 | 243 |
| 228 | 3300009553 | Ga0105249_10000012 | Ga0105249_1000001283 | 243 |
| 229 | 3300009553 | Ga0105249_10002603 | Ga0105249_100026035 | 243 |
| 230 | 3300009553 | Ga0105249_10807819 | Ga0105249_108078192 | 243 |
| 231 | 3300010375 | Ga0105239_10000461 | Ga0105239_100004614 | 243 |
| 232 | 3300011119 | Ga0105246_10176826 | Ga0105246_101768262 | 243 |
| 233 | 3300013100 | Ga0157373_10121323 | Ga0157373_101213232 | 243 |
| 234 | 3300013100 | Ga0157373_10492926 | Ga0157373_104929261 | 243 |
| 235 | 3300013102 | Ga0157371_10085604 | Ga0157371_100856043 | 243 |
| 236 | 3300013102 | Ga0157371_10149242 | Ga0157371_101492422 | 243 |
| 237 | 3300013102 | Ga0157371_10169826 | Ga0157371_101698262 | 243 |
| 238 | 3300013104 | Ga0157370_10000008 | Ga0157370_10000008100 | 243 |
| 239 | 3300013104 | Ga0157370_10002308 | Ga0157370_1000230811 | 243 |
| 240 | 3300013104 | Ga0157370_10024209 | Ga0157370_100242096 | 243 |
| 241 | 3300013105 | Ga0157369_10031631 | Ga0157369_100316312 | 243 |
| 242 | 3300013105 | Ga0157369_10112395 | Ga0157369_101123952 | 243 |
| 243 | 3300013296 | Ga0157374_10004197 | Ga0157374_100041972 | 243 |
| 244 | 3300013296 | Ga0157374_10067557 | Ga0157374_100675573 | 243 |
| 245 | 3300013296 | Ga0157374_10372050 | Ga0157374_103720502 | 243 |
| 246 | 3300013306 | Ga0163162_10202484 | Ga0163162_102024842 | 243 |
| 247 | 3300013306 | Ga0163162_10204173 | Ga0163162_102041732 | 243 |
| 248 | 3300013307 | Ga0157372_10018134 | Ga0157372_100181343 | 243 |
| 249 | 3300014325 | Ga0163163_10081360 | Ga0163163_100813602 | 243 |
| 250 | 3300014325 | Ga0163163_10159477 | Ga0163163_101594773 | 243 |
| 251 | 3300014326 | Ga0157380_10000440 | Ga0157380_1000044025 | 243 |
| 252 | 3300014968 | Ga0157379_10003144 | Ga0157379_1000314415 | 243 |
| 253 | 3300014968 | Ga0157379_10036117 | Ga0157379_100361172 | 243 |
| 254 | 3300014968 | Ga0157379_10121240 | Ga0157379_101212402 | 243 |
| 255 | 3300014969 | Ga0157376_10130417 | Ga0157376_101304172 | 243 |
| 256 | 3300017792 | Ga0163161_10000202 | Ga0163161_1000020212 | 243 |
| 257 | 3300017792 | Ga0163161_10017029 | Ga0163161_100170293 | 243 |
| 258 | 3300017792 | Ga0163161_10355841 | Ga0163161_103558412 | 243 |
| 259 | 3300017792 | Ga0163161_10406912 | Ga0163161_104069122 | 243 |
| 260 | 3300020082 | Ga0206353_11760290 | Ga0206353_117602908 | 243 |
| 261 | 3300021384 | Ga0213876_10033404 | Ga0213876_100334042 | 243 |
| 262 | 3300021388 | Ga0213875_10000721 | Ga0213875_100007211 | 243 |
| 263 | 3300025223 | Ga0207672_1001024 | Ga0207672_10010242 | 243 |
| 264 | 3300025231 | Ga0207427_100545 | Ga0207427_1005455 | 243 |
| 265 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005147 | 243 |
| 266 | 3300025245 | Ga0207425_1004365 | Ga0207425_10043654 | 243 |
| 267 | 3300025250 | Ga0209026_1002632 | Ga0209026_10026325 | 243 |
| 268 | 3300025254 | Ga0209148_1000338 | Ga0209148_100033849 | 243 |
| 269 | 3300025258 | Ga0209129_1000825 | Ga0209129_100082519 | 243 |
| 270 | 3300025261 | Ga0209233_1000207 | Ga0209233_100020767 | 243 |
| 271 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007128 | 243 |
| 272 | 3300025263 | Ga0209565_1000056 | Ga0209565_1000056115 | 243 |
| 273 | 3300025272 | Ga0209455_1018960 | Ga0209455_10189602 | 243 |
| 274 | 3300025273 | Ga0209673_1001497 | Ga0209673_100149724 | 243 |
| 275 | 3300025294 | Ga0209025_1000296 | Ga0209025_100029650 | 243 |
| 276 | 3300025297 | Ga0209758_1000002 | Ga0209758_10000021197 | 243 |
| 277 | 3300025297 | Ga0209758_1002418 | Ga0209758_10024189 | 243 |
| 278 | 3300025297 | Ga0209758_1066833 | Ga0209758_10668332 | 243 |
| 279 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005111 | 243 |
| 280 | 3300025298 | Ga0209050_1000196 | Ga0209050_100019613 | 243 |
| 281 | 3300025298 | Ga0209050_1008839 | Ga0209050_10088395 | 243 |
| 282 | 3300025298 | Ga0209050_1016183 | Ga0209050_10161833 | 243 |
| 283 | 3300025299 | Ga0209256_1000009 | Ga0209256_100000931 | 243 |
| 284 | 3300025303 | Ga0209051_1000153 | Ga0209051_100015377 | 243 |
| 285 | 3300025304 | Ga0209257_1000228 | Ga0209257_100022813 | 243 |
| 286 | 3300025304 | Ga0209257_1003469 | Ga0209257_10034699 | 243 |
| 287 | 3300025304 | Ga0209257_1004247 | Ga0209257_10042476 | 243 |
| 288 | 3300025304 | Ga0209257_1004769 | Ga0209257_10047699 | 243 |
| 289 | 3300025315 | Ga0207697_10016147 | Ga0207697_100161472 | 243 |
| 290 | 3300025900 | Ga0207710_10166100 | Ga0207710_101661002 | 243 |
| 291 | 3300025901 | Ga0207688_10032718 | Ga0207688_100327184 | 243 |
| 292 | 3300025903 | Ga0207680_10000012 | Ga0207680_10000012203 | 243 |
| 293 | 3300025904 | Ga0207647_10001622 | Ga0207647_100016224 | 243 |
| 294 | 3300025904 | Ga0207647_10135199 | Ga0207647_101351992 | 243 |
| 295 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021911 | 243 |
| 296 | 3300025909 | Ga0207705_10007714 | Ga0207705_100077147 | 243 |
| 297 | 3300025909 | Ga0207705_10011424 | Ga0207705_100114244 | 243 |
| 298 | 3300025909 | Ga0207705_10042116 | Ga0207705_100421163 | 243 |
| 299 | 3300025909 | Ga0207705_10117758 | Ga0207705_101177582 | 243 |
| 300 | 3300025909 | Ga0207705_10192064 | Ga0207705_101920642 | 243 |
| 301 | 3300025909 | Ga0207705_10194448 | Ga0207705_101944482 | 243 |
| 302 | 3300025911 | Ga0207654_10001661 | Ga0207654_1000166112 | 243 |
| 303 | 3300025913 | Ga0207695_10000641 | Ga0207695_1000064115 | 243 |
| 304 | 3300025913 | Ga0207695_10006576 | Ga0207695_1000657613 | 243 |
| 305 | 3300025913 | Ga0207695_10077765 | Ga0207695_100777653 | 243 |
| 306 | 3300025913 | Ga0207695_10098637 | Ga0207695_100986373 | 243 |
| 307 | 3300025913 | Ga0207695_10134453 | Ga0207695_101344532 | 243 |
| 308 | 3300025914 | Ga0207671_10002738 | Ga0207671_1000273810 | 243 |
| 309 | 3300025919 | Ga0207657_10008853 | Ga0207657_100088536 | 243 |
| 310 | 3300025919 | Ga0207657_10065750 | Ga0207657_100657502 | 243 |
| 311 | 3300025919 | Ga0207657_10066709 | Ga0207657_100667093 | 243 |
| 312 | 3300025919 | Ga0207657_10103427 | Ga0207657_101034273 | 243 |
| 313 | 3300025919 | Ga0207657_10189101 | Ga0207657_101891012 | 243 |
| 314 | 3300025919 | Ga0207657_10254383 | Ga0207657_102543832 | 243 |
| 315 | 3300025920 | Ga0207649_10010061 | Ga0207649_100100615 | 243 |
| 316 | 3300025920 | Ga0207649_10050916 | Ga0207649_100509162 | 243 |
| 317 | 3300025920 | Ga0207649_10126732 | Ga0207649_101267322 | 243 |
| 318 | 3300025920 | Ga0207649_10312385 | Ga0207649_103123852 | 243 |
| 319 | 3300025920 | Ga0207649_10325948 | Ga0207649_103259482 | 243 |
| 320 | 3300025923 | Ga0207681_10000076 | Ga0207681_1000007677 | 243 |
| 321 | 3300025924 | Ga0207694_10001461 | Ga0207694_1000146116 | 243 |
| 322 | 3300025924 | Ga0207694_10028824 | Ga0207694_100288241 | 243 |
| 323 | 3300025925 | Ga0207650_10026743 | Ga0207650_100267433 | 243 |
| 324 | 3300025925 | Ga0207650_10061262 | Ga0207650_100612622 | 243 |
| 325 | 3300025925 | Ga0207650_10157802 | Ga0207650_101578022 | 243 |
| 326 | 3300025927 | Ga0207687_10003098 | Ga0207687_100030987 | 243 |
| 327 | 3300025931 | Ga0207644_10003422 | Ga0207644_100034227 | 243 |
| 328 | 3300025931 | Ga0207644_10072418 | Ga0207644_100724182 | 243 |
| 329 | 3300025931 | Ga0207644_10081104 | Ga0207644_100811043 | 243 |
| 330 | 3300025932 | Ga0207690_10003689 | Ga0207690_100036892 | 243 |
| 331 | 3300025932 | Ga0207690_10007350 | Ga0207690_100073504 | 243 |
| 332 | 3300025932 | Ga0207690_10040990 | Ga0207690_100409903 | 243 |
| 333 | 3300025932 | Ga0207690_10043362 | Ga0207690_100433624 | 243 |
| 334 | 3300025932 | Ga0207690_10093263 | Ga0207690_100932632 | 243 |
| 335 | 3300025932 | Ga0207690_10099311 | Ga0207690_100993113 | 243 |
| 336 | 3300025932 | Ga0207690_10129291 | Ga0207690_101292913 | 243 |
| 337 | 3300025932 | Ga0207690_10161495 | Ga0207690_101614952 | 243 |
| 338 | 3300025932 | Ga0207690_10314363 | Ga0207690_103143632 | 243 |
| 339 | 3300025933 | Ga0207706_10001442 | Ga0207706_1000144220 | 243 |
| 340 | 3300025933 | Ga0207706_10018968 | Ga0207706_100189688 | 243 |
| 341 | 3300025933 | Ga0207706_10246139 | Ga0207706_102461392 | 243 |
| 342 | 3300025933 | Ga0207706_10511476 | Ga0207706_105114762 | 243 |
| 343 | 3300025933 | Ga0207706_10643802 | Ga0207706_106438022 | 243 |
| 344 | 3300025934 | Ga0207686_10028588 | Ga0207686_100285882 | 243 |
| 345 | 3300025935 | Ga0207709_10105314 | Ga0207709_101053142 | 243 |
| 346 | 3300025937 | Ga0207669_10078646 | Ga0207669_100786462 | 243 |
| 347 | 3300025940 | Ga0207691_10000631 | Ga0207691_100006319 | 243 |
| 348 | 3300025940 | Ga0207691_10037826 | Ga0207691_100378264 | 243 |
| 349 | 3300025941 | Ga0207711_10010871 | Ga0207711_100108712 | 243 |
| 350 | 3300025941 | Ga0207711_10016625 | Ga0207711_100166253 | 243 |
| 351 | 3300025942 | Ga0207689_10087928 | Ga0207689_100879283 | 243 |
| 352 | 3300025942 | Ga0207689_10100100 | Ga0207689_101001003 | 243 |
| 353 | 3300025945 | Ga0207679_10005299 | Ga0207679_100052995 | 243 |
| 354 | 3300025945 | Ga0207679_10016820 | Ga0207679_100168206 | 243 |
| 355 | 3300025949 | Ga0207667_10004663 | Ga0207667_100046634 | 243 |
| 356 | 3300025949 | Ga0207667_10044332 | Ga0207667_100443325 | 243 |
| 357 | 3300025949 | Ga0207667_10219943 | Ga0207667_102199431 | 243 |
| 358 | 3300025960 | Ga0207651_10008206 | Ga0207651_100082065 | 243 |
| 359 | 3300025961 | Ga0207712_10000021 | Ga0207712_10000021203 | 243 |
| 360 | 3300025961 | Ga0207712_10002020 | Ga0207712_1000202011 | 243 |
| 361 | 3300025981 | Ga0207640_10018490 | Ga0207640_100184904 | 243 |
| 362 | 3300025981 | Ga0207640_10158364 | Ga0207640_101583642 | 243 |
| 363 | 3300025986 | Ga0207658_10003067 | Ga0207658_1000306712 | 243 |
| 364 | 3300026023 | Ga0207677_10087570 | Ga0207677_100875702 | 243 |
| 365 | 3300026035 | Ga0207703_10010176 | Ga0207703_100101767 | 243 |
| 366 | 3300026035 | Ga0207703_10054384 | Ga0207703_100543842 | 243 |
| 367 | 3300026041 | Ga0207639_10071982 | Ga0207639_100719823 | 243 |
| 368 | 3300026041 | Ga0207639_10315558 | Ga0207639_103155582 | 243 |
| 369 | 3300026041 | Ga0207639_10787962 | Ga0207639_107879621 | 243 |
| 370 | 3300026067 | Ga0207678_10004357 | Ga0207678_100043572 | 243 |
| 371 | 3300026067 | Ga0207678_10045975 | Ga0207678_100459752 | 243 |
| 372 | 3300026067 | Ga0207678_10241115 | Ga0207678_102411152 | 243 |
| 373 | 3300026078 | Ga0207702_10008254 | Ga0207702_100082542 | 243 |
| 374 | 3300026088 | Ga0207641_10000414 | Ga0207641_1000041411 | 243 |
| 375 | 3300026088 | Ga0207641_10005204 | Ga0207641_100052049 | 243 |
| 376 | 3300026089 | Ga0207648_10001344 | Ga0207648_100013445 | 243 |
| 377 | 3300026089 | Ga0207648_10062609 | Ga0207648_100626094 | 243 |
| 378 | 3300026095 | Ga0207676_10009609 | Ga0207676_100096099 | 243 |
| 379 | 3300026095 | Ga0207676_10077831 | Ga0207676_100778312 | 243 |
| 380 | 3300026116 | Ga0207674_10000291 | Ga0207674_1000029155 | 243 |
| 381 | 3300026116 | Ga0207674_10042500 | Ga0207674_100425004 | 243 |
| 382 | 3300026116 | Ga0207674_10114135 | Ga0207674_101141353 | 243 |
| 383 | 3300026116 | Ga0207674_10246853 | Ga0207674_102468532 | 243 |
| 384 | 3300026116 | Ga0207674_10251420 | Ga0207674_102514202 | 243 |
| 385 | 3300026118 | Ga0207675_100000227 | Ga0207675_10000022738 | 243 |
| 386 | 3300026118 | Ga0207675_100000998 | Ga0207675_10000099826 | 243 |
| 387 | 3300026121 | Ga0207683_10004993 | Ga0207683_1000499310 | 243 |
| 388 | 3300026142 | Ga0207698_10001499 | Ga0207698_1000149910 | 243 |
| 389 | 3300026142 | Ga0207698_10038110 | Ga0207698_100381102 | 243 |
| 390 | 3300026142 | Ga0207698_10079015 | Ga0207698_100790153 | 243 |
| 391 | 3300028379 | Ga0268266_10000054 | Ga0268266_10000054202 | 243 |
| 392 | 3300028379 | Ga0268266_10116025 | Ga0268266_101160252 | 243 |
| 393 | 3300028380 | Ga0268265_10002814 | Ga0268265_1000281413 | 243 |
| 394 | 3300028380 | Ga0268265_10239805 | Ga0268265_102398052 | 243 |
| 395 | 3300028380 | Ga0268265_10315647 | Ga0268265_103156471 | 243 |
| 396 | 3300028381 | Ga0268264_10000074 | Ga0268264_10000074203 | 243 |
| 397 | 3300028381 | Ga0268264_10754480 | Ga0268264_107544802 | 243 |
| 398 | 3300031824 | Ga0307413_10004075 | Ga0307413_100040756 | 243 |
| 399 | 3300031824 | Ga0307413_10028063 | Ga0307413_100280631 | 243 |
| 400 | 3300031824 | Ga0307413_10119107 | Ga0307413_101191072 | 243 |
| 401 | 3300031852 | Ga0307410_10000281 | Ga0307410_100002817 | 243 |
| 402 | 3300031852 | Ga0307410_10035705 | Ga0307410_100357054 | 243 |
| 403 | 3300031901 | Ga0307406_10149122 | Ga0307406_101491223 | 243 |
| 404 | 3300031901 | Ga0307406_10229868 | Ga0307406_102298682 | 243 |
| 405 | 3300031903 | Ga0307407_10001856 | Ga0307407_100018563 | 243 |
| 406 | 3300031903 | Ga0307407_10004947 | Ga0307407_100049473 | 243 |
| 407 | 3300031903 | Ga0307407_10209618 | Ga0307407_102096181 | 243 |
| 408 | 3300031911 | Ga0307412_10005872 | Ga0307412_100058723 | 243 |
| 409 | 3300031995 | Ga0307409_100013771 | Ga0307409_1000137712 | 243 |
| 410 | 3300031995 | Ga0307409_100065828 | Ga0307409_1000658282 | 243 |
| 411 | 3300031995 | Ga0307409_100277011 | Ga0307409_1002770112 | 243 |
| 412 | 3300032002 | Ga0307416_100069334 | Ga0307416_1000693344 | 243 |
| 413 | 3300032002 | Ga0307416_100225252 | Ga0307416_1002252523 | 243 |
| 414 | 3300032004 | Ga0307414_10004115 | Ga0307414_100041158 | 243 |
| 415 | 3300032004 | Ga0307414_10008487 | Ga0307414_100084873 | 243 |
| 416 | 3300032004 | Ga0307414_10018719 | Ga0307414_100187192 | 243 |
| 417 | 3300032005 | Ga0307411_10004182 | Ga0307411_100041826 | 243 |
| 418 | 3300032005 | Ga0307411_10012924 | Ga0307411_100129241 | 243 |
| 419 | 3300032005 | Ga0307411_10076900 | Ga0307411_100769003 | 243 |
| 420 | 3300032005 | Ga0307411_10079644 | Ga0307411_100796443 | 243 |
| 421 | 3300032126 | Ga0307415_100272494 | Ga0307415_1002724942 | 243 |
| 422 | 3300035112 | Ga0373932_0041935 | Ga0373932_0041935_178_915 | 243 |
| 423 | 3300035112 | Ga0373932_0045385 | Ga0373932_0045385_46_777 | 243 |
| 424 | 3300037312 | Ga0395899_0000251 | Ga0395899_0000251_59025_59762 | 243 |
| 425 | 3300037312 | Ga0395899_0001062 | Ga0395899_0001062_18490_19227 | 243 |
| 426 | 3300037312 | Ga0395899_0001983 | Ga0395899_0001983_15366_16097 | 243 |
| 427 | 3300037418 | Ga0395900_0000084 | Ga0395900_0000084_142108_142845 | 243 |
| 428 | 3300037418 | Ga0395900_0022623 | Ga0395900_0022623_4516_5247 | 243 |
| 429 | 3300037418 | Ga0395900_0025014 | Ga0395900_0025014_1710_2447 | 243 |
| 430 | 3300037418 | Ga0395900_0479610 | Ga0395900_0479610_195_932 | 243 |
| 431 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_190460_191197 | 243 |
| 432 | 3300037466 | Ga0395898_0002422 | Ga0395898_0002422_2992_3729 | 243 |
| 433 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_406712_407449 | 243 |
| 434 | 3300037471 | Ga0395905_0000762 | Ga0395905_0000762_4472_5209 | 243 |
| 435 | 3300037471 | Ga0395905_0031744 | Ga0395905_0031744_894_1631 | 243 |
| 436 | 3300037471 | Ga0395905_0073303 | Ga0395905_0073303_1707_2444 | 243 |
| 437 | 3300037471 | Ga0395905_0234336 | Ga0395905_0234336_755_1492 | 243 |
| 438 | 3300037471 | Ga0395905_0528582 | Ga0395905_0528582_270_1007 | 243 |
| 439 | 3300037853 | Ga0436364_0322209 | Ga0436364_0322209_876_1607 | 243 |
| 440 | 3300037853 | Ga0436364_0462751 | Ga0436364_0462751_347_1078 | 243 |
| 441 | 3300038443 | Ga0395901_0008794 | Ga0395901_0008794_7454_8191 | 243 |
| 442 | 3300038443 | Ga0395901_0009640 | Ga0395901_0009640_4735_5472 | 243 |
| 443 | 3300038443 | Ga0395901_0069324 | Ga0395901_0069324_2378_3109 | 243 |
| 444 | 3300039437 | Ga0436365_0695304 | Ga0436365_0695304_1480_2217 | 243 |
| 445 | 3300039437 | Ga0436365_1474733 | Ga0436365_1474733_2346_3077 | 243 |
| 446 | 3300039450 | Ga0436363_1509936 | Ga0436363_1509936_668_1399 | 243 |
| 447 | 3300041404 | Ga0439436_0007826 | Ga0439436_0007826_1436_2167 | 243 |
| 448 | 3300041410 | Ga0439461_0000239 | Ga0439461_0000239_5983_6714 | 243 |
| 449 | 3300041410 | Ga0439461_0006785 | Ga0439461_0006785_874_1605 | 243 |
| 450 | 3300041413 | Ga0439465_0000177 | Ga0439465_0000177_5365_6096 | 243 |
| 451 | 3300041413 | Ga0439465_0012688 | Ga0439465_0012688_705_1436 | 243 |
| 452 | 3300041462 | Ga0451806_431010 | Ga0451806_431010_1753_2484 | 243 |
| 453 | 3300041463 | Ga0451804_1038976 | Ga0451804_1038976_660_1391 | 243 |
| 454 | 3300041486 | Ga0451807_1283003 | Ga0451807_1283003_1376_2107 | 243 |
| 455 | 3300041997 | Ga0439431_0000207 | Ga0439431_0000207_8897_9628 | 243 |
| 456 | 3300041997 | Ga0439431_0006020 | Ga0439431_0006020_975_1706 | 243 |
| 457 | 3300042002 | Ga0439442_002361 | Ga0439442_002361_1722_2453 | 243 |
| 458 | 3300042004 | Ga0439445_0000060 | Ga0439445_0000060_5905_6636 | 243 |
| 459 | 3300042006 | Ga0439432_017104 | Ga0439432_017104_239_970 | 243 |
| 460 | 3300042015 | Ga0439462_0000195 | Ga0439462_0000195_5915_6646 | 243 |
| 461 | 3300042156 | Ga0439446_0074395 | Ga0439446_0074395_34_765 | 243 |
| 462 | 3300042435 | Ga0439434_0003840 | Ga0439434_0003840_3129_3860 | 243 |
| 463 | 3300042435 | Ga0439434_0007436 | Ga0439434_0007436_1255_1986 | 243 |
| 464 | 3300042439 | Ga0439464_0044684 | Ga0439464_0044684_271_1008 | 243 |
| 465 | 3300044658 | Ga0466972_0010895 | Ga0466972_0010895_3270_4007 | 243 |
| 466 | 3300044658 | Ga0466972_0068978 | Ga0466972_0068978_422_1159 | 243 |
| 467 | 3300044683 | Ga0466965_0084296 | Ga0466965_0084296_673_1410 | 243 |
| 468 | 3300044693 | Ga0466961_0221293 | Ga0466961_0221293_340_1077 | 243 |
| 469 | 3300044694 | Ga0466963_0014337 | Ga0466963_0014337_1319_2056 | 243 |
| 470 | 3300044694 | Ga0466963_0087573 | Ga0466963_0087573_13_750 | 243 |
| 471 | 3300044719 | Ga0466971_0013927 | Ga0466971_0013927_331_1068 | 243 |
| 472 | 3300044735 | Ga0466968_0042644 | Ga0466968_0042644_242_979 | 243 |
| 473 | 3300044765 | Ga0466970_0050313 | Ga0466970_0050313_760_1497 | 243 |
| 474 | 3300044842 | Ga0466957_0016826 | Ga0466957_0016826_1217_1954 | 243 |
| 475 | 3300044901 | Ga0466960_0003085 | Ga0466960_0003085_4585_5322 | 243 |
| 476 | 3300044901 | Ga0466960_0035587 | Ga0466960_0035587_119_856 | 243 |
| 477 | 3300045836 | Ga0466958_0012119 | Ga0466958_0012119_1473_2210 | 243 |
| 478 | 3300045836 | Ga0466958_0301418 | Ga0466958_0301418_212_949 | 243 |
| 479 | 3300045976 | Ga0466967_0007703 | Ga0466967_0007703_4854_5591 | 243 |
| 480 | 3300045976 | Ga0466967_0050831 | Ga0466967_0050831_567_1304 | 243 |
| 481 | 3300046507 | Ga0495606_0094008 | Ga0495606_0094008_471_1202 | 243 |
| 482 | 3300046525 | Ga0495663_0018160 | Ga0495663_0018160_399_1136 | 243 |
| 483 | 3300046525 | Ga0495663_0024238 | Ga0495663_0024238_295_1032 | 243 |
| 484 | 3300046539 | Ga0495621_0007456 | Ga0495621_0007456_1148_1885 | 243 |
| 485 | 3300046558 | Ga0495633_0130434 | Ga0495633_0130434_291_1028 | 243 |
| 486 | 3300046660 | Ga0495625_0257602 | Ga0495625_0257602_304_1035 | 243 |
| 487 | 3300046692 | Ga0495671_0003910 | Ga0495671_0003910_4778_5509 | 243 |
| 488 | 3300047318 | Ga0495636_0163863 | Ga0495636_0163863_110_847 | 243 |
| 489 | 3300047469 | Ga0495673_0084474 | Ga0495673_0084474_41_775 | 243 |
| 490 | 3300047472 | Ga0495686_0000366 | Ga0495686_0000366_49870_50604 | 243 |
| 491 | 3300047472 | Ga0495686_0000986 | Ga0495686_0000986_27828_28559 | 243 |
| 492 | 3300048903 | Ga0496100_0001542 | Ga0496100_0001542_827_1564 | 243 |
| 493 | 3300048903 | Ga0496100_0029233 | Ga0496100_0029233_2356_3090 | 243 |
| 494 | 3300048904 | Ga0496101_0003699 | Ga0496101_0003699_4346_5083 | 243 |
| 495 | 3300048905 | Ga0496102_0067110 | Ga0496102_0067110_820_1554 | 243 |
| 496 | 3300048905 | Ga0496102_0088970 | Ga0496102_0088970_957_1688 | 243 |
| 497 | 3300048905 | Ga0496102_0156222 | Ga0496102_0156222_1221_1958 | 243 |
| 498 | 3300048906 | Ga0496103_0003725 | Ga0496103_0003725_7630_8364 | 243 |
| 499 | 3300048906 | Ga0496103_0140695 | Ga0496103_0140695_544_1281 | 243 |
| 500 | 3300048907 | Ga0496104_0137687 | Ga0496104_0137687_423_1160 | 243 |
| 501 | 3300048907 | Ga0496104_0853155 | Ga0496104_0853155_26_760 | 243 |
| 502 | 3300048908 | Ga0496105_0171707 | Ga0496105_0171707_434_1171 | 243 |
| 503 | 3300048909 | Ga0496106_0121516 | Ga0496106_0121516_304_1038 | 243 |
| 504 | 3300048910 | Ga0496107_0018156 | Ga0496107_0018156_2022_2759 | 243 |
| 505 | 3300048910 | Ga0496107_0090106 | Ga0496107_0090106_184_918 | 243 |
| 506 | 3300048911 | Ga0496108_0156763 | Ga0496108_0156763_697_1434 | 243 |
| 507 | 3300048912 | Ga0496109_0178660 | Ga0496109_0178660_1139_1876 | 243 |
| 508 | 3300048912 | Ga0496109_0579378 | Ga0496109_0579378_232_969 | 243 |
| 509 | 3300048913 | Ga0496110_0219553 | Ga0496110_0219553_271_1008 | 243 |
| 510 | 3300048914 | Ga0496111_0125943 | Ga0496111_0125943_845_1582 | 243 |
| 511 | 3300048915 | Ga0496112_0105543 | Ga0496112_0105543_1528_2265 | 243 |
| 512 | 3300048917 | Ga0496114_0174873 | Ga0496114_0174873_639_1376 | 243 |
| 513 | 3300048918 | Ga0496115_0003674 | Ga0496115_0003674_45_776 | 243 |
| 514 | 3300048919 | Ga0496116_0121765 | Ga0496116_0121765_574_1308 | 243 |
| 515 | 3300048920 | Ga0496117_0012393 | Ga0496117_0012393_3577_4308 | 243 |
| 516 | 3300048920 | Ga0496117_0047279 | Ga0496117_0047279_1523_2257 | 243 |
| 517 | 3300048920 | Ga0496117_0063203 | Ga0496117_0063203_1192_1923 | 243 |
| 518 | 3300048921 | Ga0496118_0027239 | Ga0496118_0027239_3391_4122 | 243 |
| 519 | 3300048921 | Ga0496118_0098454 | Ga0496118_0098454_144_875 | 243 |
| 520 | 3300048921 | Ga0496118_0116649 | Ga0496118_0116649_781_1512 | 243 |
| 521 | 3300048922 | Ga0496119_0102222 | Ga0496119_0102222_30_761 | 243 |
| 522 | 3300048923 | Ga0496120_0071098 | Ga0496120_0071098_871_1602 | 243 |
| 523 | 3300048923 | Ga0496120_0233981 | Ga0496120_0233981_20_751 | 243 |
| 524 | 3300048924 | Ga0496121_0000650 | Ga0496121_0000650_2494_3228 | 243 |
| 525 | 3300048924 | Ga0496121_0040635 | Ga0496121_0040635_2806_3540 | 243 |
| 526 | 3300048924 | Ga0496121_0048915 | Ga0496121_0048915_597_1328 | 243 |
| 527 | 3300048924 | Ga0496121_0050973 | Ga0496121_0050973_1172_1906 | 243 |
| 528 | 3300048924 | Ga0496121_0126821 | Ga0496121_0126821_478_1209 | 243 |
| 529 | 3300048925 | Ga0496122_0028593 | Ga0496122_0028593_536_1267 | 243 |
| 530 | 3300048925 | Ga0496122_0135922 | Ga0496122_0135922_103_834 | 243 |
| 531 | 3300048926 | Ga0496123_0050545 | Ga0496123_0050545_172_903 | 243 |
| 532 | 3300048926 | Ga0496123_0081779 | Ga0496123_0081779_172_903 | 243 |
| 533 | 3300048926 | Ga0496123_0175105 | Ga0496123_0175105_186_920 | 243 |
| 534 | 3300048927 | Ga0496124_0000129 | Ga0496124_0000129_6831_7562 | 243 |
| 535 | 3300048927 | Ga0496124_0007123 | Ga0496124_0007123_1054_1785 | 243 |
| 536 | 3300048927 | Ga0496124_0113648 | Ga0496124_0113648_156_887 | 243 |
| 537 | 3300048927 | Ga0496124_0166013 | Ga0496124_0166013_925_1659 | 243 |
| 538 | 3300048927 | Ga0496124_0363207 | Ga0496124_0363207_133_864 | 243 |
| 539 | 3300048928 | Ga0496125_0017604 | Ga0496125_0017604_813_1544 | 243 |
| 540 | 3300048928 | Ga0496125_0105320 | Ga0496125_0105320_1117_1848 | 243 |
| 541 | 3300048928 | Ga0496125_0113688 | Ga0496125_0113688_826_1560 | 243 |
| 542 | 3300048928 | Ga0496125_0277712 | Ga0496125_0277712_215_949 | 243 |
| 543 | 3300048929 | Ga0496126_0046922 | Ga0496126_0046922_276_1007 | 243 |
| 544 | 3300048929 | Ga0496126_0077467 | Ga0496126_0077467_1458_2192 | 243 |
| 545 | 3300048929 | Ga0496126_0149598 | Ga0496126_0149598_431_1162 | 243 |
| 546 | 3300049570 | Ga0501033_0140763 | Ga0501033_0140763_755_1489 | 243 |
| 547 | 3300049579 | Ga0501043_0108214 | Ga0501043_0108214_583_1317 | 243 |
| 548 | 3300049581 | Ga0501047_0147011 | Ga0501047_0147011_788_1519 | 243 |
| 549 | 3300049581 | Ga0501047_0191251 | Ga0501047_0191251_358_1125 | 243 |
| 550 | 3300049823 | Ga0501044_0090163 | Ga0501044_0090163_1253_2020 | 243 |
| 551 | 3300053087 | Ga0500643_023449 | Ga0500643_023449_61_792 | 243 |
| 552 | 3300053094 | Ga0500566_0007362 | Ga0500566_0007362_2994_3725 | 243 |
| 553 | 3300053116 | Ga0500592_000050 | Ga0500592_000050_29561_30292 | 243 |
| 554 | 3300053118 | Ga0500594_0001614 | Ga0500594_0001614_581_1312 | 243 |
| 555 | 3300053119 | Ga0500595_015056 | Ga0500595_015056_1156_1887 | 243 |
| 556 | 3300053134 | Ga0500658_0048476 | Ga0500658_0048476_230_961 | 243 |
| 557 | 3300053136 | Ga0500559_0144605 | Ga0500559_0144605_82_816 | 243 |
| 558 | 3300053140 | Ga0500573_0000366 | Ga0500573_0000366_11978_12709 | 243 |
| 559 | 3300053140 | Ga0500573_0170376 | Ga0500573_0170376_43_774 | 243 |
| 560 | 3300053142 | Ga0500577_0061655 | Ga0500577_0061655_404_1135 | 243 |
| 561 | 3300053158 | Ga0500627_0000938 | Ga0500627_0000938_2536_3267 | 243 |
| 562 | 3300053730 | Ga0500645_005027 | Ga0500645_005027_3742_4473 | 243 |
| 563 | 3300061719 | Ga0466962_0005982 | Ga0466962_0005982_3778_4515 | 243 |
| 564 | 2162886007 | SwRhRL2b_contig_1489105 | SwRhRL2b_0114.00005680 | 244 |
| 565 | 3300001904 | JGI24736J21556_1002251 | JGI24736J21556_10022513 | 244 |
| 566 | 3300001915 | JGI24741J21665_1000549 | JGI24741J21665_10005497 | 244 |
| 567 | 3300001979 | JGI24740J21852_10005015 | JGI24740J21852_100050156 | 244 |
| 568 | 3300001990 | JGI24737J22298_10002940 | JGI24737J22298_100029406 | 244 |
| 569 | 3300002067 | JGI24735J21928_10002252 | JGI24735J21928_100022522 | 244 |
| 570 | 3300002067 | JGI24735J21928_10010004 | JGI24735J21928_100100043 | 244 |
| 571 | 3300002077 | JGI24744J21845_10002202 | JGI24744J21845_100022022 | 244 |
| 572 | 3300005289 | Ga0065704_10007250 | Ga0065704_100072503 | 244 |
| 573 | 3300005289 | Ga0065704_10072419 | Ga0065704_100724197 | 244 |
| 574 | 3300005331 | Ga0070670_100050727 | Ga0070670_1000507272 | 244 |
| 575 | 3300005339 | Ga0070660_100054688 | Ga0070660_1000546883 | 244 |
| 576 | 3300005353 | Ga0070669_100037676 | Ga0070669_1000376763 | 244 |
| 577 | 3300005354 | Ga0070675_100001516 | Ga0070675_10000151615 | 244 |
| 578 | 3300005355 | Ga0070671_100061130 | Ga0070671_1000611302 | 244 |
| 579 | 3300005356 | Ga0070674_100021920 | Ga0070674_1000219204 | 244 |
| 580 | 3300005366 | Ga0070659_100204838 | Ga0070659_1002048382 | 244 |
| 581 | 3300005455 | Ga0070663_100004890 | Ga0070663_1000048901 | 244 |
| 582 | 3300005456 | Ga0070678_100004810 | Ga0070678_1000048103 | 244 |
| 583 | 3300005539 | Ga0068853_100048683 | Ga0068853_1000486833 | 244 |
| 584 | 3300005543 | Ga0070672_100059421 | Ga0070672_1000594213 | 244 |
| 585 | 3300005564 | Ga0070664_100044891 | Ga0070664_1000448912 | 244 |
| 586 | 3300005577 | Ga0068857_100003501 | Ga0068857_1000035012 | 244 |
| 587 | 3300005618 | Ga0068864_100503707 | Ga0068864_1005037072 | 244 |
| 588 | 3300005834 | Ga0068851_10103684 | Ga0068851_101036842 | 244 |
| 589 | 3300005842 | Ga0068858_100243409 | Ga0068858_1002434093 | 244 |
| 590 | 3300006042 | Ga0075368_10000033 | Ga0075368_1000003313 | 244 |
| 591 | 3300006178 | Ga0075367_10000481 | Ga0075367_1000048112 | 244 |
| 592 | 3300009011 | Ga0105251_10017044 | Ga0105251_100170444 | 244 |
| 593 | 3300009093 | Ga0105240_10873625 | Ga0105240_108736251 | 244 |
| 594 | 3300009174 | Ga0105241_10008072 | Ga0105241_100080722 | 244 |
| 595 | 3300009545 | Ga0105237_10013028 | Ga0105237_100130284 | 244 |
| 596 | 3300009553 | Ga0105249_10325529 | Ga0105249_103255292 | 244 |
| 597 | 3300009978 | Ga0105148_100202 | Ga0105148_1002028 | 244 |
| 598 | 3300013100 | Ga0157373_10389734 | Ga0157373_103897341 | 244 |
| 599 | 3300013102 | Ga0157371_10177025 | Ga0157371_101770252 | 244 |
| 600 | 3300013105 | Ga0157369_10816810 | Ga0157369_108168101 | 244 |
| 601 | 3300013307 | Ga0157372_10404374 | Ga0157372_104043741 | 244 |
| 602 | 3300014326 | Ga0157380_10034756 | Ga0157380_100347562 | 244 |
| 603 | 3300025321 | Ga0207656_10049933 | Ga0207656_100499332 | 244 |
| 604 | 3300025904 | Ga0207647_10104017 | Ga0207647_101040172 | 244 |
| 605 | 3300025909 | Ga0207705_10000027 | Ga0207705_1000002768 | 244 |
| 606 | 3300025911 | Ga0207654_10049270 | Ga0207654_100492702 | 244 |
| 607 | 3300025913 | Ga0207695_10024580 | Ga0207695_100245807 | 244 |
| 608 | 3300025914 | Ga0207671_10203960 | Ga0207671_102039602 | 244 |
| 609 | 3300025919 | Ga0207657_10065116 | Ga0207657_100651163 | 244 |
| 610 | 3300025920 | Ga0207649_10352238 | Ga0207649_103522381 | 244 |
| 611 | 3300025924 | Ga0207694_10039527 | Ga0207694_100395273 | 244 |
| 612 | 3300025925 | Ga0207650_10033961 | Ga0207650_100339612 | 244 |
| 613 | 3300025926 | Ga0207659_10059191 | Ga0207659_100591912 | 244 |
| 614 | 3300025931 | Ga0207644_10067193 | Ga0207644_100671931 | 244 |
| 615 | 3300025931 | Ga0207644_10073678 | Ga0207644_100736782 | 244 |
| 616 | 3300025932 | Ga0207690_10205312 | Ga0207690_102053122 | 244 |
| 617 | 3300025933 | Ga0207706_10043654 | Ga0207706_100436542 | 244 |
| 618 | 3300025937 | Ga0207669_10055566 | Ga0207669_100555663 | 244 |
| 619 | 3300025945 | Ga0207679_10196654 | Ga0207679_101966542 | 244 |
| 620 | 3300025949 | Ga0207667_10277086 | Ga0207667_102770862 | 244 |
| 621 | 3300025961 | Ga0207712_10134447 | Ga0207712_101344472 | 244 |
| 622 | 3300025981 | Ga0207640_10228286 | Ga0207640_102282861 | 244 |
| 623 | 3300026067 | Ga0207678_10001799 | Ga0207678_100017997 | 244 |
| 624 | 3300026078 | Ga0207702_10002022 | Ga0207702_100020227 | 244 |
| 625 | 3300026095 | Ga0207676_10646159 | Ga0207676_106461592 | 244 |
| 626 | 3300026116 | Ga0207674_10010820 | Ga0207674_1001082011 | 244 |
| 627 | 3300026121 | Ga0207683_10010089 | Ga0207683_100100896 | 244 |
| 628 | 3300026142 | Ga0207698_10130366 | Ga0207698_101303662 | 244 |
| 629 | 3300027866 | Ga0209813_10000041 | Ga0209813_1000004126 | 244 |
| 630 | 3300028379 | Ga0268266_10376461 | Ga0268266_103764612 | 244 |
| 631 | 3300031548 | Ga0307408_100036711 | Ga0307408_1000367114 | 244 |
| 632 | 3300031548 | Ga0307408_100453026 | Ga0307408_1004530262 | 244 |
| 633 | 3300031731 | Ga0307405_10038560 | Ga0307405_100385603 | 244 |
| 634 | 3300031852 | Ga0307410_10019341 | Ga0307410_100193414 | 244 |
| 635 | 3300031901 | Ga0307406_10020481 | Ga0307406_100204811 | 244 |
| 636 | 3300031911 | Ga0307412_10000453 | Ga0307412_1000045321 | 244 |
| 637 | 3300031911 | Ga0307412_10132167 | Ga0307412_101321672 | 244 |
| 638 | 3300032002 | Ga0307416_100009701 | Ga0307416_1000097017 | 244 |
| 639 | 3300032002 | Ga0307416_100033727 | Ga0307416_1000337274 | 244 |
| 640 | 3300032004 | Ga0307414_10000248 | Ga0307414_100002488 | 244 |
| 641 | 3300032004 | Ga0307414_10373356 | Ga0307414_103733562 | 244 |
| 642 | 3300032005 | Ga0307411_10021318 | Ga0307411_100213183 | 244 |
| 643 | 3300032005 | Ga0307411_10106071 | Ga0307411_101060712 | 244 |
| 644 | 3300046452 | Ga0495617_029351 | Ga0495617_029351_831_1568 | 244 |
| 645 | 3300046453 | Ga0495627_006278 | Ga0495627_006278_1731_2465 | 244 |
| 646 | 3300046453 | Ga0495627_051928 | Ga0495627_051928_373_1107 | 244 |
| 647 | 3300046506 | Ga0495583_0001401 | Ga0495583_0001401_14714_15457 | 244 |
| 648 | 3300046512 | Ga0495610_0000206 | Ga0495610_0000206_23232_23966 | 244 |
| 649 | 3300046512 | Ga0495610_0049660 | Ga0495610_0049660_1116_1850 | 244 |
| 650 | 3300046513 | Ga0495616_0000189 | Ga0495616_0000189_13169_13903 | 244 |
| 651 | 3300046519 | Ga0495632_0001899 | Ga0495632_0001899_15171_15908 | 244 |
| 652 | 3300046520 | Ga0495637_0029360 | Ga0495637_0029360_414_1148 | 244 |
| 653 | 3300046522 | Ga0495643_0000162 | Ga0495643_0000162_15521_16255 | 244 |
| 654 | 3300046524 | Ga0495648_0000038 | Ga0495648_0000038_140606_141349 | 244 |
| 655 | 3300046530 | Ga0495654_0180699 | Ga0495654_0180699_133_867 | 244 |
| 656 | 3300046557 | Ga0495622_0093923 | Ga0495622_0093923_234_968 | 244 |
| 657 | 3300046691 | Ga0495670_0000028 | Ga0495670_0000028_19659_20504 | 244 |
| 658 | 3300046692 | Ga0495671_0000034 | Ga0495671_0000034_128155_128898 | 244 |
| 659 | 3300046692 | Ga0495671_0000062 | Ga0495671_0000062_15521_16255 | 244 |
| 660 | 3300047469 | Ga0495673_0000013 | Ga0495673_0000013_200856_201599 | 244 |
| 661 | 3300047470 | Ga0495681_0000106 | Ga0495681_0000106_35996_36730 | 244 |
| 662 | 3300047470 | Ga0495681_0008636 | Ga0495681_0008636_55_789 | 244 |
| 663 | 3300047472 | Ga0495686_0071813 | Ga0495686_0071813_907_1641 | 244 |
| 664 | 3300048905 | Ga0496102_0270111 | Ga0496102_0270111_40_774 | 244 |
| 665 | 3300048909 | Ga0496106_0205599 | Ga0496106_0205599_150_884 | 244 |
| 666 | 3300048911 | Ga0496108_0013686 | Ga0496108_0013686_598_1332 | 244 |
| 667 | 3300048911 | Ga0496108_0032889 | Ga0496108_0032889_3103_3837 | 244 |
| 668 | 3300048913 | Ga0496110_0016041 | Ga0496110_0016041_4804_5538 | 244 |
| 669 | 3300048913 | Ga0496110_0023804 | Ga0496110_0023804_2146_2880 | 244 |
| 670 | 3300048914 | Ga0496111_0022461 | Ga0496111_0022461_1311_2045 | 244 |
| 671 | 3300048916 | Ga0496113_0015706 | Ga0496113_0015706_3747_4481 | 244 |
| 672 | 3300048920 | Ga0496117_0014638 | Ga0496117_0014638_3631_4365 | 244 |
| 673 | 3300048921 | Ga0496118_0163339 | Ga0496118_0163339_440_1174 | 244 |
| 674 | 3300048924 | Ga0496121_0000175 | Ga0496121_0000175_96850_97584 | 244 |
| 675 | 3300048925 | Ga0496122_0026729 | Ga0496122_0026729_2217_2951 | 244 |
| 676 | 3300048927 | Ga0496124_0006227 | Ga0496124_0006227_4582_5316 | 244 |
| 677 | 3300048927 | Ga0496124_0089345 | Ga0496124_0089345_933_1667 | 244 |
| 678 | 3300048927 | Ga0496124_0214970 | Ga0496124_0214970_81_815 | 244 |
| 679 | 3300048927 | Ga0496124_0239613 | Ga0496124_0239613_187_921 | 244 |
| 680 | 3300048928 | Ga0496125_0000445 | Ga0496125_0000445_35454_36188 | 244 |
| 681 | 3300048928 | Ga0496125_0007177 | Ga0496125_0007177_7612_8346 | 244 |
| 682 | 3300048928 | Ga0496125_0142321 | Ga0496125_0142321_94_828 | 244 |
| 683 | 3300048929 | Ga0496126_0202533 | Ga0496126_0202533_793_1527 | 244 |
| 684 | 3300049571 | Ga0501034_0069690 | Ga0501034_0069690_413_1147 | 244 |
| 685 | 3300049658 | Ga0501211_005276 | Ga0501211_005276_161_895 | 244 |
| 686 | 3300049663 | Ga0501223_000066 | Ga0501223_000066_22715_23449 | 244 |
| 687 | 3300049663 | Ga0501223_000317 | Ga0501223_000317_9065_9814 | 244 |
| 688 | 3300049664 | Ga0501224_000076 | Ga0501224_000076_462_1211 | 244 |
| 689 | 3300049668 | Ga0501233_000558 | Ga0501233_000558_268_1002 | 244 |
| 690 | 3300049669 | Ga0501235_003738 | Ga0501235_003738_2243_2977 | 244 |
| 691 | 3300049669 | Ga0501235_041828 | Ga0501235_041828_165_899 | 244 |
| 692 | 3300049705 | Ga0501225_0000137 | Ga0501225_0000137_9224_9958 | 244 |
| 693 | 3300049705 | Ga0501225_0000228 | Ga0501225_0000228_14137_14886 | 244 |
| 694 | 3300049705 | Ga0501225_0008682 | Ga0501225_0008682_1308_2042 | 244 |
| 695 | 3300049707 | Ga0501234_000767 | Ga0501234_000767_367_1116 | 244 |
| 696 | 3300049853 | Ga0501226_000183 | Ga0501226_000183_9065_9814 | 244 |
| 697 | 3300050494 | nmdc:mga06z11_9_c1 | nmdc:mga06z11_9_c1_29821_30555 | 244 |
| 698 | 3300050495 | nmdc:mga04h51_12_c1 | nmdc:mga04h51_12_c1_79428_80162 | 244 |
| 699 | 3300053108 | Ga0500562_029007 | Ga0500562_029007_567_1301 | 244 |
| 700 | 3300053153 | Ga0500616_0105036 | Ga0500616_0105036_547_1329 | 244 |
| 701 | 3300053157 | Ga0500624_000084 | Ga0500624_000084_40735_41469 | 244 |
| 702 | 3300053158 | Ga0500627_0000452 | Ga0500627_0000452_1585_2319 | 244 |
| 703 | iso_pu_bacteria | 2775507255 | 2778124399 | 244 |
| 704 | iso_pu_bacteria | 2984564862 | 2984568279 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3q8d-assembly1.cif.gz_A | e. coli reco complex with ssb c-terminus | 0.8049 | 5 | 238 |
| 6cqm-assembly2.cif.gz_H-3 | crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) | 0.7947 | 3 | 77 |
| 3q8d-assembly1.cif.gz_A | e. coli reco complex with ssb c-terminus | 0.789 | 5 | 238 |
| 1h9m-assembly1.cif.gz_A | two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound | 0.7709 | 4 | 61 |
| 3m4q-assembly1.cif.gz_B | entamoeba histolytica asparaginyl-trna synthetase (asnrs) | 0.7581 | 2 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q8dB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8446 | 5 | 74 | 2.40.50.140 |
| 4jcvF01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8363 | 4 | 81 | 2.40.50.140 |
| af_P9WHI5_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8349 | 1 | 80 | 2.40.50.140 |
| af_P9WHI5_1_82_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8074 | 1 | 80 | 2.40.50.140 |
| 4jcvF01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8057 | 4 | 81 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A6D315-F1-model_v4 | DNA recombination protein RecO | 0.9881 | 93 | 244 |
GO:0006281
GO:0006310 |
| AF-A5VEW5-F1-model_v4 | DNA repair protein RecO (Recombination protein O) | 0.9838 | 2 | 241 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-A0A5A7N7C2-F1-model_v4 | DNA replication/recombination mediator RecO N-terminal domain-containing protein | 0.9793 | 2 | 123 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-A0A355BZV3-F1-model_v4 | DNA repair protein RecO | 0.9737 | 2 | 124 |
GO:0006302
GO:0006310 GO:0043590 |
| AF-J3A9D5-F1-model_v4 | Recombinational DNA repair protein (RecF pathway) | 0.9725 | 2 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar