F476374

General Info

Members Datasets Scaffolds Average Seq Length
704 326 688 244

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0000028|Ga0495670_0000028_19659_20504
Length 281
Sequence MLSASCDAHWSDVCCLTGFPQAGKAPVAFRGAIPYIGAMHLRAEAIILSVRAHGEHGAVVRALTESDGLQPGYVRGGRSRALRPVLQPANLVLGEWRSRTEDQLAGLTVELIHSRAPMFGEPLPAAAFEWATALTAATLPDAQPYPRLYSALDGVLAAIEAAPAARGWAVALVRYELLLLAELGFGLDLEHCAATGRNDDLAFVSPKSGIAVSRLGAEGYEKRLLALPRFLFEGGEADWDDILAGLKLTGHFLERDLLIGKGADTLAARARLVDRLLRAVA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
5 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
6 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
7 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
8 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
9 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
10 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
11 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
12 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
13 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
14 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
15 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
16 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
17 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
29 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
222 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
254 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
297 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
298 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
299 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
300 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
301 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
302 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
315 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
316 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
321 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.59
Metatranscriptomes 0.14
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 8.95
Nodule 0
Rhizoplane 4.97
Rhizosphere 76.28
Stem 0
Stem Tuber 0.14
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1489105 2162886007 Bacteria 7422
2 JGI24736J21556_1002251 3300001904 Bacteria 3412
3 JGI24741J21665_1000549 3300001915 Bacteria 11447
4 JGI24752J21851_1001710 3300001976 Bacteria 2943
5 JGI24740J21852_10004963 3300001979 Bacteria 5657
6 JGI24740J21852_10005015 3300001979 Bacteria 5624
7 JGI24739J22299_10011325 3300001989 Bacteria 3294
8 JGI24737J22298_10002940 3300001990 Bacteria 6039
9 JGI24737J22298_10005153 3300001990 Bacteria 4525
10 JGI24735J21928_10001689 3300002067 Bacteria 7795
11 JGI24735J21928_10002252 3300002067 Bacteria 6743
12 JGI24735J21928_10003032 3300002067 Bacteria 5764
13 JGI24735J21928_10010004 3300002067 Bacteria 3035
14 JGI24735J21928_10015767 3300002067 Bacteria 2352
15 JGI24735J21928_10050673 3300002067 Bacteria 1199
16 JGI24750J21931_1000042 3300002070 Bacteria 16868
17 JGI24748J21848_1000063 3300002074 Bacteria 40664
18 JGI24738J21930_10001001 3300002075 Bacteria 8087
19 JGI24738J21930_10001487 3300002075 Bacteria 6511
20 JGI24744J21845_10002202 3300002077 Bacteria 3961
21 JGI24034J26672_10000007 3300002239 Bacteria 224370
22 JGI25150J39212_1002132 3300002774 Bacteria 5113
23 JGI25165J46597_1000145 3300003214 Bacteria 116948
24 JGI25153J46596_10000028 3300003215 Bacteria 209842
25 rootH2_10161563 3300003320 Bacteria 1182
26 rootH2_10235635 3300003320 Bacteria 2669
27 rootL2_10107312 3300003322 Bacteria 1065
28 rootH1_10190613 3300003323 Bacteria 1084
29 Ga0055526_1000478 3300003771 Bacteria 31736
30 Ga0055537_1001154 3300003773 Bacteria 11291
31 Ga0055524_1000457 3300003775 Bacteria 33415
32 Ga0055530_10041505 3300003791 Bacteria 1122
33 Ga0055540_1001446 3300003792 Bacteria 14141
34 Ga0055540_1001525 3300003792 Bacteria 13634
35 Ga0055531_10000384 3300003794 Bacteria 42713
36 Ga0065165_1002862 3300005262 Bacteria 13339
37 Ga0065165_1003940 3300005262 Bacteria 9774
38 Ga0065165_1031534 3300005262 Bacteria 1674
39 Ga0065165_1044517 3300005262 Bacteria 1298
40 Ga0065704_10007250 3300005289 Bacteria 4185
41 Ga0065704_10072419 3300005289 Bacteria 8555
42 Ga0065707_10082875 3300005295 Bacteria 11637
43 Ga0070658_10000033 3300005327 Bacteria 147380
44 Ga0070658_10037857 3300005327 Bacteria 3889
45 Ga0070658_10160501 3300005327 Bacteria 1886
46 Ga0070676_10411414 3300005328 Bacteria 943
47 Ga0070676_10503058 3300005328 Bacteria 860
48 Ga0070690_100000110 3300005330 Bacteria 42574
49 Ga0070690_100019099 3300005330 Bacteria 4153
50 Ga0070670_100000075 3300005331 Bacteria 97494
51 Ga0070670_100050727 3300005331 Bacteria 3565
52 Ga0070670_100085590 3300005331 Bacteria 2708
53 Ga0070670_100111155 3300005331 Bacteria 2361
54 Ga0070670_100169856 3300005331 Bacteria 1891
55 Ga0068869_100191317 3300005334 Bacteria 1609
56 Ga0070666_10000417 3300005335 Bacteria 26409
57 Ga0070666_10003441 3300005335 Bacteria 9590
58 Ga0070660_100002857 3300005339 Bacteria 11892
59 Ga0070660_100011482 3300005339 Bacteria 6296
60 Ga0070660_100054688 3300005339 Bacteria 3083
61 Ga0070660_100063008 3300005339 Bacteria 2882
62 Ga0070660_100073995 3300005339 Bacteria 2665
63 Ga0070660_100090135 3300005339 Bacteria 2417
64 Ga0070660_100092582 3300005339 Bacteria 2386
65 Ga0070660_100135012 3300005339 Bacteria 1977
66 Ga0070660_100173181 3300005339 Bacteria 1744
67 Ga0070661_100130953 3300005344 Bacteria 1884
68 Ga0070661_100199930 3300005344 Bacteria 1527
69 Ga0070661_100254965 3300005344 Bacteria 1355
70 Ga0070661_100274167 3300005344 Bacteria 1307
71 Ga0070692_10018735 3300005345 Bacteria 3333
72 Ga0070668_100089004 3300005347 Bacteria 2431
73 Ga0070669_100000332 3300005353 Bacteria 36750
74 Ga0070669_100037676 3300005353 Bacteria 3508
75 Ga0070675_100001516 3300005354 Bacteria 17164
76 Ga0070675_100146846 3300005354 Bacteria 2020
77 Ga0070671_100022882 3300005355 Bacteria 5107
78 Ga0070671_100055455 3300005355 Bacteria 3297
79 Ga0070671_100061130 3300005355 Bacteria 3137
80 Ga0070671_100073726 3300005355 Bacteria 2851
81 Ga0070671_100099761 3300005355 Bacteria 2436
82 Ga0070674_100021920 3300005356 Bacteria 4112
83 Ga0070674_100092379 3300005356 Bacteria 2187
84 Ga0070673_100002629 3300005364 Bacteria 10985
85 Ga0070659_100002258 3300005366 Bacteria 13727
86 Ga0070659_100022028 3300005366 Bacteria 4862
87 Ga0070659_100057141 3300005366 Bacteria 3076
88 Ga0070659_100062359 3300005366 Bacteria 2947
89 Ga0070659_100115132 3300005366 Bacteria 2173
90 Ga0070659_100181006 3300005366 Bacteria 1730
91 Ga0070659_100204838 3300005366 Bacteria 1625
92 Ga0070659_100271573 3300005366 Bacteria 1409
93 Ga0070659_100433901 3300005366 Bacteria 1112
94 Ga0070659_100676045 3300005366 Bacteria 891
95 Ga0070667_100000039 3300005367 Bacteria 170228
96 Ga0070667_100259304 3300005367 Bacteria 1556
97 Ga0070663_100004890 3300005455 Bacteria 7910
98 Ga0070663_100132933 3300005455 Bacteria 1891
99 Ga0070663_100181416 3300005455 Bacteria 1633
100 Ga0070678_100001866 3300005456 Bacteria 11366
101 Ga0070678_100004810 3300005456 Bacteria 7707
102 Ga0070662_100006444 3300005457 Bacteria 7564
103 Ga0070662_100011803 3300005457 Bacteria 5773
104 Ga0070662_100168906 3300005457 Bacteria 1716
105 Ga0070681_10102501 3300005458 Bacteria 2807
106 Ga0068867_100005781 3300005459 Bacteria 8775
107 Ga0068867_100006557 3300005459 Bacteria 8220
108 Ga0070685_10000036 3300005466 Bacteria 80641
109 Ga0068853_100008364 3300005539 Bacteria 8308
110 Ga0068853_100048683 3300005539 Bacteria 3642
111 Ga0068853_100552448 3300005539 Bacteria 1091
112 Ga0068853_100614750 3300005539 Bacteria 1033
113 Ga0068853_100842060 3300005539 Unclassified 879
114 Ga0070672_100018490 3300005543 Bacteria 5039
115 Ga0070672_100059421 3300005543 Bacteria 3008
116 Ga0070672_100250539 3300005543 Bacteria 1491
117 Ga0070686_100000045 3300005544 Bacteria 101988
118 Ga0070693_100096773 3300005547 Bacteria 1790
119 Ga0070665_100000042 3300005548 Bacteria 292582
120 Ga0070665_100138494 3300005548 Bacteria 2437
121 Ga0070665_100139592 3300005548 Bacteria 2427
122 Ga0068855_100117343 3300005563 Bacteria 3049
123 Ga0068855_100131931 3300005563 Bacteria 2853
124 Ga0068855_100526948 3300005563 Bacteria 1281
125 Ga0070664_100014603 3300005564 Bacteria 6408
126 Ga0070664_100044891 3300005564 Bacteria 3732
127 Ga0068857_100003501 3300005577 Bacteria 13108
128 Ga0068857_100018632 3300005577 Bacteria 6092
129 Ga0068857_100235716 3300005577 Bacteria 1674
130 Ga0068857_100244914 3300005577 Bacteria 1642
131 Ga0068857_100392160 3300005577 Bacteria 1291
132 Ga0068854_100016231 3300005578 Bacteria 4959
133 Ga0068854_100025435 3300005578 Bacteria 4062
134 Ga0068854_100067438 3300005578 Bacteria 2607
135 Ga0068856_100016269 3300005614 Bacteria 7197
136 Ga0068856_100036758 3300005614 Bacteria 4802
137 Ga0068856_100064590 3300005614 Bacteria 3617
138 Ga0068856_100246893 3300005614 Bacteria 1800
139 Ga0068852_100068729 3300005616 Bacteria 3102
140 Ga0068852_100199080 3300005616 Bacteria 1895
141 Ga0068852_100454952 3300005616 Bacteria 1268
142 Ga0068852_101093151 3300005616 Bacteria 817
143 Ga0068859_100005488 3300005617 Bacteria 12913
144 Ga0068859_100022537 3300005617 Bacteria 6316
145 Ga0068864_100000016 3300005618 Bacteria 292454
146 Ga0068864_100157801 3300005618 Bacteria 2060
147 Ga0068864_100503707 3300005618 Bacteria 1165
148 Ga0068861_100000321 3300005719 Bacteria 26985
149 Ga0068861_100000965 3300005719 Bacteria 17524
150 Ga0068851_10008938 3300005834 Bacteria 4646
151 Ga0068851_10027735 3300005834 Bacteria 2792
152 Ga0068851_10103684 3300005834 Bacteria 1511
153 Ga0068863_100000033 3300005841 Bacteria 170238
154 Ga0068863_100000280 3300005841 Bacteria 52729
155 Ga0068863_100007192 3300005841 Bacteria 10917
156 Ga0068863_100019160 3300005841 Bacteria 6550
157 Ga0068858_100007900 3300005842 Bacteria 10254
158 Ga0068858_100069059 3300005842 Bacteria 3275
159 Ga0068858_100243409 3300005842 Bacteria 1707
160 Ga0068860_100000182 3300005843 Bacteria 100888
161 Ga0068860_100112898 3300005843 Bacteria 2598
162 Ga0068862_100000040 3300005844 Bacteria 167832
163 Ga0068862_100000308 3300005844 Bacteria 53687
164 Ga0068862_100009087 3300005844 Bacteria 8225
165 Ga0068862_100266217 3300005844 Bacteria 1566
166 Ga0068862_100361141 3300005844 Bacteria 1350
167 Ga0081455_10160295 3300005937 Bacteria 1725
168 Ga0075368_10000033 3300006042 Bacteria 32184
169 Ga0075367_10000481 3300006178 Bacteria 14919
170 Ga0097621_100048516 3300006237 Bacteria 3445
171 Ga0075370_10066614 3300006353 Bacteria 2055
172 Ga0068871_100562537 3300006358 Bacteria 1034
173 Ga0075430_100059109 3300006846 Bacteria 3222
174 Ga0075431_100151201 3300006847 Bacteria 2390
175 Ga0075431_100366551 3300006847 Bacteria 1446
176 Ga0075429_100161451 3300006880 Bacteria 1963
177 Ga0068865_100004177 3300006881 Bacteria 8697
178 Ga0097620_100005488 3300006931 Bacteria 12913
179 Ga0097620_100022537 3300006931 Bacteria 6316
180 Ga0105251_10001444 3300009011 Bacteria 20434
181 Ga0105251_10017044 3300009011 Bacteria 3903
182 Ga0105240_10007666 3300009093 Bacteria 15628
183 Ga0105240_10026155 3300009093 Bacteria 7658
184 Ga0105240_10098942 3300009093 Bacteria 3551
185 Ga0105240_10128458 3300009093 Bacteria 3043
186 Ga0105240_10873625 3300009093 Bacteria 969
187 Ga0105245_10001867 3300009098 Bacteria 19148
188 Ga0105247_10214021 3300009101 Bacteria 1301
189 Ga0114129_10841433 3300009147 Bacteria 1167
190 Ga0105243_10104131 3300009148 Bacteria 2361
191 Ga0105241_10008072 3300009174 Bacteria 7745
192 Ga0105241_10217538 3300009174 Bacteria 1604
193 Ga0105242_10064796 3300009176 Bacteria 3013
194 Ga0105248_10000021 3300009177 Bacteria 276159
195 Ga0105248_10124883 3300009177 Bacteria 2903
196 Ga0105248_10394403 3300009177 Bacteria 1558
197 Ga0105248_10982508 3300009177 Bacteria 954
198 Ga0105237_10009418 3300009545 Bacteria 10463
199 Ga0105237_10013028 3300009545 Bacteria 8731
200 Ga0105237_10050016 3300009545 Bacteria 4201
201 Ga0105237_10054292 3300009545 Bacteria 4015
202 Ga0105238_10065766 3300009551 Bacteria 3627
203 Ga0105238_10120716 3300009551 Bacteria 2600
204 Ga0105238_10421674 3300009551 Bacteria 1329
205 Ga0105249_10000012 3300009553 Bacteria 292640
206 Ga0105249_10002603 3300009553 Bacteria 15632
207 Ga0105249_10325529 3300009553 Bacteria 1549
208 Ga0105249_10807819 3300009553 Bacteria 1002
209 Ga0105148_100202 3300009978 Bacteria 8692
210 Ga0105239_10000461 3300010375 Bacteria 59449
211 Ga0105246_10176826 3300011119 Bacteria 1640
212 Ga0157373_10121323 3300013100 Bacteria 1837
213 Ga0157373_10389734 3300013100 Bacteria 997
214 Ga0157373_10492926 3300013100 Bacteria 884
215 Ga0157371_10085604 3300013102 Bacteria 2233
216 Ga0157371_10149242 3300013102 Unclassified 1667
217 Ga0157371_10169826 3300013102 Bacteria 1558
218 Ga0157371_10177025 3300013102 Bacteria 1525
219 Ga0157370_10000008 3300013104 Bacteria 240668
220 Ga0157370_10002308 3300013104 Bacteria 23086
221 Ga0157370_10024209 3300013104 Bacteria 6016
222 Ga0157369_10031631 3300013105 Bacteria 5825
223 Ga0157369_10112395 3300013105 Bacteria 2893
224 Ga0157369_10816810 3300013105 Bacteria 957
225 Ga0157374_10004197 3300013296 Bacteria 12105
226 Ga0157374_10067557 3300013296 Bacteria 3361
227 Ga0157374_10372050 3300013296 Bacteria 1422
228 Ga0163162_10096754 3300013306 Bacteria 3040
229 Ga0163162_10202484 3300013306 Bacteria 2114
230 Ga0163162_10204173 3300013306 Bacteria 2105
231 Ga0157372_10018134 3300013307 Bacteria 7567
232 Ga0157372_10404374 3300013307 Bacteria 1591
233 Ga0163163_10081360 3300014325 Bacteria 3241
234 Ga0163163_10120063 3300014325 Bacteria 2662
235 Ga0163163_10159477 3300014325 Bacteria 2301
236 Ga0157380_10000440 3300014326 Bacteria 25347
237 Ga0157380_10034756 3300014326 Bacteria 3890
238 Ga0157379_10003144 3300014968 Bacteria 13972
239 Ga0157379_10036117 3300014968 Bacteria 4407
240 Ga0157379_10121240 3300014968 Bacteria 2352
241 Ga0157376_10130417 3300014969 Bacteria 2242
242 Ga0163161_10000202 3300017792 Bacteria 54518
243 Ga0163161_10017029 3300017792 Bacteria 5082
244 Ga0163161_10355841 3300017792 Bacteria 1165
245 Ga0163161_10406912 3300017792 Unclassified 1092
246 Ga0206353_11760290 3300020082 Bacteria 11326
247 Ga0213876_10033404 3300021384 Bacteria 2713
248 Ga0213875_10000721 3300021388 Bacteria 25266
249 Ga0207672_1001024 3300025223 Bacteria 2658
250 Ga0207427_100545 3300025231 Bacteria 19253
251 Ga0207425_1000005 3300025245 Bacteria 900502
252 Ga0207425_1004365 3300025245 Bacteria 4275
253 Ga0209026_1002632 3300025250 Bacteria 6543
254 Ga0209148_1000338 3300025254 Bacteria 62960
255 Ga0209129_1000825 3300025258 Bacteria 19506
256 Ga0209233_1000207 3300025261 Bacteria 117152
257 Ga0209565_1000007 3300025263 Bacteria 784361
258 Ga0209565_1000056 3300025263 Bacteria 200189
259 Ga0209455_1000480 3300025272 Bacteria 29756
260 Ga0209455_1018960 3300025272 Bacteria 1401
261 Ga0209673_1001497 3300025273 Bacteria 21703
262 Ga0209025_1000296 3300025294 Bacteria 111440
263 Ga0209758_1000002 3300025297 Bacteria 1400310
264 Ga0209758_1002418 3300025297 Bacteria 19122
265 Ga0209758_1066833 3300025297 Bacteria 1153
266 Ga0209050_1000005 3300025298 Bacteria 1557793
267 Ga0209050_1000196 3300025298 Bacteria 135678
268 Ga0209050_1008839 3300025298 Bacteria 5283
269 Ga0209050_1016183 3300025298 Bacteria 3071
270 Ga0209256_1000009 3300025299 Bacteria 922071
271 Ga0209051_1000153 3300025303 Bacteria 131166
272 Ga0209257_1000228 3300025304 Bacteria 133390
273 Ga0209257_1003469 3300025304 Bacteria 13472
274 Ga0209257_1004247 3300025304 Bacteria 11310
275 Ga0209257_1004769 3300025304 Bacteria 10121
276 Ga0207697_10016147 3300025315 Bacteria 3079
277 Ga0207656_10049933 3300025321 Bacteria 1805
278 Ga0207713_1007763 3300025735 Bacteria 6265
279 Ga0207710_10166100 3300025900 Unclassified 1077
280 Ga0207688_10032718 3300025901 Bacteria 2875
281 Ga0207680_10000012 3300025903 Bacteria 293810
282 Ga0207647_10001622 3300025904 Bacteria 17295
283 Ga0207647_10104017 3300025904 Bacteria 1683
284 Ga0207647_10135199 3300025904 Bacteria 1447
285 Ga0207705_10000002 3300025909 Bacteria 2046852
286 Ga0207705_10000027 3300025909 Bacteria 248863
287 Ga0207705_10007714 3300025909 Bacteria 7913
288 Ga0207705_10011424 3300025909 Bacteria 6428
289 Ga0207705_10042116 3300025909 Bacteria 3278
290 Ga0207705_10117758 3300025909 Bacteria 1968
291 Ga0207705_10192064 3300025909 Bacteria 1545
292 Ga0207705_10194448 3300025909 Bacteria 1535
293 Ga0207654_10001661 3300025911 Bacteria 11622
294 Ga0207654_10049270 3300025911 Bacteria 2415
295 Ga0207695_10000641 3300025913 Bacteria 69705
296 Ga0207695_10006576 3300025913 Bacteria 15034
297 Ga0207695_10024580 3300025913 Bacteria 6771
298 Ga0207695_10077765 3300025913 Bacteria 3369
299 Ga0207695_10098637 3300025913 Bacteria 2921
300 Ga0207695_10134453 3300025913 Bacteria 2427
301 Ga0207671_10002738 3300025914 Bacteria 18433
302 Ga0207671_10203960 3300025914 Bacteria 1545
303 Ga0207657_10008853 3300025919 Bacteria 10181
304 Ga0207657_10065116 3300025919 Bacteria 3108
305 Ga0207657_10065750 3300025919 Bacteria 3090
306 Ga0207657_10066709 3300025919 Bacteria 3062
307 Ga0207657_10103427 3300025919 Bacteria 2361
308 Ga0207657_10189101 3300025919 Bacteria 1662
309 Ga0207657_10227301 3300025919 Bacteria 1493
310 Ga0207657_10254383 3300025919 Bacteria 1399
311 Ga0207649_10010061 3300025920 Bacteria 5189
312 Ga0207649_10050916 3300025920 Bacteria 2563
313 Ga0207649_10126732 3300025920 Bacteria 1729
314 Ga0207649_10312385 3300025920 Bacteria 1152
315 Ga0207649_10325948 3300025920 Bacteria 1130
316 Ga0207649_10352238 3300025920 Bacteria 1090
317 Ga0207681_10000076 3300025923 Bacteria 89353
318 Ga0207694_10001461 3300025924 Bacteria 20212
319 Ga0207694_10028824 3300025924 Bacteria 4234
320 Ga0207694_10039527 3300025924 Bacteria 3630
321 Ga0207650_10000069 3300025925 Bacteria 138442
322 Ga0207650_10026743 3300025925 Bacteria 4120
323 Ga0207650_10033961 3300025925 Bacteria 3698
324 Ga0207650_10061262 3300025925 Bacteria 2809
325 Ga0207650_10157802 3300025925 Bacteria 1795
326 Ga0207659_10059191 3300025926 Bacteria 2753
327 Ga0207687_10003098 3300025927 Bacteria 11274
328 Ga0207644_10003422 3300025931 Bacteria 10247
329 Ga0207644_10067193 3300025931 Bacteria 2612
330 Ga0207644_10072418 3300025931 Bacteria 2523
331 Ga0207644_10073678 3300025931 Bacteria 2504
332 Ga0207644_10081104 3300025931 Bacteria 2396
333 Ga0207644_10225803 3300025931 Bacteria 1486
334 Ga0207690_10003689 3300025932 Bacteria 9111
335 Ga0207690_10007350 3300025932 Bacteria 6539
336 Ga0207690_10040990 3300025932 Bacteria 3031
337 Ga0207690_10043362 3300025932 Bacteria 2960
338 Ga0207690_10093263 3300025932 Bacteria 2133
339 Ga0207690_10099311 3300025932 Bacteria 2075
340 Ga0207690_10129291 3300025932 Bacteria 1846
341 Ga0207690_10161495 3300025932 Bacteria 1671
342 Ga0207690_10205312 3300025932 Bacteria 1499
343 Ga0207690_10314363 3300025932 Bacteria 1229
344 Ga0207706_10001442 3300025933 Bacteria 23791
345 Ga0207706_10018968 3300025933 Bacteria 6185
346 Ga0207706_10043654 3300025933 Bacteria 3972
347 Ga0207706_10160806 3300025933 Bacteria 1974
348 Ga0207706_10246139 3300025933 Bacteria 1562
349 Ga0207706_10511476 3300025933 Bacteria 1036
350 Ga0207706_10643802 3300025933 Bacteria 908
351 Ga0207686_10028588 3300025934 Bacteria 3279
352 Ga0207709_10105314 3300025935 Bacteria 1874
353 Ga0207669_10055566 3300025937 Bacteria 2398
354 Ga0207669_10078646 3300025937 Bacteria 2102
355 Ga0207691_10000631 3300025940 Bacteria 34819
356 Ga0207691_10037826 3300025940 Bacteria 4466
357 Ga0207711_10000025 3300025941 Bacteria 289972
358 Ga0207711_10010871 3300025941 Bacteria 7565
359 Ga0207711_10016625 3300025941 Bacteria 6110
360 Ga0207689_10087928 3300025942 Bacteria 2553
361 Ga0207689_10100100 3300025942 Bacteria 2381
362 Ga0207679_10005299 3300025945 Bacteria 8090
363 Ga0207679_10016820 3300025945 Bacteria 4862
364 Ga0207679_10196654 3300025945 Bacteria 1681
365 Ga0207667_10004663 3300025949 Bacteria 16793
366 Ga0207667_10044332 3300025949 Bacteria 4714
367 Ga0207667_10219943 3300025949 Bacteria 1946
368 Ga0207667_10277086 3300025949 Bacteria 1714
369 Ga0207651_10008206 3300025960 Bacteria 5624
370 Ga0207712_10000021 3300025961 Bacteria 292649
371 Ga0207712_10002020 3300025961 Bacteria 13317
372 Ga0207712_10134447 3300025961 Bacteria 1889
373 Ga0207668_10135614 3300025972 Bacteria 1885
374 Ga0207640_10018490 3300025981 Bacteria 4097
375 Ga0207640_10158364 3300025981 Bacteria 1672
376 Ga0207640_10228286 3300025981 Bacteria 1430
377 Ga0207658_10000652 3300025986 Bacteria 30347
378 Ga0207658_10003067 3300025986 Bacteria 11944
379 Ga0207658_10202436 3300025986 Bacteria 1658
380 Ga0207677_10087570 3300026023 Bacteria 2255
381 Ga0207703_10010176 3300026035 Bacteria 7372
382 Ga0207703_10054384 3300026035 Bacteria 3255
383 Ga0207639_10071982 3300026041 Bacteria 2706
384 Ga0207639_10315558 3300026041 Unclassified 1386
385 Ga0207639_10401778 3300026041 Bacteria 1234
386 Ga0207639_10787962 3300026041 Bacteria 885
387 Ga0207678_10001799 3300026067 Bacteria 19627
388 Ga0207678_10004357 3300026067 Bacteria 12713
389 Ga0207678_10045975 3300026067 Bacteria 3775
390 Ga0207678_10241115 3300026067 Bacteria 1548
391 Ga0207702_10002022 3300026078 Bacteria 19645
392 Ga0207702_10008254 3300026078 Bacteria 8801
393 Ga0207641_10000002 3300026088 Bacteria 981004
394 Ga0207641_10000414 3300026088 Bacteria 49835
395 Ga0207641_10005204 3300026088 Bacteria 11123
396 Ga0207648_10001344 3300026089 Bacteria 27279
397 Ga0207648_10062609 3300026089 Bacteria 3243
398 Ga0207676_10000353 3300026095 Bacteria 39309
399 Ga0207676_10009609 3300026095 Bacteria 6885
400 Ga0207676_10077831 3300026095 Bacteria 2684
401 Ga0207676_10646159 3300026095 Bacteria 1020
402 Ga0207674_10000291 3300026116 Bacteria 63446
403 Ga0207674_10010820 3300026116 Bacteria 10286
404 Ga0207674_10042500 3300026116 Bacteria 4694
405 Ga0207674_10114135 3300026116 Unclassified 2674
406 Ga0207674_10246853 3300026116 Bacteria 1732
407 Ga0207674_10251420 3300026116 Bacteria 1715
408 Ga0207675_100000227 3300026118 Bacteria 53090
409 Ga0207675_100000998 3300026118 Bacteria 28040
410 Ga0207683_10004993 3300026121 Bacteria 11396
411 Ga0207683_10010089 3300026121 Bacteria 8060
412 Ga0207698_10001499 3300026142 Bacteria 13593
413 Ga0207698_10038110 3300026142 Bacteria 3548
414 Ga0207698_10079015 3300026142 Bacteria 2644
415 Ga0207698_10095930 3300026142 Bacteria 2443
416 Ga0207698_10130366 3300026142 Bacteria 2147
417 Ga0207698_10304513 3300026142 Bacteria 1485
418 Ga0209813_10000041 3300027866 Bacteria 53753
419 Ga0268266_10000054 3300028379 Bacteria 292717
420 Ga0268266_10116025 3300028379 Bacteria 2378
421 Ga0268266_10194973 3300028379 Bacteria 1851
422 Ga0268266_10376461 3300028379 Bacteria 1338
423 Ga0268265_10000003 3300028380 Bacteria 949201
424 Ga0268265_10002814 3300028380 Bacteria 12797
425 Ga0268265_10239805 3300028380 Bacteria 1599
426 Ga0268265_10315647 3300028380 Bacteria 1413
427 Ga0268264_10000074 3300028381 Bacteria 259555
428 Ga0268264_10754480 3300028381 Bacteria 970
429 Ga0307408_100036711 3300031548 Bacteria 3446
430 Ga0307408_100453026 3300031548 Bacteria 1113
431 Ga0307405_10038560 3300031731 Bacteria 2881
432 Ga0307413_10004075 3300031824 Bacteria 6286
433 Ga0307413_10028063 3300031824 Bacteria 3128
434 Ga0307413_10119107 3300031824 Bacteria 1784
435 Ga0307410_10000281 3300031852 Bacteria 19663
436 Ga0307410_10019341 3300031852 Bacteria 4141
437 Ga0307410_10035705 3300031852 Bacteria 3231
438 Ga0307406_10020481 3300031901 Bacteria 3895
439 Ga0307406_10149122 3300031901 Bacteria 1666
440 Ga0307406_10229868 3300031901 Bacteria 1384
441 Ga0307407_10001856 3300031903 Bacteria 7945
442 Ga0307407_10004947 3300031903 Bacteria 5730
443 Ga0307407_10209618 3300031903 Bacteria 1311
444 Ga0307412_10000453 3300031911 Bacteria 24741
445 Ga0307412_10005872 3300031911 Bacteria 6914
446 Ga0307412_10132167 3300031911 Bacteria 1814
447 Ga0307409_100013771 3300031995 Bacteria 5225
448 Ga0307409_100065828 3300031995 Bacteria 2854
449 Ga0307409_100277011 3300031995 Bacteria 1548
450 Ga0307416_100009701 3300032002 Bacteria 6321
451 Ga0307416_100033727 3300032002 Bacteria 3885
452 Ga0307416_100069334 3300032002 Bacteria 2917
453 Ga0307416_100225252 3300032002 Bacteria 1802
454 Ga0307414_10000248 3300032004 Bacteria 33977
455 Ga0307414_10004115 3300032004 Bacteria 7856
456 Ga0307414_10008487 3300032004 Bacteria 5829
457 Ga0307414_10018719 3300032004 Bacteria 4272
458 Ga0307414_10373356 3300032004 Bacteria 1231
459 Ga0307411_10004182 3300032005 Bacteria 6861
460 Ga0307411_10012924 3300032005 Bacteria 4580
461 Ga0307411_10021318 3300032005 Bacteria 3789
462 Ga0307411_10076900 3300032005 Bacteria 2283
463 Ga0307411_10079644 3300032005 Bacteria 2250
464 Ga0307411_10106071 3300032005 Bacteria 1999
465 Ga0307415_100272494 3300032126 Bacteria 1387
466 Ga0373932_0041935 3300035112 Bacteria 1325
467 Ga0373932_0045385 3300035112 Bacteria 1285
468 Ga0395899_0000251 3300037312 Bacteria 71228
469 Ga0395899_0001062 3300037312 Bacteria 24783
470 Ga0395899_0001983 3300037312 Bacteria 16840
471 Ga0395900_0000084 3300037418 Bacteria 172593
472 Ga0395900_0022623 3300037418 Bacteria 6433
473 Ga0395900_0025014 3300037418 Bacteria 6110
474 Ga0395900_0479610 3300037418 Bacteria 1196
475 Ga0395898_0000021 3300037466 Bacteria 393971
476 Ga0395898_0002422 3300037466 Bacteria 22069
477 Ga0395905_0000006 3300037471 Bacteria 549428
478 Ga0395905_0000762 3300037471 Bacteria 42402
479 Ga0395905_0031744 3300037471 Bacteria 4969
480 Ga0395905_0073303 3300037471 Bacteria 3209
481 Ga0395905_0234336 3300037471 Bacteria 1716
482 Ga0395905_0528582 3300037471 Bacteria 1080
483 Ga0436364_0322209 3300037853 Bacteria 1693
484 Ga0436364_0462751 3300037853 Bacteria 45616
485 Ga0395901_0008794 3300038443 Bacteria 10217
486 Ga0395901_0009640 3300038443 Bacteria 9795
487 Ga0395901_0069324 3300038443 Bacteria 3673
488 Ga0436365_0695304 3300039437 Bacteria 6007
489 Ga0436365_1474733 3300039437 Bacteria 4043
490 Ga0436363_0379517 3300039450 Bacteria 4119
491 Ga0436363_1509936 3300039450 Bacteria 1603
492 Ga0439436_0007826 3300041404 Bacteria 3285
493 Ga0439461_0000239 3300041410 Bacteria 7764
494 Ga0439461_0006785 3300041410 Bacteria 2002
495 Ga0439465_0000177 3300041413 Bacteria 16347
496 Ga0439465_0012688 3300041413 Bacteria 2635
497 Ga0451806_431010 3300041462 Bacteria 9494
498 Ga0451804_1038976 3300041463 Bacteria 1919
499 Ga0451807_1283003 3300041486 Bacteria 5402
500 Ga0439431_0000207 3300041997 Bacteria 11634
501 Ga0439431_0006020 3300041997 Bacteria 2677
502 Ga0439442_002361 3300042002 Bacteria 3702
503 Ga0439445_0000060 3300042004 Bacteria 16616
504 Ga0439448_0001841 3300042005 Bacteria 5615
505 Ga0439432_017104 3300042006 Bacteria 2436
506 Ga0439455_0007574 3300042012 Bacteria 2300
507 Ga0439462_0000195 3300042015 Bacteria 10446
508 Ga0439446_0074395 3300042156 Bacteria 1044
509 Ga0439458_0000436 3300042157 Bacteria 10507
510 Ga0439434_0003840 3300042435 Bacteria 4392
511 Ga0439434_0007436 3300042435 Bacteria 3209
512 Ga0439464_0044684 3300042439 Bacteria 1269
513 Ga0466972_0010895 3300044658 Bacteria 4562
514 Ga0466972_0068978 3300044658 Bacteria 1689
515 Ga0466965_0084296 3300044683 Bacteria 1610
516 Ga0466961_0221293 3300044693 Bacteria 1166
517 Ga0466963_0005621 3300044694 Bacteria 7355
518 Ga0466963_0014337 3300044694 Bacteria 4886
519 Ga0466963_0087573 3300044694 Bacteria 2117
520 Ga0466971_0013927 3300044719 Bacteria 3535
521 Ga0466971_0131759 3300044719 Bacteria 1161
522 Ga0466968_0042644 3300044735 Bacteria 1919
523 Ga0466970_0050313 3300044765 Bacteria 2222
524 Ga0466957_0016826 3300044842 Bacteria 4279
525 Ga0466957_0206908 3300044842 Bacteria 1291
526 Ga0466960_0003085 3300044901 Bacteria 6375
527 Ga0466960_0035587 3300044901 Bacteria 2328
528 Ga0466958_0012119 3300045836 Bacteria 4875
529 Ga0466958_0187392 3300045836 Bacteria 1314
530 Ga0466958_0301418 3300045836 Bacteria 1029
531 Ga0466967_0007703 3300045976 Bacteria 7804
532 Ga0466967_0050831 3300045976 Bacteria 3630
533 Ga0495617_029351 3300046452 Bacteria 1849
534 Ga0495627_006278 3300046453 Bacteria 4670
535 Ga0495627_051928 3300046453 Bacteria 1231
536 Ga0495583_0001401 3300046506 Bacteria 24579
537 Ga0495606_0094008 3300046507 Bacteria 1838
538 Ga0495610_0000206 3300046512 Bacteria 65469
539 Ga0495610_0049660 3300046512 Bacteria 2053
540 Ga0495616_0000189 3300046513 Bacteria 51610
541 Ga0495632_0001899 3300046519 Bacteria 16723
542 Ga0495637_0029360 3300046520 Bacteria 2448
543 Ga0495643_0000162 3300046522 Bacteria 106672
544 Ga0495648_0000038 3300046524 Bacteria 191612
545 Ga0495663_0018160 3300046525 Bacteria 2001
546 Ga0495663_0024238 3300046525 Bacteria 1762
547 Ga0495654_0180699 3300046530 Bacteria 914
548 Ga0495621_0007456 3300046539 Bacteria 3240
549 Ga0495622_0093923 3300046557 Bacteria 1377
550 Ga0495633_0130434 3300046558 Bacteria 1163
551 Ga0495625_0257602 3300046660 Bacteria 1130
552 Ga0495670_0000028 3300046691 Bacteria 90085
553 Ga0495671_0000034 3300046692 Bacteria 195385
554 Ga0495671_0000062 3300046692 Bacteria 106672
555 Ga0495671_0003910 3300046692 Bacteria 9038
556 Ga0495636_0163863 3300047318 Bacteria 1003
557 Ga0495673_0000013 3300047469 Bacteria 612902
558 Ga0495673_0084474 3300047469 Bacteria 1309
559 Ga0495681_0000106 3300047470 Bacteria 72369
560 Ga0495681_0008636 3300047470 Bacteria 6361
561 Ga0495686_0000366 3300047472 Bacteria 73243
562 Ga0495686_0000986 3300047472 Bacteria 34762
563 Ga0495686_0071813 3300047472 Bacteria 2129
564 Ga0496100_0001542 3300048903 Bacteria 11314
565 Ga0496100_0029233 3300048903 Bacteria 3407
566 Ga0496101_0003699 3300048904 Bacteria 9538
567 Ga0496102_0067110 3300048905 Bacteria 3289
568 Ga0496102_0088970 3300048905 Bacteria 2856
569 Ga0496102_0156222 3300048905 Bacteria 2144
570 Ga0496102_0270111 3300048905 Bacteria 1603
571 Ga0496103_0003725 3300048906 Bacteria 9269
572 Ga0496103_0041637 3300048906 Bacteria 2824
573 Ga0496103_0140695 3300048906 Bacteria 1543
574 Ga0496104_0137687 3300048907 Bacteria 2345
575 Ga0496104_0853155 3300048907 Unclassified 816
576 Ga0496105_0171707 3300048908 Bacteria 1777
577 Ga0496106_0121516 3300048909 Bacteria 2042
578 Ga0496106_0205599 3300048909 Bacteria 1568
579 Ga0496107_0018156 3300048910 Bacteria 4949
580 Ga0496107_0090106 3300048910 Unclassified 2240
581 Ga0496108_0013686 3300048911 Bacteria 6623
582 Ga0496108_0032889 3300048911 Bacteria 4308
583 Ga0496108_0156763 3300048911 Bacteria 1966
584 Ga0496109_0178660 3300048912 Bacteria 1993
585 Ga0496109_0579378 3300048912 Bacteria 1058
586 Ga0496110_0016041 3300048913 Bacteria 6247
587 Ga0496110_0023804 3300048913 Bacteria 5212
588 Ga0496110_0219553 3300048913 Bacteria 1728
589 Ga0496111_0022461 3300048914 Bacteria 4418
590 Ga0496111_0125943 3300048914 Bacteria 1893
591 Ga0496112_0105543 3300048915 Bacteria 2787
592 Ga0496113_0015706 3300048916 Bacteria 5214
593 Ga0496114_0174873 3300048917 Bacteria 1873
594 Ga0496115_0003674 3300048918 Bacteria 11044
595 Ga0496116_0121765 3300048919 Bacteria 1508
596 Ga0496117_0012393 3300048920 Bacteria 7520
597 Ga0496117_0014638 3300048920 Bacteria 6746
598 Ga0496117_0040062 3300048920 Bacteria 3451
599 Ga0496117_0047279 3300048920 Bacteria 3087
600 Ga0496117_0063203 3300048920 Bacteria 2532
601 Ga0496118_0002436 3300048921 Bacteria 25049
602 Ga0496118_0023982 3300048921 Bacteria 5279
603 Ga0496118_0027239 3300048921 Bacteria 4843
604 Ga0496118_0098454 3300048921 Bacteria 1986
605 Ga0496118_0116649 3300048921 Bacteria 1754
606 Ga0496118_0163339 3300048921 Bacteria 1373
607 Ga0496119_0102222 3300048922 Bacteria 1607
608 Ga0496120_0071098 3300048923 Bacteria 1911
609 Ga0496120_0233981 3300048923 Bacteria 871
610 Ga0496121_0000175 3300048924 Bacteria 142910
611 Ga0496121_0000650 3300048924 Bacteria 65007
612 Ga0496121_0040635 3300048924 Bacteria 4077
613 Ga0496121_0048915 3300048924 Bacteria 3592
614 Ga0496121_0050973 3300048924 Bacteria 3490
615 Ga0496121_0099521 3300048924 Bacteria 2247
616 Ga0496121_0126821 3300048924 Bacteria 1917
617 Ga0496122_0026729 3300048925 Bacteria 4964
618 Ga0496122_0028593 3300048925 Bacteria 4724
619 Ga0496122_0135922 3300048925 Bacteria 1549
620 Ga0496123_0050545 3300048926 Bacteria 2776
621 Ga0496123_0081779 3300048926 Bacteria 1961
622 Ga0496123_0163235 3300048926 Bacteria 1185
623 Ga0496123_0175105 3300048926 Bacteria 1127
624 Ga0496124_0000129 3300048927 Bacteria 156648
625 Ga0496124_0006227 3300048927 Bacteria 13070
626 Ga0496124_0007123 3300048927 Bacteria 11972
627 Ga0496124_0089345 3300048927 Bacteria 2516
628 Ga0496124_0113648 3300048927 Bacteria 2175
629 Ga0496124_0166013 3300048927 Bacteria 1716
630 Ga0496124_0214970 3300048927 Bacteria 1451
631 Ga0496124_0239613 3300048927 Bacteria 1350
632 Ga0496124_0363207 3300048927 Bacteria 1019
633 Ga0496125_0000445 3300048928 Bacteria 75404
634 Ga0496125_0007177 3300048928 Bacteria 11883
635 Ga0496125_0017604 3300048928 Bacteria 6808
636 Ga0496125_0105320 3300048928 Bacteria 2062
637 Ga0496125_0113688 3300048928 Bacteria 1952
638 Ga0496125_0142321 3300048928 Bacteria 1665
639 Ga0496125_0277712 3300048928 Bacteria 1040
640 Ga0496126_0046922 3300048929 Bacteria 3958
641 Ga0496126_0077467 3300048929 Bacteria 2947
642 Ga0496126_0149598 3300048929 Bacteria 2002
643 Ga0496126_0202533 3300048929 Bacteria 1675
644 Ga0501033_0140763 3300049570 Bacteria 1744
645 Ga0501034_0069690 3300049571 Bacteria 3528
646 Ga0501043_0108214 3300049579 Bacteria 2184
647 Ga0501047_0147011 3300049581 Bacteria 2233
648 Ga0501047_0191251 3300049581 Bacteria 1910
649 Ga0501211_005276 3300049658 Bacteria 1296
650 Ga0501223_000066 3300049663 Bacteria 33567
651 Ga0501223_000317 3300049663 Bacteria 12000
652 Ga0501224_000076 3300049664 Bacteria 10275
653 Ga0501233_000558 3300049668 Bacteria 6046
654 Ga0501233_011054 3300049668 Bacteria 1789
655 Ga0501235_003738 3300049669 Bacteria 3285
656 Ga0501235_041828 3300049669 Bacteria 1049
657 Ga0501225_0000137 3300049705 Bacteria 22173
658 Ga0501225_0000228 3300049705 Bacteria 17699
659 Ga0501225_0008682 3300049705 Bacteria 2909
660 Ga0501234_000767 3300049707 Bacteria 4989
661 Ga0501035_0294576 3300049822 Bacteria 1369
662 Ga0501044_0090163 3300049823 Bacteria 3094
663 Ga0501226_000183 3300049853 Bacteria 10218
664 nmdc:mga06z11_9_c1 3300050494 Bacteria 109982
665 nmdc:mga04h51_12_c1 3300050495 Bacteria 83117
666 nmdc:mga07m45_101835_c1 3300050496 Bacteria 1649
667 nmdc:mga05p37_27409_c1 3300050507 Bacteria 6934
668 nmdc:mga05p37_844348_c1 3300050507 Bacteria 995
669 nmdc:mga09592_115513_c1 3300050508 Bacteria 2303
670 nmdc:mga06r32_10890_c1 3300050510 Bacteria 8189
671 Ga0500643_023449 3300053087 Bacteria 1971
672 Ga0500643_070832 3300053087 Bacteria 967
673 Ga0500566_0007362 3300053094 Bacteria 6519
674 Ga0500562_029007 3300053108 Bacteria 1455
675 Ga0500592_000050 3300053116 Bacteria 35179
676 Ga0500594_0001614 3300053118 Bacteria 4902
677 Ga0500595_015056 3300053119 Bacteria 2913
678 Ga0500658_0048476 3300053134 Bacteria 1727
679 Ga0500559_0144605 3300053136 Bacteria 1114
680 Ga0500573_0000366 3300053140 Bacteria 19207
681 Ga0500573_0170376 3300053140 Bacteria 1178
682 Ga0500577_0061655 3300053142 Bacteria 1444
683 Ga0500616_0105036 3300053153 Bacteria 1374
684 Ga0500624_000084 3300053157 Bacteria 47961
685 Ga0500627_0000452 3300053158 Bacteria 11132
686 Ga0500627_0000938 3300053158 Bacteria 7861
687 Ga0500645_005027 3300053730 Bacteria 4952
688 Ga0466962_0005982 3300061719 Bacteria 5846

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_101835_c1 nmdc:mga07m45_101835_c1_19_663 195
2 3300005339 Ga0070660_100063008 Ga0070660_1000630082 209
3 3300025933 Ga0207706_10160806 Ga0207706_101608061 209
4 3300042005 Ga0439448_0001841 Ga0439448_0001841_2434_3168 209
5 3300042012 Ga0439455_0007574 Ga0439455_0007574_548_1282 209
6 3300042157 Ga0439458_0000436 Ga0439458_0000436_667_1401 209
7 3300005366 Ga0070659_100433901 Ga0070659_1004339011 219
8 3300006353 Ga0075370_10066614 Ga0075370_100666142 225
9 3300005327 Ga0070658_10037857 Ga0070658_100378574 226
10 3300005339 Ga0070660_100011482 Ga0070660_1000114822 226
11 3300025272 Ga0209455_1000480 Ga0209455_100048010 226
12 3300025919 Ga0207657_10227301 Ga0207657_102273012 226
13 3300005937 Ga0081455_10160295 Ga0081455_101602952 229
14 3300026142 Ga0207698_10095930 Ga0207698_100959302 231
15 3300026041 Ga0207639_10401778 Ga0207639_104017782 235
16 3300044694 Ga0466963_0005621 Ga0466963_0005621_4672_5409 235
17 3300044719 Ga0466971_0131759 Ga0466971_0131759_320_1057 235
18 3300045836 Ga0466958_0187392 Ga0466958_0187392_532_1269 235
19 3300003320 rootH2_10235635 rootH2_102356352 236
20 3300039450 Ga0436363_0379517 Ga0436363_0379517_822_1544 237
21 3300006846 Ga0075430_100059109 Ga0075430_1000591094 238
22 3300006847 Ga0075431_100151201 Ga0075431_1001512014 238
23 3300006847 Ga0075431_100366551 Ga0075431_1003665513 238
24 3300006880 Ga0075429_100161451 Ga0075429_1001614512 238
25 3300009147 Ga0114129_10841433 Ga0114129_108414332 238
26 3300013306 Ga0163162_10096754 Ga0163162_100967542 238
27 3300050507 nmdc:mga05p37_27409_c1 nmdc:mga05p37_27409_c1_5388_6119 238
28 3300050507 nmdc:mga05p37_844348_c1 nmdc:mga05p37_844348_c1_73_804 238
29 3300050508 nmdc:mga09592_115513_c1 nmdc:mga09592_115513_c1_259_990 238
30 3300050510 nmdc:mga06r32_10890_c1 nmdc:mga06r32_10890_c1_832_1563 238
31 iso_pu_bacteria 2599185359 2600228822 239
32 iso_pu_bacteria 2643221622 2644125801 239
33 iso_pu_bacteria 2818991466 2819714649 239
34 iso_pu_bacteria 2879163058 2879165271 239
35 iso_pu_bacteria 2885427238 2885428503 239
36 iso_pu_bacteria 2928027323 2928030398 239
37 iso_pu_bacteria 2928526807 2928529152 239
38 iso_pu_bacteria 2928968154 2928968696 239
39 iso_pu_bacteria 2984555340 2984557324 239
40 iso_pu_bacteria 2512564014 2512644916 240
41 iso_pu_bacteria 2808606401 2809064386 240
42 iso_pu_bacteria 2808606404 2809080449 240
43 iso_pu_bacteria 2808606405 2809084718 240
44 iso_pu_bacteria 2880518877 2880519159 240
45 3300001976 JGI24752J21851_1001710 JGI24752J21851_10017102 242
46 3300003323 rootH1_10190613 rootH1_101906131 242
47 3300005331 Ga0070670_100000075 Ga0070670_10000007585 242
48 3300005345 Ga0070692_10018735 Ga0070692_100187354 242
49 3300005347 Ga0070668_100089004 Ga0070668_1000890043 242
50 3300005355 Ga0070671_100099761 Ga0070671_1000997613 242
51 3300005367 Ga0070667_100000039 Ga0070667_10000003959 242
52 3300005367 Ga0070667_100259304 Ga0070667_1002593042 242
53 3300005548 Ga0070665_100138494 Ga0070665_1001384943 242
54 3300005563 Ga0068855_100526948 Ga0068855_1005269481 242
55 3300005616 Ga0068852_100199080 Ga0068852_1001990802 242
56 3300005618 Ga0068864_100000016 Ga0068864_100000016199 242
57 3300005841 Ga0068863_100000033 Ga0068863_10000003353 242
58 3300005844 Ga0068862_100000040 Ga0068862_10000004052 242
59 3300005844 Ga0068862_100009087 Ga0068862_1000090872 242
60 3300009011 Ga0105251_10001444 Ga0105251_100014448 242
61 3300009177 Ga0105248_10000021 Ga0105248_10000021165 242
62 3300009177 Ga0105248_10982508 Ga0105248_109825081 242
63 3300014325 Ga0163163_10120063 Ga0163163_101200633 242
64 3300025735 Ga0207713_1007763 Ga0207713_10077632 242
65 3300025925 Ga0207650_10000069 Ga0207650_10000069125 242
66 3300025931 Ga0207644_10225803 Ga0207644_102258032 242
67 3300025941 Ga0207711_10000025 Ga0207711_10000025131 242
68 3300025972 Ga0207668_10135614 Ga0207668_101356141 242
69 3300025986 Ga0207658_10000652 Ga0207658_1000065223 242
70 3300025986 Ga0207658_10202436 Ga0207658_102024362 242
71 3300026088 Ga0207641_10000002 Ga0207641_1000000252 242
72 3300026095 Ga0207676_10000353 Ga0207676_100003532 242
73 3300026142 Ga0207698_10304513 Ga0207698_103045132 242
74 3300028379 Ga0268266_10194973 Ga0268266_101949732 242
75 3300028380 Ga0268265_10000003 Ga0268265_10000003939 242
76 3300044842 Ga0466957_0206908 Ga0466957_0206908_25_753 242
77 3300048906 Ga0496103_0041637 Ga0496103_0041637_1422_2150 242
78 3300048920 Ga0496117_0040062 Ga0496117_0040062_1975_2703 242
79 3300048921 Ga0496118_0002436 Ga0496118_0002436_9885_10613 242
80 3300048921 Ga0496118_0023982 Ga0496118_0023982_2345_3073 242
81 3300048924 Ga0496121_0099521 Ga0496121_0099521_197_925 242
82 3300048926 Ga0496123_0163235 Ga0496123_0163235_354_1082 242
83 3300049668 Ga0501233_011054 Ga0501233_011054_509_1243 242
84 3300049822 Ga0501035_0294576 Ga0501035_0294576_570_1298 242
85 3300053087 Ga0500643_070832 Ga0500643_070832_200_928 242
86 3300001979 JGI24740J21852_10004963 JGI24740J21852_100049634 243
87 3300001989 JGI24739J22299_10011325 JGI24739J22299_100113253 243
88 3300001990 JGI24737J22298_10005153 JGI24737J22298_100051534 243
89 3300002067 JGI24735J21928_10001689 JGI24735J21928_100016893 243
90 3300002067 JGI24735J21928_10003032 JGI24735J21928_100030326 243
91 3300002067 JGI24735J21928_10015767 JGI24735J21928_100157673 243
92 3300002067 JGI24735J21928_10050673 JGI24735J21928_100506732 243
93 3300002070 JGI24750J21931_1000042 JGI24750J21931_10000429 243
94 3300002074 JGI24748J21848_1000063 JGI24748J21848_100006338 243
95 3300002075 JGI24738J21930_10001001 JGI24738J21930_100010013 243
96 3300002075 JGI24738J21930_10001487 JGI24738J21930_100014874 243
97 3300002239 JGI24034J26672_10000007 JGI24034J26672_1000000715 243
98 3300002774 JGI25150J39212_1002132 JGI25150J39212_10021324 243
99 3300003214 JGI25165J46597_1000145 JGI25165J46597_100014568 243
100 3300003215 JGI25153J46596_10000028 JGI25153J46596_10000028148 243
101 3300003320 rootH2_10161563 rootH2_101615632 243
102 3300003322 rootL2_10107312 rootL2_101073122 243
103 3300003771 Ga0055526_1000478 Ga0055526_100047821 243
104 3300003773 Ga0055537_1001154 Ga0055537_10011547 243
105 3300003775 Ga0055524_1000457 Ga0055524_100045730 243
106 3300003791 Ga0055530_10041505 Ga0055530_100415052 243
107 3300003792 Ga0055540_1001446 Ga0055540_10014461 243
108 3300003792 Ga0055540_1001525 Ga0055540_100152516 243
109 3300003794 Ga0055531_10000384 Ga0055531_1000038437 243
110 3300005262 Ga0065165_1002862 Ga0065165_100286214 243
111 3300005262 Ga0065165_1003940 Ga0065165_10039403 243
112 3300005262 Ga0065165_1031534 Ga0065165_10315342 243
113 3300005262 Ga0065165_1044517 Ga0065165_10445172 243
114 3300005295 Ga0065707_10082875 Ga0065707_100828757 243
115 3300005327 Ga0070658_10000033 Ga0070658_1000003327 243
116 3300005327 Ga0070658_10160501 Ga0070658_101605012 243
117 3300005328 Ga0070676_10411414 Ga0070676_104114142 243
118 3300005328 Ga0070676_10503058 Ga0070676_105030581 243
119 3300005330 Ga0070690_100000110 Ga0070690_10000011022 243
120 3300005330 Ga0070690_100019099 Ga0070690_1000190993 243
121 3300005331 Ga0070670_100085590 Ga0070670_1000855903 243
122 3300005331 Ga0070670_100111155 Ga0070670_1001111552 243
123 3300005331 Ga0070670_100169856 Ga0070670_1001698562 243
124 3300005334 Ga0068869_100191317 Ga0068869_1001913172 243
125 3300005335 Ga0070666_10000417 Ga0070666_100004178 243
126 3300005335 Ga0070666_10003441 Ga0070666_100034414 243
127 3300005339 Ga0070660_100002857 Ga0070660_10000285710 243
128 3300005339 Ga0070660_100073995 Ga0070660_1000739953 243
129 3300005339 Ga0070660_100090135 Ga0070660_1000901351 243
130 3300005339 Ga0070660_100092582 Ga0070660_1000925822 243
131 3300005339 Ga0070660_100135012 Ga0070660_1001350123 243
132 3300005339 Ga0070660_100173181 Ga0070660_1001731812 243
133 3300005344 Ga0070661_100130953 Ga0070661_1001309531 243
134 3300005344 Ga0070661_100199930 Ga0070661_1001999302 243
135 3300005344 Ga0070661_100254965 Ga0070661_1002549652 243
136 3300005344 Ga0070661_100274167 Ga0070661_1002741672 243
137 3300005353 Ga0070669_100000332 Ga0070669_10000033221 243
138 3300005354 Ga0070675_100146846 Ga0070675_1001468462 243
139 3300005355 Ga0070671_100022882 Ga0070671_1000228824 243
140 3300005355 Ga0070671_100055455 Ga0070671_1000554552 243
141 3300005355 Ga0070671_100073726 Ga0070671_1000737263 243
142 3300005356 Ga0070674_100092379 Ga0070674_1000923793 243
143 3300005364 Ga0070673_100002629 Ga0070673_1000026295 243
144 3300005366 Ga0070659_100002258 Ga0070659_1000022584 243
145 3300005366 Ga0070659_100022028 Ga0070659_1000220282 243
146 3300005366 Ga0070659_100057141 Ga0070659_1000571412 243
147 3300005366 Ga0070659_100062359 Ga0070659_1000623594 243
148 3300005366 Ga0070659_100115132 Ga0070659_1001151322 243
149 3300005366 Ga0070659_100181006 Ga0070659_1001810062 243
150 3300005366 Ga0070659_100271573 Ga0070659_1002715732 243
151 3300005366 Ga0070659_100676045 Ga0070659_1006760451 243
152 3300005455 Ga0070663_100132933 Ga0070663_1001329332 243
153 3300005455 Ga0070663_100181416 Ga0070663_1001814162 243
154 3300005456 Ga0070678_100001866 Ga0070678_10000186610 243
155 3300005457 Ga0070662_100006444 Ga0070662_1000064442 243
156 3300005457 Ga0070662_100011803 Ga0070662_1000118032 243
157 3300005457 Ga0070662_100168906 Ga0070662_1001689062 243
158 3300005458 Ga0070681_10102501 Ga0070681_101025011 243
159 3300005459 Ga0068867_100005781 Ga0068867_1000057817 243
160 3300005459 Ga0068867_100006557 Ga0068867_1000065572 243
161 3300005466 Ga0070685_10000036 Ga0070685_1000003681 243
162 3300005539 Ga0068853_100008364 Ga0068853_1000083642 243
163 3300005539 Ga0068853_100552448 Ga0068853_1005524481 243
164 3300005539 Ga0068853_100614750 Ga0068853_1006147502 243
165 3300005539 Ga0068853_100842060 Ga0068853_1008420601 243
166 3300005543 Ga0070672_100018490 Ga0070672_1000184904 243
167 3300005543 Ga0070672_100250539 Ga0070672_1002505392 243
168 3300005544 Ga0070686_100000045 Ga0070686_10000004584 243
169 3300005547 Ga0070693_100096773 Ga0070693_1000967732 243
170 3300005548 Ga0070665_100000042 Ga0070665_100000042205 243
171 3300005548 Ga0070665_100139592 Ga0070665_1001395922 243
172 3300005563 Ga0068855_100117343 Ga0068855_1001173433 243
173 3300005563 Ga0068855_100131931 Ga0068855_1001319312 243
174 3300005564 Ga0070664_100014603 Ga0070664_1000146034 243
175 3300005577 Ga0068857_100018632 Ga0068857_1000186326 243
176 3300005577 Ga0068857_100235716 Ga0068857_1002357161 243
177 3300005577 Ga0068857_100244914 Ga0068857_1002449142 243
178 3300005577 Ga0068857_100392160 Ga0068857_1003921602 243
179 3300005578 Ga0068854_100016231 Ga0068854_1000162313 243
180 3300005578 Ga0068854_100025435 Ga0068854_1000254354 243
181 3300005578 Ga0068854_100067438 Ga0068854_1000674383 243
182 3300005614 Ga0068856_100016269 Ga0068856_1000162696 243
183 3300005614 Ga0068856_100036758 Ga0068856_1000367582 243
184 3300005614 Ga0068856_100064590 Ga0068856_1000645903 243
185 3300005614 Ga0068856_100246893 Ga0068856_1002468932 243
186 3300005616 Ga0068852_100068729 Ga0068852_1000687292 243
187 3300005616 Ga0068852_100454952 Ga0068852_1004549522 243
188 3300005616 Ga0068852_101093151 Ga0068852_1010931511 243
189 3300005617 Ga0068859_100005488 Ga0068859_1000054889 243
190 3300005617 Ga0068859_100022537 Ga0068859_1000225373 243
191 3300005618 Ga0068864_100157801 Ga0068864_1001578012 243
192 3300005719 Ga0068861_100000321 Ga0068861_10000032127 243
193 3300005719 Ga0068861_100000965 Ga0068861_1000009653 243
194 3300005834 Ga0068851_10008938 Ga0068851_100089382 243
195 3300005834 Ga0068851_10027735 Ga0068851_100277353 243
196 3300005841 Ga0068863_100000280 Ga0068863_10000028014 243
197 3300005841 Ga0068863_100007192 Ga0068863_1000071924 243
198 3300005841 Ga0068863_100019160 Ga0068863_1000191606 243
199 3300005842 Ga0068858_100007900 Ga0068858_1000079002 243
200 3300005842 Ga0068858_100069059 Ga0068858_1000690592 243
201 3300005843 Ga0068860_100000182 Ga0068860_10000018285 243
202 3300005843 Ga0068860_100112898 Ga0068860_1001128981 243
203 3300005844 Ga0068862_100000308 Ga0068862_10000030823 243
204 3300005844 Ga0068862_100266217 Ga0068862_1002662172 243
205 3300005844 Ga0068862_100361141 Ga0068862_1003611412 243
206 3300006237 Ga0097621_100048516 Ga0097621_1000485162 243
207 3300006358 Ga0068871_100562537 Ga0068871_1005625371 243
208 3300006881 Ga0068865_100004177 Ga0068865_1000041772 243
209 3300006931 Ga0097620_100005488 Ga0097620_1000054885 243
210 3300006931 Ga0097620_100022537 Ga0097620_1000225373 243
211 3300009093 Ga0105240_10007666 Ga0105240_100076665 243
212 3300009093 Ga0105240_10026155 Ga0105240_100261557 243
213 3300009093 Ga0105240_10098942 Ga0105240_100989423 243
214 3300009093 Ga0105240_10128458 Ga0105240_101284582 243
215 3300009098 Ga0105245_10001867 Ga0105245_1000186720 243
216 3300009101 Ga0105247_10214021 Ga0105247_102140212 243
217 3300009148 Ga0105243_10104131 Ga0105243_101041313 243
218 3300009174 Ga0105241_10217538 Ga0105241_102175382 243
219 3300009176 Ga0105242_10064796 Ga0105242_100647963 243
220 3300009177 Ga0105248_10124883 Ga0105248_101248832 243
221 3300009177 Ga0105248_10394403 Ga0105248_103944032 243
222 3300009545 Ga0105237_10009418 Ga0105237_1000941812 243
223 3300009545 Ga0105237_10050016 Ga0105237_100500164 243
224 3300009545 Ga0105237_10054292 Ga0105237_100542922 243
225 3300009551 Ga0105238_10065766 Ga0105238_100657662 243
226 3300009551 Ga0105238_10120716 Ga0105238_101207162 243
227 3300009551 Ga0105238_10421674 Ga0105238_104216742 243
228 3300009553 Ga0105249_10000012 Ga0105249_1000001283 243
229 3300009553 Ga0105249_10002603 Ga0105249_100026035 243
230 3300009553 Ga0105249_10807819 Ga0105249_108078192 243
231 3300010375 Ga0105239_10000461 Ga0105239_100004614 243
232 3300011119 Ga0105246_10176826 Ga0105246_101768262 243
233 3300013100 Ga0157373_10121323 Ga0157373_101213232 243
234 3300013100 Ga0157373_10492926 Ga0157373_104929261 243
235 3300013102 Ga0157371_10085604 Ga0157371_100856043 243
236 3300013102 Ga0157371_10149242 Ga0157371_101492422 243
237 3300013102 Ga0157371_10169826 Ga0157371_101698262 243
238 3300013104 Ga0157370_10000008 Ga0157370_10000008100 243
239 3300013104 Ga0157370_10002308 Ga0157370_1000230811 243
240 3300013104 Ga0157370_10024209 Ga0157370_100242096 243
241 3300013105 Ga0157369_10031631 Ga0157369_100316312 243
242 3300013105 Ga0157369_10112395 Ga0157369_101123952 243
243 3300013296 Ga0157374_10004197 Ga0157374_100041972 243
244 3300013296 Ga0157374_10067557 Ga0157374_100675573 243
245 3300013296 Ga0157374_10372050 Ga0157374_103720502 243
246 3300013306 Ga0163162_10202484 Ga0163162_102024842 243
247 3300013306 Ga0163162_10204173 Ga0163162_102041732 243
248 3300013307 Ga0157372_10018134 Ga0157372_100181343 243
249 3300014325 Ga0163163_10081360 Ga0163163_100813602 243
250 3300014325 Ga0163163_10159477 Ga0163163_101594773 243
251 3300014326 Ga0157380_10000440 Ga0157380_1000044025 243
252 3300014968 Ga0157379_10003144 Ga0157379_1000314415 243
253 3300014968 Ga0157379_10036117 Ga0157379_100361172 243
254 3300014968 Ga0157379_10121240 Ga0157379_101212402 243
255 3300014969 Ga0157376_10130417 Ga0157376_101304172 243
256 3300017792 Ga0163161_10000202 Ga0163161_1000020212 243
257 3300017792 Ga0163161_10017029 Ga0163161_100170293 243
258 3300017792 Ga0163161_10355841 Ga0163161_103558412 243
259 3300017792 Ga0163161_10406912 Ga0163161_104069122 243
260 3300020082 Ga0206353_11760290 Ga0206353_117602908 243
261 3300021384 Ga0213876_10033404 Ga0213876_100334042 243
262 3300021388 Ga0213875_10000721 Ga0213875_100007211 243
263 3300025223 Ga0207672_1001024 Ga0207672_10010242 243
264 3300025231 Ga0207427_100545 Ga0207427_1005455 243
265 3300025245 Ga0207425_1000005 Ga0207425_1000005147 243
266 3300025245 Ga0207425_1004365 Ga0207425_10043654 243
267 3300025250 Ga0209026_1002632 Ga0209026_10026325 243
268 3300025254 Ga0209148_1000338 Ga0209148_100033849 243
269 3300025258 Ga0209129_1000825 Ga0209129_100082519 243
270 3300025261 Ga0209233_1000207 Ga0209233_100020767 243
271 3300025263 Ga0209565_1000007 Ga0209565_1000007128 243
272 3300025263 Ga0209565_1000056 Ga0209565_1000056115 243
273 3300025272 Ga0209455_1018960 Ga0209455_10189602 243
274 3300025273 Ga0209673_1001497 Ga0209673_100149724 243
275 3300025294 Ga0209025_1000296 Ga0209025_100029650 243
276 3300025297 Ga0209758_1000002 Ga0209758_10000021197 243
277 3300025297 Ga0209758_1002418 Ga0209758_10024189 243
278 3300025297 Ga0209758_1066833 Ga0209758_10668332 243
279 3300025298 Ga0209050_1000005 Ga0209050_1000005111 243
280 3300025298 Ga0209050_1000196 Ga0209050_100019613 243
281 3300025298 Ga0209050_1008839 Ga0209050_10088395 243
282 3300025298 Ga0209050_1016183 Ga0209050_10161833 243
283 3300025299 Ga0209256_1000009 Ga0209256_100000931 243
284 3300025303 Ga0209051_1000153 Ga0209051_100015377 243
285 3300025304 Ga0209257_1000228 Ga0209257_100022813 243
286 3300025304 Ga0209257_1003469 Ga0209257_10034699 243
287 3300025304 Ga0209257_1004247 Ga0209257_10042476 243
288 3300025304 Ga0209257_1004769 Ga0209257_10047699 243
289 3300025315 Ga0207697_10016147 Ga0207697_100161472 243
290 3300025900 Ga0207710_10166100 Ga0207710_101661002 243
291 3300025901 Ga0207688_10032718 Ga0207688_100327184 243
292 3300025903 Ga0207680_10000012 Ga0207680_10000012203 243
293 3300025904 Ga0207647_10001622 Ga0207647_100016224 243
294 3300025904 Ga0207647_10135199 Ga0207647_101351992 243
295 3300025909 Ga0207705_10000002 Ga0207705_100000021911 243
296 3300025909 Ga0207705_10007714 Ga0207705_100077147 243
297 3300025909 Ga0207705_10011424 Ga0207705_100114244 243
298 3300025909 Ga0207705_10042116 Ga0207705_100421163 243
299 3300025909 Ga0207705_10117758 Ga0207705_101177582 243
300 3300025909 Ga0207705_10192064 Ga0207705_101920642 243
301 3300025909 Ga0207705_10194448 Ga0207705_101944482 243
302 3300025911 Ga0207654_10001661 Ga0207654_1000166112 243
303 3300025913 Ga0207695_10000641 Ga0207695_1000064115 243
304 3300025913 Ga0207695_10006576 Ga0207695_1000657613 243
305 3300025913 Ga0207695_10077765 Ga0207695_100777653 243
306 3300025913 Ga0207695_10098637 Ga0207695_100986373 243
307 3300025913 Ga0207695_10134453 Ga0207695_101344532 243
308 3300025914 Ga0207671_10002738 Ga0207671_1000273810 243
309 3300025919 Ga0207657_10008853 Ga0207657_100088536 243
310 3300025919 Ga0207657_10065750 Ga0207657_100657502 243
311 3300025919 Ga0207657_10066709 Ga0207657_100667093 243
312 3300025919 Ga0207657_10103427 Ga0207657_101034273 243
313 3300025919 Ga0207657_10189101 Ga0207657_101891012 243
314 3300025919 Ga0207657_10254383 Ga0207657_102543832 243
315 3300025920 Ga0207649_10010061 Ga0207649_100100615 243
316 3300025920 Ga0207649_10050916 Ga0207649_100509162 243
317 3300025920 Ga0207649_10126732 Ga0207649_101267322 243
318 3300025920 Ga0207649_10312385 Ga0207649_103123852 243
319 3300025920 Ga0207649_10325948 Ga0207649_103259482 243
320 3300025923 Ga0207681_10000076 Ga0207681_1000007677 243
321 3300025924 Ga0207694_10001461 Ga0207694_1000146116 243
322 3300025924 Ga0207694_10028824 Ga0207694_100288241 243
323 3300025925 Ga0207650_10026743 Ga0207650_100267433 243
324 3300025925 Ga0207650_10061262 Ga0207650_100612622 243
325 3300025925 Ga0207650_10157802 Ga0207650_101578022 243
326 3300025927 Ga0207687_10003098 Ga0207687_100030987 243
327 3300025931 Ga0207644_10003422 Ga0207644_100034227 243
328 3300025931 Ga0207644_10072418 Ga0207644_100724182 243
329 3300025931 Ga0207644_10081104 Ga0207644_100811043 243
330 3300025932 Ga0207690_10003689 Ga0207690_100036892 243
331 3300025932 Ga0207690_10007350 Ga0207690_100073504 243
332 3300025932 Ga0207690_10040990 Ga0207690_100409903 243
333 3300025932 Ga0207690_10043362 Ga0207690_100433624 243
334 3300025932 Ga0207690_10093263 Ga0207690_100932632 243
335 3300025932 Ga0207690_10099311 Ga0207690_100993113 243
336 3300025932 Ga0207690_10129291 Ga0207690_101292913 243
337 3300025932 Ga0207690_10161495 Ga0207690_101614952 243
338 3300025932 Ga0207690_10314363 Ga0207690_103143632 243
339 3300025933 Ga0207706_10001442 Ga0207706_1000144220 243
340 3300025933 Ga0207706_10018968 Ga0207706_100189688 243
341 3300025933 Ga0207706_10246139 Ga0207706_102461392 243
342 3300025933 Ga0207706_10511476 Ga0207706_105114762 243
343 3300025933 Ga0207706_10643802 Ga0207706_106438022 243
344 3300025934 Ga0207686_10028588 Ga0207686_100285882 243
345 3300025935 Ga0207709_10105314 Ga0207709_101053142 243
346 3300025937 Ga0207669_10078646 Ga0207669_100786462 243
347 3300025940 Ga0207691_10000631 Ga0207691_100006319 243
348 3300025940 Ga0207691_10037826 Ga0207691_100378264 243
349 3300025941 Ga0207711_10010871 Ga0207711_100108712 243
350 3300025941 Ga0207711_10016625 Ga0207711_100166253 243
351 3300025942 Ga0207689_10087928 Ga0207689_100879283 243
352 3300025942 Ga0207689_10100100 Ga0207689_101001003 243
353 3300025945 Ga0207679_10005299 Ga0207679_100052995 243
354 3300025945 Ga0207679_10016820 Ga0207679_100168206 243
355 3300025949 Ga0207667_10004663 Ga0207667_100046634 243
356 3300025949 Ga0207667_10044332 Ga0207667_100443325 243
357 3300025949 Ga0207667_10219943 Ga0207667_102199431 243
358 3300025960 Ga0207651_10008206 Ga0207651_100082065 243
359 3300025961 Ga0207712_10000021 Ga0207712_10000021203 243
360 3300025961 Ga0207712_10002020 Ga0207712_1000202011 243
361 3300025981 Ga0207640_10018490 Ga0207640_100184904 243
362 3300025981 Ga0207640_10158364 Ga0207640_101583642 243
363 3300025986 Ga0207658_10003067 Ga0207658_1000306712 243
364 3300026023 Ga0207677_10087570 Ga0207677_100875702 243
365 3300026035 Ga0207703_10010176 Ga0207703_100101767 243
366 3300026035 Ga0207703_10054384 Ga0207703_100543842 243
367 3300026041 Ga0207639_10071982 Ga0207639_100719823 243
368 3300026041 Ga0207639_10315558 Ga0207639_103155582 243
369 3300026041 Ga0207639_10787962 Ga0207639_107879621 243
370 3300026067 Ga0207678_10004357 Ga0207678_100043572 243
371 3300026067 Ga0207678_10045975 Ga0207678_100459752 243
372 3300026067 Ga0207678_10241115 Ga0207678_102411152 243
373 3300026078 Ga0207702_10008254 Ga0207702_100082542 243
374 3300026088 Ga0207641_10000414 Ga0207641_1000041411 243
375 3300026088 Ga0207641_10005204 Ga0207641_100052049 243
376 3300026089 Ga0207648_10001344 Ga0207648_100013445 243
377 3300026089 Ga0207648_10062609 Ga0207648_100626094 243
378 3300026095 Ga0207676_10009609 Ga0207676_100096099 243
379 3300026095 Ga0207676_10077831 Ga0207676_100778312 243
380 3300026116 Ga0207674_10000291 Ga0207674_1000029155 243
381 3300026116 Ga0207674_10042500 Ga0207674_100425004 243
382 3300026116 Ga0207674_10114135 Ga0207674_101141353 243
383 3300026116 Ga0207674_10246853 Ga0207674_102468532 243
384 3300026116 Ga0207674_10251420 Ga0207674_102514202 243
385 3300026118 Ga0207675_100000227 Ga0207675_10000022738 243
386 3300026118 Ga0207675_100000998 Ga0207675_10000099826 243
387 3300026121 Ga0207683_10004993 Ga0207683_1000499310 243
388 3300026142 Ga0207698_10001499 Ga0207698_1000149910 243
389 3300026142 Ga0207698_10038110 Ga0207698_100381102 243
390 3300026142 Ga0207698_10079015 Ga0207698_100790153 243
391 3300028379 Ga0268266_10000054 Ga0268266_10000054202 243
392 3300028379 Ga0268266_10116025 Ga0268266_101160252 243
393 3300028380 Ga0268265_10002814 Ga0268265_1000281413 243
394 3300028380 Ga0268265_10239805 Ga0268265_102398052 243
395 3300028380 Ga0268265_10315647 Ga0268265_103156471 243
396 3300028381 Ga0268264_10000074 Ga0268264_10000074203 243
397 3300028381 Ga0268264_10754480 Ga0268264_107544802 243
398 3300031824 Ga0307413_10004075 Ga0307413_100040756 243
399 3300031824 Ga0307413_10028063 Ga0307413_100280631 243
400 3300031824 Ga0307413_10119107 Ga0307413_101191072 243
401 3300031852 Ga0307410_10000281 Ga0307410_100002817 243
402 3300031852 Ga0307410_10035705 Ga0307410_100357054 243
403 3300031901 Ga0307406_10149122 Ga0307406_101491223 243
404 3300031901 Ga0307406_10229868 Ga0307406_102298682 243
405 3300031903 Ga0307407_10001856 Ga0307407_100018563 243
406 3300031903 Ga0307407_10004947 Ga0307407_100049473 243
407 3300031903 Ga0307407_10209618 Ga0307407_102096181 243
408 3300031911 Ga0307412_10005872 Ga0307412_100058723 243
409 3300031995 Ga0307409_100013771 Ga0307409_1000137712 243
410 3300031995 Ga0307409_100065828 Ga0307409_1000658282 243
411 3300031995 Ga0307409_100277011 Ga0307409_1002770112 243
412 3300032002 Ga0307416_100069334 Ga0307416_1000693344 243
413 3300032002 Ga0307416_100225252 Ga0307416_1002252523 243
414 3300032004 Ga0307414_10004115 Ga0307414_100041158 243
415 3300032004 Ga0307414_10008487 Ga0307414_100084873 243
416 3300032004 Ga0307414_10018719 Ga0307414_100187192 243
417 3300032005 Ga0307411_10004182 Ga0307411_100041826 243
418 3300032005 Ga0307411_10012924 Ga0307411_100129241 243
419 3300032005 Ga0307411_10076900 Ga0307411_100769003 243
420 3300032005 Ga0307411_10079644 Ga0307411_100796443 243
421 3300032126 Ga0307415_100272494 Ga0307415_1002724942 243
422 3300035112 Ga0373932_0041935 Ga0373932_0041935_178_915 243
423 3300035112 Ga0373932_0045385 Ga0373932_0045385_46_777 243
424 3300037312 Ga0395899_0000251 Ga0395899_0000251_59025_59762 243
425 3300037312 Ga0395899_0001062 Ga0395899_0001062_18490_19227 243
426 3300037312 Ga0395899_0001983 Ga0395899_0001983_15366_16097 243
427 3300037418 Ga0395900_0000084 Ga0395900_0000084_142108_142845 243
428 3300037418 Ga0395900_0022623 Ga0395900_0022623_4516_5247 243
429 3300037418 Ga0395900_0025014 Ga0395900_0025014_1710_2447 243
430 3300037418 Ga0395900_0479610 Ga0395900_0479610_195_932 243
431 3300037466 Ga0395898_0000021 Ga0395898_0000021_190460_191197 243
432 3300037466 Ga0395898_0002422 Ga0395898_0002422_2992_3729 243
433 3300037471 Ga0395905_0000006 Ga0395905_0000006_406712_407449 243
434 3300037471 Ga0395905_0000762 Ga0395905_0000762_4472_5209 243
435 3300037471 Ga0395905_0031744 Ga0395905_0031744_894_1631 243
436 3300037471 Ga0395905_0073303 Ga0395905_0073303_1707_2444 243
437 3300037471 Ga0395905_0234336 Ga0395905_0234336_755_1492 243
438 3300037471 Ga0395905_0528582 Ga0395905_0528582_270_1007 243
439 3300037853 Ga0436364_0322209 Ga0436364_0322209_876_1607 243
440 3300037853 Ga0436364_0462751 Ga0436364_0462751_347_1078 243
441 3300038443 Ga0395901_0008794 Ga0395901_0008794_7454_8191 243
442 3300038443 Ga0395901_0009640 Ga0395901_0009640_4735_5472 243
443 3300038443 Ga0395901_0069324 Ga0395901_0069324_2378_3109 243
444 3300039437 Ga0436365_0695304 Ga0436365_0695304_1480_2217 243
445 3300039437 Ga0436365_1474733 Ga0436365_1474733_2346_3077 243
446 3300039450 Ga0436363_1509936 Ga0436363_1509936_668_1399 243
447 3300041404 Ga0439436_0007826 Ga0439436_0007826_1436_2167 243
448 3300041410 Ga0439461_0000239 Ga0439461_0000239_5983_6714 243
449 3300041410 Ga0439461_0006785 Ga0439461_0006785_874_1605 243
450 3300041413 Ga0439465_0000177 Ga0439465_0000177_5365_6096 243
451 3300041413 Ga0439465_0012688 Ga0439465_0012688_705_1436 243
452 3300041462 Ga0451806_431010 Ga0451806_431010_1753_2484 243
453 3300041463 Ga0451804_1038976 Ga0451804_1038976_660_1391 243
454 3300041486 Ga0451807_1283003 Ga0451807_1283003_1376_2107 243
455 3300041997 Ga0439431_0000207 Ga0439431_0000207_8897_9628 243
456 3300041997 Ga0439431_0006020 Ga0439431_0006020_975_1706 243
457 3300042002 Ga0439442_002361 Ga0439442_002361_1722_2453 243
458 3300042004 Ga0439445_0000060 Ga0439445_0000060_5905_6636 243
459 3300042006 Ga0439432_017104 Ga0439432_017104_239_970 243
460 3300042015 Ga0439462_0000195 Ga0439462_0000195_5915_6646 243
461 3300042156 Ga0439446_0074395 Ga0439446_0074395_34_765 243
462 3300042435 Ga0439434_0003840 Ga0439434_0003840_3129_3860 243
463 3300042435 Ga0439434_0007436 Ga0439434_0007436_1255_1986 243
464 3300042439 Ga0439464_0044684 Ga0439464_0044684_271_1008 243
465 3300044658 Ga0466972_0010895 Ga0466972_0010895_3270_4007 243
466 3300044658 Ga0466972_0068978 Ga0466972_0068978_422_1159 243
467 3300044683 Ga0466965_0084296 Ga0466965_0084296_673_1410 243
468 3300044693 Ga0466961_0221293 Ga0466961_0221293_340_1077 243
469 3300044694 Ga0466963_0014337 Ga0466963_0014337_1319_2056 243
470 3300044694 Ga0466963_0087573 Ga0466963_0087573_13_750 243
471 3300044719 Ga0466971_0013927 Ga0466971_0013927_331_1068 243
472 3300044735 Ga0466968_0042644 Ga0466968_0042644_242_979 243
473 3300044765 Ga0466970_0050313 Ga0466970_0050313_760_1497 243
474 3300044842 Ga0466957_0016826 Ga0466957_0016826_1217_1954 243
475 3300044901 Ga0466960_0003085 Ga0466960_0003085_4585_5322 243
476 3300044901 Ga0466960_0035587 Ga0466960_0035587_119_856 243
477 3300045836 Ga0466958_0012119 Ga0466958_0012119_1473_2210 243
478 3300045836 Ga0466958_0301418 Ga0466958_0301418_212_949 243
479 3300045976 Ga0466967_0007703 Ga0466967_0007703_4854_5591 243
480 3300045976 Ga0466967_0050831 Ga0466967_0050831_567_1304 243
481 3300046507 Ga0495606_0094008 Ga0495606_0094008_471_1202 243
482 3300046525 Ga0495663_0018160 Ga0495663_0018160_399_1136 243
483 3300046525 Ga0495663_0024238 Ga0495663_0024238_295_1032 243
484 3300046539 Ga0495621_0007456 Ga0495621_0007456_1148_1885 243
485 3300046558 Ga0495633_0130434 Ga0495633_0130434_291_1028 243
486 3300046660 Ga0495625_0257602 Ga0495625_0257602_304_1035 243
487 3300046692 Ga0495671_0003910 Ga0495671_0003910_4778_5509 243
488 3300047318 Ga0495636_0163863 Ga0495636_0163863_110_847 243
489 3300047469 Ga0495673_0084474 Ga0495673_0084474_41_775 243
490 3300047472 Ga0495686_0000366 Ga0495686_0000366_49870_50604 243
491 3300047472 Ga0495686_0000986 Ga0495686_0000986_27828_28559 243
492 3300048903 Ga0496100_0001542 Ga0496100_0001542_827_1564 243
493 3300048903 Ga0496100_0029233 Ga0496100_0029233_2356_3090 243
494 3300048904 Ga0496101_0003699 Ga0496101_0003699_4346_5083 243
495 3300048905 Ga0496102_0067110 Ga0496102_0067110_820_1554 243
496 3300048905 Ga0496102_0088970 Ga0496102_0088970_957_1688 243
497 3300048905 Ga0496102_0156222 Ga0496102_0156222_1221_1958 243
498 3300048906 Ga0496103_0003725 Ga0496103_0003725_7630_8364 243
499 3300048906 Ga0496103_0140695 Ga0496103_0140695_544_1281 243
500 3300048907 Ga0496104_0137687 Ga0496104_0137687_423_1160 243
501 3300048907 Ga0496104_0853155 Ga0496104_0853155_26_760 243
502 3300048908 Ga0496105_0171707 Ga0496105_0171707_434_1171 243
503 3300048909 Ga0496106_0121516 Ga0496106_0121516_304_1038 243
504 3300048910 Ga0496107_0018156 Ga0496107_0018156_2022_2759 243
505 3300048910 Ga0496107_0090106 Ga0496107_0090106_184_918 243
506 3300048911 Ga0496108_0156763 Ga0496108_0156763_697_1434 243
507 3300048912 Ga0496109_0178660 Ga0496109_0178660_1139_1876 243
508 3300048912 Ga0496109_0579378 Ga0496109_0579378_232_969 243
509 3300048913 Ga0496110_0219553 Ga0496110_0219553_271_1008 243
510 3300048914 Ga0496111_0125943 Ga0496111_0125943_845_1582 243
511 3300048915 Ga0496112_0105543 Ga0496112_0105543_1528_2265 243
512 3300048917 Ga0496114_0174873 Ga0496114_0174873_639_1376 243
513 3300048918 Ga0496115_0003674 Ga0496115_0003674_45_776 243
514 3300048919 Ga0496116_0121765 Ga0496116_0121765_574_1308 243
515 3300048920 Ga0496117_0012393 Ga0496117_0012393_3577_4308 243
516 3300048920 Ga0496117_0047279 Ga0496117_0047279_1523_2257 243
517 3300048920 Ga0496117_0063203 Ga0496117_0063203_1192_1923 243
518 3300048921 Ga0496118_0027239 Ga0496118_0027239_3391_4122 243
519 3300048921 Ga0496118_0098454 Ga0496118_0098454_144_875 243
520 3300048921 Ga0496118_0116649 Ga0496118_0116649_781_1512 243
521 3300048922 Ga0496119_0102222 Ga0496119_0102222_30_761 243
522 3300048923 Ga0496120_0071098 Ga0496120_0071098_871_1602 243
523 3300048923 Ga0496120_0233981 Ga0496120_0233981_20_751 243
524 3300048924 Ga0496121_0000650 Ga0496121_0000650_2494_3228 243
525 3300048924 Ga0496121_0040635 Ga0496121_0040635_2806_3540 243
526 3300048924 Ga0496121_0048915 Ga0496121_0048915_597_1328 243
527 3300048924 Ga0496121_0050973 Ga0496121_0050973_1172_1906 243
528 3300048924 Ga0496121_0126821 Ga0496121_0126821_478_1209 243
529 3300048925 Ga0496122_0028593 Ga0496122_0028593_536_1267 243
530 3300048925 Ga0496122_0135922 Ga0496122_0135922_103_834 243
531 3300048926 Ga0496123_0050545 Ga0496123_0050545_172_903 243
532 3300048926 Ga0496123_0081779 Ga0496123_0081779_172_903 243
533 3300048926 Ga0496123_0175105 Ga0496123_0175105_186_920 243
534 3300048927 Ga0496124_0000129 Ga0496124_0000129_6831_7562 243
535 3300048927 Ga0496124_0007123 Ga0496124_0007123_1054_1785 243
536 3300048927 Ga0496124_0113648 Ga0496124_0113648_156_887 243
537 3300048927 Ga0496124_0166013 Ga0496124_0166013_925_1659 243
538 3300048927 Ga0496124_0363207 Ga0496124_0363207_133_864 243
539 3300048928 Ga0496125_0017604 Ga0496125_0017604_813_1544 243
540 3300048928 Ga0496125_0105320 Ga0496125_0105320_1117_1848 243
541 3300048928 Ga0496125_0113688 Ga0496125_0113688_826_1560 243
542 3300048928 Ga0496125_0277712 Ga0496125_0277712_215_949 243
543 3300048929 Ga0496126_0046922 Ga0496126_0046922_276_1007 243
544 3300048929 Ga0496126_0077467 Ga0496126_0077467_1458_2192 243
545 3300048929 Ga0496126_0149598 Ga0496126_0149598_431_1162 243
546 3300049570 Ga0501033_0140763 Ga0501033_0140763_755_1489 243
547 3300049579 Ga0501043_0108214 Ga0501043_0108214_583_1317 243
548 3300049581 Ga0501047_0147011 Ga0501047_0147011_788_1519 243
549 3300049581 Ga0501047_0191251 Ga0501047_0191251_358_1125 243
550 3300049823 Ga0501044_0090163 Ga0501044_0090163_1253_2020 243
551 3300053087 Ga0500643_023449 Ga0500643_023449_61_792 243
552 3300053094 Ga0500566_0007362 Ga0500566_0007362_2994_3725 243
553 3300053116 Ga0500592_000050 Ga0500592_000050_29561_30292 243
554 3300053118 Ga0500594_0001614 Ga0500594_0001614_581_1312 243
555 3300053119 Ga0500595_015056 Ga0500595_015056_1156_1887 243
556 3300053134 Ga0500658_0048476 Ga0500658_0048476_230_961 243
557 3300053136 Ga0500559_0144605 Ga0500559_0144605_82_816 243
558 3300053140 Ga0500573_0000366 Ga0500573_0000366_11978_12709 243
559 3300053140 Ga0500573_0170376 Ga0500573_0170376_43_774 243
560 3300053142 Ga0500577_0061655 Ga0500577_0061655_404_1135 243
561 3300053158 Ga0500627_0000938 Ga0500627_0000938_2536_3267 243
562 3300053730 Ga0500645_005027 Ga0500645_005027_3742_4473 243
563 3300061719 Ga0466962_0005982 Ga0466962_0005982_3778_4515 243
564 2162886007 SwRhRL2b_contig_1489105 SwRhRL2b_0114.00005680 244
565 3300001904 JGI24736J21556_1002251 JGI24736J21556_10022513 244
566 3300001915 JGI24741J21665_1000549 JGI24741J21665_10005497 244
567 3300001979 JGI24740J21852_10005015 JGI24740J21852_100050156 244
568 3300001990 JGI24737J22298_10002940 JGI24737J22298_100029406 244
569 3300002067 JGI24735J21928_10002252 JGI24735J21928_100022522 244
570 3300002067 JGI24735J21928_10010004 JGI24735J21928_100100043 244
571 3300002077 JGI24744J21845_10002202 JGI24744J21845_100022022 244
572 3300005289 Ga0065704_10007250 Ga0065704_100072503 244
573 3300005289 Ga0065704_10072419 Ga0065704_100724197 244
574 3300005331 Ga0070670_100050727 Ga0070670_1000507272 244
575 3300005339 Ga0070660_100054688 Ga0070660_1000546883 244
576 3300005353 Ga0070669_100037676 Ga0070669_1000376763 244
577 3300005354 Ga0070675_100001516 Ga0070675_10000151615 244
578 3300005355 Ga0070671_100061130 Ga0070671_1000611302 244
579 3300005356 Ga0070674_100021920 Ga0070674_1000219204 244
580 3300005366 Ga0070659_100204838 Ga0070659_1002048382 244
581 3300005455 Ga0070663_100004890 Ga0070663_1000048901 244
582 3300005456 Ga0070678_100004810 Ga0070678_1000048103 244
583 3300005539 Ga0068853_100048683 Ga0068853_1000486833 244
584 3300005543 Ga0070672_100059421 Ga0070672_1000594213 244
585 3300005564 Ga0070664_100044891 Ga0070664_1000448912 244
586 3300005577 Ga0068857_100003501 Ga0068857_1000035012 244
587 3300005618 Ga0068864_100503707 Ga0068864_1005037072 244
588 3300005834 Ga0068851_10103684 Ga0068851_101036842 244
589 3300005842 Ga0068858_100243409 Ga0068858_1002434093 244
590 3300006042 Ga0075368_10000033 Ga0075368_1000003313 244
591 3300006178 Ga0075367_10000481 Ga0075367_1000048112 244
592 3300009011 Ga0105251_10017044 Ga0105251_100170444 244
593 3300009093 Ga0105240_10873625 Ga0105240_108736251 244
594 3300009174 Ga0105241_10008072 Ga0105241_100080722 244
595 3300009545 Ga0105237_10013028 Ga0105237_100130284 244
596 3300009553 Ga0105249_10325529 Ga0105249_103255292 244
597 3300009978 Ga0105148_100202 Ga0105148_1002028 244
598 3300013100 Ga0157373_10389734 Ga0157373_103897341 244
599 3300013102 Ga0157371_10177025 Ga0157371_101770252 244
600 3300013105 Ga0157369_10816810 Ga0157369_108168101 244
601 3300013307 Ga0157372_10404374 Ga0157372_104043741 244
602 3300014326 Ga0157380_10034756 Ga0157380_100347562 244
603 3300025321 Ga0207656_10049933 Ga0207656_100499332 244
604 3300025904 Ga0207647_10104017 Ga0207647_101040172 244
605 3300025909 Ga0207705_10000027 Ga0207705_1000002768 244
606 3300025911 Ga0207654_10049270 Ga0207654_100492702 244
607 3300025913 Ga0207695_10024580 Ga0207695_100245807 244
608 3300025914 Ga0207671_10203960 Ga0207671_102039602 244
609 3300025919 Ga0207657_10065116 Ga0207657_100651163 244
610 3300025920 Ga0207649_10352238 Ga0207649_103522381 244
611 3300025924 Ga0207694_10039527 Ga0207694_100395273 244
612 3300025925 Ga0207650_10033961 Ga0207650_100339612 244
613 3300025926 Ga0207659_10059191 Ga0207659_100591912 244
614 3300025931 Ga0207644_10067193 Ga0207644_100671931 244
615 3300025931 Ga0207644_10073678 Ga0207644_100736782 244
616 3300025932 Ga0207690_10205312 Ga0207690_102053122 244
617 3300025933 Ga0207706_10043654 Ga0207706_100436542 244
618 3300025937 Ga0207669_10055566 Ga0207669_100555663 244
619 3300025945 Ga0207679_10196654 Ga0207679_101966542 244
620 3300025949 Ga0207667_10277086 Ga0207667_102770862 244
621 3300025961 Ga0207712_10134447 Ga0207712_101344472 244
622 3300025981 Ga0207640_10228286 Ga0207640_102282861 244
623 3300026067 Ga0207678_10001799 Ga0207678_100017997 244
624 3300026078 Ga0207702_10002022 Ga0207702_100020227 244
625 3300026095 Ga0207676_10646159 Ga0207676_106461592 244
626 3300026116 Ga0207674_10010820 Ga0207674_1001082011 244
627 3300026121 Ga0207683_10010089 Ga0207683_100100896 244
628 3300026142 Ga0207698_10130366 Ga0207698_101303662 244
629 3300027866 Ga0209813_10000041 Ga0209813_1000004126 244
630 3300028379 Ga0268266_10376461 Ga0268266_103764612 244
631 3300031548 Ga0307408_100036711 Ga0307408_1000367114 244
632 3300031548 Ga0307408_100453026 Ga0307408_1004530262 244
633 3300031731 Ga0307405_10038560 Ga0307405_100385603 244
634 3300031852 Ga0307410_10019341 Ga0307410_100193414 244
635 3300031901 Ga0307406_10020481 Ga0307406_100204811 244
636 3300031911 Ga0307412_10000453 Ga0307412_1000045321 244
637 3300031911 Ga0307412_10132167 Ga0307412_101321672 244
638 3300032002 Ga0307416_100009701 Ga0307416_1000097017 244
639 3300032002 Ga0307416_100033727 Ga0307416_1000337274 244
640 3300032004 Ga0307414_10000248 Ga0307414_100002488 244
641 3300032004 Ga0307414_10373356 Ga0307414_103733562 244
642 3300032005 Ga0307411_10021318 Ga0307411_100213183 244
643 3300032005 Ga0307411_10106071 Ga0307411_101060712 244
644 3300046452 Ga0495617_029351 Ga0495617_029351_831_1568 244
645 3300046453 Ga0495627_006278 Ga0495627_006278_1731_2465 244
646 3300046453 Ga0495627_051928 Ga0495627_051928_373_1107 244
647 3300046506 Ga0495583_0001401 Ga0495583_0001401_14714_15457 244
648 3300046512 Ga0495610_0000206 Ga0495610_0000206_23232_23966 244
649 3300046512 Ga0495610_0049660 Ga0495610_0049660_1116_1850 244
650 3300046513 Ga0495616_0000189 Ga0495616_0000189_13169_13903 244
651 3300046519 Ga0495632_0001899 Ga0495632_0001899_15171_15908 244
652 3300046520 Ga0495637_0029360 Ga0495637_0029360_414_1148 244
653 3300046522 Ga0495643_0000162 Ga0495643_0000162_15521_16255 244
654 3300046524 Ga0495648_0000038 Ga0495648_0000038_140606_141349 244
655 3300046530 Ga0495654_0180699 Ga0495654_0180699_133_867 244
656 3300046557 Ga0495622_0093923 Ga0495622_0093923_234_968 244
657 3300046691 Ga0495670_0000028 Ga0495670_0000028_19659_20504 244
658 3300046692 Ga0495671_0000034 Ga0495671_0000034_128155_128898 244
659 3300046692 Ga0495671_0000062 Ga0495671_0000062_15521_16255 244
660 3300047469 Ga0495673_0000013 Ga0495673_0000013_200856_201599 244
661 3300047470 Ga0495681_0000106 Ga0495681_0000106_35996_36730 244
662 3300047470 Ga0495681_0008636 Ga0495681_0008636_55_789 244
663 3300047472 Ga0495686_0071813 Ga0495686_0071813_907_1641 244
664 3300048905 Ga0496102_0270111 Ga0496102_0270111_40_774 244
665 3300048909 Ga0496106_0205599 Ga0496106_0205599_150_884 244
666 3300048911 Ga0496108_0013686 Ga0496108_0013686_598_1332 244
667 3300048911 Ga0496108_0032889 Ga0496108_0032889_3103_3837 244
668 3300048913 Ga0496110_0016041 Ga0496110_0016041_4804_5538 244
669 3300048913 Ga0496110_0023804 Ga0496110_0023804_2146_2880 244
670 3300048914 Ga0496111_0022461 Ga0496111_0022461_1311_2045 244
671 3300048916 Ga0496113_0015706 Ga0496113_0015706_3747_4481 244
672 3300048920 Ga0496117_0014638 Ga0496117_0014638_3631_4365 244
673 3300048921 Ga0496118_0163339 Ga0496118_0163339_440_1174 244
674 3300048924 Ga0496121_0000175 Ga0496121_0000175_96850_97584 244
675 3300048925 Ga0496122_0026729 Ga0496122_0026729_2217_2951 244
676 3300048927 Ga0496124_0006227 Ga0496124_0006227_4582_5316 244
677 3300048927 Ga0496124_0089345 Ga0496124_0089345_933_1667 244
678 3300048927 Ga0496124_0214970 Ga0496124_0214970_81_815 244
679 3300048927 Ga0496124_0239613 Ga0496124_0239613_187_921 244
680 3300048928 Ga0496125_0000445 Ga0496125_0000445_35454_36188 244
681 3300048928 Ga0496125_0007177 Ga0496125_0007177_7612_8346 244
682 3300048928 Ga0496125_0142321 Ga0496125_0142321_94_828 244
683 3300048929 Ga0496126_0202533 Ga0496126_0202533_793_1527 244
684 3300049571 Ga0501034_0069690 Ga0501034_0069690_413_1147 244
685 3300049658 Ga0501211_005276 Ga0501211_005276_161_895 244
686 3300049663 Ga0501223_000066 Ga0501223_000066_22715_23449 244
687 3300049663 Ga0501223_000317 Ga0501223_000317_9065_9814 244
688 3300049664 Ga0501224_000076 Ga0501224_000076_462_1211 244
689 3300049668 Ga0501233_000558 Ga0501233_000558_268_1002 244
690 3300049669 Ga0501235_003738 Ga0501235_003738_2243_2977 244
691 3300049669 Ga0501235_041828 Ga0501235_041828_165_899 244
692 3300049705 Ga0501225_0000137 Ga0501225_0000137_9224_9958 244
693 3300049705 Ga0501225_0000228 Ga0501225_0000228_14137_14886 244
694 3300049705 Ga0501225_0008682 Ga0501225_0008682_1308_2042 244
695 3300049707 Ga0501234_000767 Ga0501234_000767_367_1116 244
696 3300049853 Ga0501226_000183 Ga0501226_000183_9065_9814 244
697 3300050494 nmdc:mga06z11_9_c1 nmdc:mga06z11_9_c1_29821_30555 244
698 3300050495 nmdc:mga04h51_12_c1 nmdc:mga04h51_12_c1_79428_80162 244
699 3300053108 Ga0500562_029007 Ga0500562_029007_567_1301 244
700 3300053153 Ga0500616_0105036 Ga0500616_0105036_547_1329 244
701 3300053157 Ga0500624_000084 Ga0500624_000084_40735_41469 244
702 3300053158 Ga0500627_0000452 Ga0500627_0000452_1585_2319 244
703 iso_pu_bacteria 2775507255 2778124399 244
704 iso_pu_bacteria 2984564862 2984568279 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02565

RecO_C

Recombination protein O C terminal

124

263

0.93

PF11967

RecO_N

Recombination protein O N terminal

39

115

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.8049 5 238
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.7947 3 77
3q8d-assembly1.cif.gz_A e. coli reco complex with ssb c-terminus 0.789 5 238
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.7709 4 61
3m4q-assembly1.cif.gz_B entamoeba histolytica asparaginyl-trna synthetase (asnrs) 0.7581 2 77
ID Description Score Start End Superfamily
3q8dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8446 5 74 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8363 4 81 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8349 1 80 2.40.50.140
af_P9WHI5_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8074 1 80 2.40.50.140
4jcvF01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8057 4 81 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0A6D315-F1-model_v4 DNA recombination protein RecO 0.9881 93 244 GO:0006281
GO:0006310
AF-A5VEW5-F1-model_v4 DNA repair protein RecO (Recombination protein O) 0.9838 2 241 GO:0006302
GO:0006310
GO:0043590
AF-A0A5A7N7C2-F1-model_v4 DNA replication/recombination mediator RecO N-terminal domain-containing protein 0.9793 2 123 GO:0006302
GO:0006310
GO:0043590
AF-A0A355BZV3-F1-model_v4 DNA repair protein RecO 0.9737 2 124 GO:0006302
GO:0006310
GO:0043590
AF-J3A9D5-F1-model_v4 Recombinational DNA repair protein (RecF pathway) 0.9725 2 85

Feature Viewer

pLDDT pTM Quality
94.99 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map