F476047

General Info

Members Datasets Scaffolds Average Seq Length
699 286 1398 285

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0053918|Ga0495592_0053918_1477_2478
Length 333
Sequence MVALLNKASGKLYGGGSFAVKHVSGILDRVLELIAQHFAWAQNPVVLARQMLAGVSTGMLLFLISAGLSLIFGVLRILNFAHGALFMLGALIAVSIAALLPDSLVGFAAALVGAAAGLALLGAAIETKLLRRIYREPHEMQLLLTFALVFVLGDAAKLIWGREEHSVGMPAMLTGGVHAFGLVFPLYRLFLIAAGAVVAAGLWLTLYRTRWGVLVRAATMDREMLSALGVNTRTLFTTVFTLGAALAGLGGALAAPVIAVGPGLHVQVLIDAFTVVVIGGLGSVLGAFVASLLVGLVNAFGVLAFPGIAVVLTFACMAVVLIVRPRGLLGSAE

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
188 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
189 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
190 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
193 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
194 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
273 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2643221672 Variovorax sp. Root434 Isolate Unclassified
283 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
284 2842747753 Variovorax sp. R-72060 Isolate Unclassified
285 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
286 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0.14
Rhizoplane 1.43
Rhizosphere 96.57
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0053918 3300046454 Bacteria 2981
2 JGI26129J50193_1000765 3300003349 Bacteria 2067
3 JGI25404J52841_10037115 3300003659 Bacteria 1036
4 Ga0065715_10100061 3300005293 Bacteria 3341
5 Ga0070676_10000671 3300005328 Bacteria 16689
6 Ga0070676_10007040 3300005328 Bacteria 6020
7 Ga0070683_100164067 3300005329 Bacteria 2108
8 Ga0070690_100056057 3300005330 Bacteria 2526
9 Ga0070670_100039225 3300005331 Bacteria 4073
10 Ga0070670_100184780 3300005331 Bacteria 1810
11 Ga0068869_100017694 3300005334 Bacteria 4838
12 Ga0068869_100028275 3300005334 Bacteria 3917
13 Ga0070666_10074768 3300005335 Bacteria 2310
14 Ga0070680_100003078 3300005336 Bacteria 12376
15 Ga0070680_100116665 3300005336 Bacteria 2226
16 Ga0070682_100019038 3300005337 Bacteria 4021
17 Ga0070660_100007427 3300005339 Bacteria 7639
18 Ga0070691_10001482 3300005341 Bacteria 10069
19 Ga0070691_10005679 3300005341 Bacteria 5691
20 Ga0070691_10041733 3300005341 Bacteria 2170
21 Ga0070661_100011652 3300005344 Bacteria 6131
22 Ga0070668_100003095 3300005347 Bacteria 12292
23 Ga0070668_100013677 3300005347 Bacteria 6060
24 Ga0070669_100010583 3300005353 Bacteria 6550
25 Ga0070669_100069287 3300005353 Bacteria 2605
26 Ga0070669_100305921 3300005353 Bacteria 1280
27 Ga0070675_100324383 3300005354 Bacteria 1361
28 Ga0070659_100000378 3300005366 Bacteria 33675
29 Ga0070667_100031677 3300005367 Bacteria 4408
30 Ga0070667_100123166 3300005367 Bacteria 2257
31 Ga0070667_100326546 3300005367 Bacteria 1385
32 Ga0070701_10078408 3300005438 Bacteria 1782
33 Ga0070711_100105079 3300005439 Bacteria 2062
34 Ga0070705_100001984 3300005440 Bacteria 10450
35 Ga0070705_100069266 3300005440 Bacteria 2126
36 Ga0070705_100099299 3300005440 Bacteria 1834
37 Ga0070700_100031315 3300005441 Bacteria 3186
38 Ga0070694_100000180 3300005444 Bacteria 32964
39 Ga0070694_100008191 3300005444 Bacteria 6386
40 Ga0070694_100051245 3300005444 Bacteria 2786
41 Ga0070694_100069186 3300005444 Bacteria 2428
42 Ga0070708_100006859 3300005445 Bacteria 9084
43 Ga0070708_100007769 3300005445 Bacteria 8593
44 Ga0070708_100017627 3300005445 Bacteria 5962
45 Ga0070708_100026088 3300005445 Bacteria 4999
46 Ga0070708_100036829 3300005445 Bacteria 4267
47 Ga0070708_100223077 3300005445 Bacteria 1768
48 Ga0070708_100256949 3300005445 Bacteria 1642
49 Ga0070663_100000411 3300005455 Bacteria 22470
50 Ga0070662_100007636 3300005457 Bacteria 7019
51 Ga0070662_100088065 3300005457 Bacteria 2326
52 Ga0070662_100177163 3300005457 Bacteria 1679
53 Ga0070681_10005266 3300005458 Bacteria 12490
54 Ga0070681_10115315 3300005458 Bacteria 2625
55 Ga0070681_10634455 3300005458 Bacteria 983
56 Ga0068867_100144810 3300005459 Bacteria 1861
57 Ga0068867_100144813 3300005459 Bacteria 1861
58 Ga0068867_100346644 3300005459 Bacteria 1238
59 Ga0070706_100002529 3300005467 Bacteria 18394
60 Ga0070706_100021306 3300005467 Bacteria 5970
61 Ga0070706_100078894 3300005467 Bacteria 3048
62 Ga0070706_100240194 3300005467 Bacteria 1691
63 Ga0070706_100330477 3300005467 Bacteria 1421
64 Ga0070706_100330950 3300005467 Bacteria 1420
65 Ga0070706_100431211 3300005467 Bacteria 1227
66 Ga0070707_100008063 3300005468 Bacteria 9777
67 Ga0070707_100064154 3300005468 Bacteria 3526
68 Ga0070707_100091259 3300005468 Bacteria 2949
69 Ga0070707_100130005 3300005468 Bacteria 2448
70 Ga0070698_100001598 3300005471 Bacteria 25206
71 Ga0070698_100036902 3300005471 Bacteria 5043
72 Ga0070698_100070457 3300005471 Bacteria 3508
73 Ga0070698_100094100 3300005471 Bacteria 2976
74 Ga0070698_100176589 3300005471 Bacteria 2075
75 Ga0070698_100215425 3300005471 Bacteria 1854
76 Ga0070698_100282861 3300005471 Unclassified 1590
77 Ga0070699_100026770 3300005518 Bacteria 4974
78 Ga0070699_100028604 3300005518 Bacteria 4806
79 Ga0070699_100033681 3300005518 Bacteria 4426
80 Ga0070699_100042334 3300005518 Bacteria 3941
81 Ga0070699_100100252 3300005518 Bacteria 2538
82 Ga0070699_100195829 3300005518 Bacteria 1796
83 Ga0070699_100209902 3300005518 Bacteria 1733
84 Ga0070699_100324779 3300005518 Bacteria 1383
85 Ga0070699_100386606 3300005518 Bacteria 1264
86 Ga0070679_100003620 3300005530 Bacteria 14125
87 Ga0070679_100206127 3300005530 Bacteria 1931
88 Ga0070684_100247803 3300005535 Bacteria 1628
89 Ga0070697_100001896 3300005536 Bacteria 15983
90 Ga0070697_100005548 3300005536 Bacteria 9726
91 Ga0070697_100120175 3300005536 Bacteria 2197
92 Ga0070697_100180859 3300005536 Bacteria 1787
93 Ga0070697_100320139 3300005536 Bacteria 1335
94 Ga0068853_100000344 3300005539 Bacteria 32315
95 Ga0070672_100314461 3300005543 Bacteria 1330
96 Ga0070695_100000324 3300005545 Bacteria 24496
97 Ga0070695_100012280 3300005545 Bacteria 5137
98 Ga0070695_100022314 3300005545 Bacteria 3882
99 Ga0070695_100030642 3300005545 Bacteria 3350
100 Ga0070695_100043067 3300005545 Bacteria 2869
101 Ga0070696_100016488 3300005546 Bacteria 4977
102 Ga0070696_100017783 3300005546 Bacteria 4800
103 Ga0070696_100027972 3300005546 Bacteria 3845
104 Ga0070696_100075344 3300005546 Bacteria 2380
105 Ga0070696_100081298 3300005546 Bacteria 2295
106 Ga0070696_100137255 3300005546 Bacteria 1784
107 Ga0070693_100000444 3300005547 Bacteria 18604
108 Ga0070693_100066427 3300005547 Bacteria 2111
109 Ga0070665_100017846 3300005548 Bacteria 7124
110 Ga0070665_100752912 3300005548 Bacteria 987
111 Ga0070704_100004554 3300005549 Bacteria 8007
112 Ga0070704_100024273 3300005549 Bacteria 3977
113 Ga0068855_100004550 3300005563 Bacteria 16934
114 Ga0070664_100003289 3300005564 Bacteria 13047
115 Ga0068857_100008826 3300005577 Bacteria 8732
116 Ga0068857_100377408 3300005577 Bacteria 1316
117 Ga0068857_100431793 3300005577 Bacteria 1229
118 Ga0068854_100001108 3300005578 Bacteria 16223
119 Ga0068856_100001066 3300005614 Bacteria 29020
120 Ga0068859_100286819 3300005617 Bacteria 1739
121 Ga0068864_100290387 3300005618 Bacteria 1529
122 Ga0068866_10071343 3300005718 Bacteria 1837
123 Ga0068861_100014057 3300005719 Bacteria 5613
124 Ga0068861_100051266 3300005719 Bacteria 3132
125 Ga0068861_100179341 3300005719 Bacteria 1762
126 Ga0068861_100373894 3300005719 Bacteria 1257
127 Ga0068863_100049127 3300005841 Bacteria 4000
128 Ga0068863_100068915 3300005841 Bacteria 3346
129 Ga0068858_100293581 3300005842 Bacteria 1550
130 Ga0068858_100332125 3300005842 Bacteria 1454
131 Ga0068860_100124869 3300005843 Bacteria 2467
132 Ga0068860_100129145 3300005843 Bacteria 2424
133 Ga0068860_100163210 3300005843 Bacteria 2149
134 Ga0068860_100182857 3300005843 Bacteria 2026
135 Ga0068860_100272594 3300005843 Bacteria 1652
136 Ga0068862_100007015 3300005844 Bacteria 9354
137 Ga0068862_100025870 3300005844 Bacteria 4929
138 Ga0068862_100026077 3300005844 Bacteria 4913
139 Ga0068862_100039291 3300005844 Bacteria 4018
140 Ga0068862_100165521 3300005844 Bacteria 1976
141 Ga0068862_100342900 3300005844 Bacteria 1384
142 Ga0081455_10000041 3300005937 Bacteria 134032
143 Ga0081455_10000882 3300005937 Bacteria 38856
144 Ga0081455_10025615 3300005937 Bacteria 5440
145 Ga0081538_10029736 3300005981 Bacteria 3725
146 Ga0081540_1000091 3300005983 Bacteria 94664
147 Ga0081540_1003214 3300005983 Bacteria 13021
148 Ga0081539_10000266 3300005985 Bacteria 119926
149 Ga0075368_10001440 3300006042 Bacteria 7610
150 Ga0075363_100012495 3300006048 Bacteria 4096
151 Ga0070712_100069042 3300006175 Bacteria 2520
152 Ga0075367_10003360 3300006178 Bacteria 7610
153 Ga0075427_10013182 3300006194 Bacteria 1262
154 Ga0075366_10084214 3300006195 Bacteria 1901
155 Ga0097621_100512292 3300006237 Bacteria 1088
156 Ga0068871_100288551 3300006358 Bacteria 1437
157 Ga0075428_100000159 3300006844 Bacteria 61724
158 Ga0075428_100001683 3300006844 Bacteria 23566
159 Ga0075428_100003162 3300006844 Bacteria 17988
160 Ga0075428_100013632 3300006844 Bacteria 9051
161 Ga0075428_100017673 3300006844 Bacteria 7881
162 Ga0075428_100021600 3300006844 Bacteria 7125
163 Ga0075428_100024043 3300006844 Bacteria 6743
164 Ga0075428_100047930 3300006844 Bacteria 4692
165 Ga0075428_100157660 3300006844 Bacteria 2465
166 Ga0075428_100268016 3300006844 Bacteria 1838
167 Ga0075428_100346419 3300006844 Bacteria 1595
168 Ga0075430_100000022 3300006846 Bacteria 81752
169 Ga0075430_100007740 3300006846 Bacteria 9076
170 Ga0075430_100024569 3300006846 Bacteria 5126
171 Ga0075430_100027411 3300006846 Bacteria 4840
172 Ga0075430_100057101 3300006846 Bacteria 3283
173 Ga0075430_100064037 3300006846 Bacteria 3088
174 Ga0075430_100157277 3300006846 Bacteria 1892
175 Ga0075430_100451721 3300006846 Bacteria 1061
176 Ga0075431_100000058 3300006847 Bacteria 61801
177 Ga0075431_100005240 3300006847 Bacteria 12764
178 Ga0075431_100008769 3300006847 Bacteria 10133
179 Ga0075431_100010677 3300006847 Bacteria 9227
180 Ga0075431_100010992 3300006847 Bacteria 9112
181 Ga0075431_100012252 3300006847 Bacteria 8655
182 Ga0075431_100021774 3300006847 Bacteria 6554
183 Ga0075431_100037522 3300006847 Bacteria 4991
184 Ga0075431_100038803 3300006847 Bacteria 4907
185 Ga0075431_100214395 3300006847 Bacteria 1966
186 Ga0075431_100381253 3300006847 Bacteria 1414
187 Ga0075431_100542345 3300006847 Bacteria 1151
188 Ga0075433_10000322 3300006852 Bacteria 29299
189 Ga0075433_10009434 3300006852 Bacteria 7797
190 Ga0075433_10092681 3300006852 Bacteria 2672
191 Ga0075433_10331582 3300006852 Bacteria 1345
192 Ga0075434_100002809 3300006871 Bacteria 15419
193 Ga0075434_100005649 3300006871 Bacteria 11412
194 Ga0075434_100010207 3300006871 Bacteria 8794
195 Ga0075434_100061335 3300006871 Bacteria 3741
196 Ga0075434_100073407 3300006871 Bacteria 3414
197 Ga0075434_100191919 3300006871 Bacteria 2063
198 Ga0075434_100281413 3300006871 Bacteria 1683
199 Ga0075434_100470009 3300006871 Bacteria 1279
200 Ga0075434_100473695 3300006871 Bacteria 1273
201 Ga0075429_100000072 3300006880 Bacteria 50828
202 Ga0075429_100001141 3300006880 Bacteria 21427
203 Ga0075429_100048188 3300006880 Bacteria 3707
204 Ga0075429_100065029 3300006880 Bacteria 3175
205 Ga0075429_100069998 3300006880 Bacteria 3054
206 Ga0075429_100097284 3300006880 Bacteria 2568
207 Ga0075429_100117001 3300006880 Bacteria 2329
208 Ga0075429_100212690 3300006880 Bacteria 1694
209 Ga0075429_100443368 3300006880 Bacteria 1138
210 Ga0068865_100011450 3300006881 Bacteria 5555
211 Ga0068865_100228254 3300006881 Bacteria 1459
212 Ga0075436_100023349 3300006914 Bacteria 4248
213 Ga0075436_100048441 3300006914 Bacteria 2932
214 Ga0075436_100063857 3300006914 Bacteria 2544
215 Ga0075436_100236461 3300006914 Bacteria 1298
216 Ga0097620_100286815 3300006931 Bacteria 1739
217 Ga0075435_100024255 3300007076 Bacteria 4704
218 Ga0075435_100095031 3300007076 Bacteria 2465
219 Ga0075435_100180379 3300007076 Bacteria 1784
220 Ga0075435_100306747 3300007076 Bacteria 1358
221 Ga0099794_10000986 3300007265 Bacteria 9601
222 Ga0099794_10046425 3300007265 Bacteria 2080
223 Ga0099794_10084462 3300007265 Bacteria 1570
224 Ga0105240_10317845 3300009093 Unclassified 1776
225 Ga0105240_10439455 3300009093 Bacteria 1462
226 Ga0111539_10000353 3300009094 Bacteria 56556
227 Ga0111539_10004083 3300009094 Bacteria 19157
228 Ga0111539_10014325 3300009094 Bacteria 9900
229 Ga0111539_10023137 3300009094 Bacteria 7631
230 Ga0111539_10032294 3300009094 Bacteria 6357
231 Ga0111539_10033857 3300009094 Bacteria 6199
232 Ga0111539_10081263 3300009094 Bacteria 3812
233 Ga0111539_10144645 3300009094 Bacteria 2783
234 Ga0111539_10397399 3300009094 Bacteria 1605
235 Ga0105245_10057491 3300009098 Bacteria 3498
236 Ga0105247_10235975 3300009101 Bacteria 1244
237 Ga0114129_10000046 3300009147 Bacteria 105492
238 Ga0114129_10006267 3300009147 Bacteria 16858
239 Ga0114129_10014694 3300009147 Bacteria 11154
240 Ga0114129_10017939 3300009147 Bacteria 10076
241 Ga0114129_10019878 3300009147 Bacteria 9558
242 Ga0114129_10050965 3300009147 Bacteria 5812
243 Ga0114129_10127048 3300009147 Bacteria 3505
244 Ga0114129_10146039 3300009147 Bacteria 3240
245 Ga0114129_10237129 3300009147 Bacteria 2454
246 Ga0114129_10267258 3300009147 Bacteria 2290
247 Ga0114129_10273270 3300009147 Bacteria 2260
248 Ga0114129_10304934 3300009147 Bacteria 2121
249 Ga0114129_10759708 3300009147 Bacteria 1240
250 Ga0114129_11071209 3300009147 Bacteria 1011
251 Ga0105243_10089024 3300009148 Bacteria 2537
252 Ga0105243_10192757 3300009148 Bacteria 1781
253 Ga0105241_10073202 3300009174 Bacteria 2665
254 Ga0105241_10190879 3300009174 Bacteria 1705
255 Ga0105242_10011961 3300009176 Bacteria 6681
256 Ga0105242_10144589 3300009176 Bacteria 2067
257 Ga0105248_10237925 3300009177 Bacteria 2050
258 Ga0105237_10163756 3300009545 Unclassified 2223
259 Ga0105249_10100098 3300009553 Bacteria 2725
260 Ga0105249_10482552 3300009553 Bacteria 1283
261 Ga0157373_10000079 3300013100 Bacteria 82786
262 Ga0157371_10089821 3300013102 Bacteria 2176
263 Ga0157369_10162534 3300013105 Bacteria 2356
264 Ga0157378_10079383 3300013297 Bacteria 2963
265 Ga0157378_10459780 3300013297 Bacteria 1264
266 Ga0163162_10019100 3300013306 Bacteria 6721
267 Ga0157372_10002520 3300013307 Bacteria 19860
268 Ga0157375_10032184 3300013308 Bacteria 4971
269 Ga0163163_10217026 3300014325 Bacteria 1962
270 Ga0157380_10169218 3300014326 Bacteria 1907
271 Ga0157379_10218778 3300014968 Bacteria 1725
272 Ga0182007_10037352 3300015262 Bacteria 1632
273 Ga0207653_10001179 3300025885 Bacteria 8538
274 Ga0207653_10020592 3300025885 Bacteria 2088
275 Ga0207653_10056412 3300025885 Bacteria 1317
276 Ga0207653_10069124 3300025885 Bacteria 1204
277 Ga0207642_10156620 3300025899 Bacteria 1218
278 Ga0207680_10092642 3300025903 Bacteria 1926
279 Ga0207685_10090996 3300025905 Bacteria 1285
280 Ga0207699_10009512 3300025906 Bacteria 4843
281 Ga0207645_10000683 3300025907 Bacteria 28120
282 Ga0207645_10079119 3300025907 Bacteria 2107
283 Ga0207643_10000087 3300025908 Bacteria 61041
284 Ga0207684_10014094 3300025910 Bacteria 6903
285 Ga0207684_10020517 3300025910 Bacteria 5647
286 Ga0207684_10020798 3300025910 Bacteria 5607
287 Ga0207684_10027632 3300025910 Bacteria 4832
288 Ga0207684_10107621 3300025910 Bacteria 2385
289 Ga0207684_10108475 3300025910 Bacteria 2376
290 Ga0207684_10373306 3300025910 Bacteria 1227
291 Ga0207684_10466986 3300025910 Unclassified 1083
292 Ga0207654_10006561 3300025911 Bacteria 5851
293 Ga0207654_10052220 3300025911 Bacteria 2355
294 Ga0207707_10000197 3300025912 Bacteria 63923
295 Ga0207707_10163337 3300025912 Bacteria 1947
296 Ga0207707_10217978 3300025912 Bacteria 1661
297 Ga0207693_10029816 3300025915 Bacteria 4306
298 Ga0207693_10159041 3300025915 Bacteria 1777
299 Ga0207660_10001135 3300025917 Bacteria 17803
300 Ga0207660_10049606 3300025917 Bacteria 2977
301 Ga0207660_10080556 3300025917 Bacteria 2392
302 Ga0207662_10195352 3300025918 Bacteria 1307
303 Ga0207657_10000264 3300025919 Bacteria 55674
304 Ga0207649_10006541 3300025920 Bacteria 6329
305 Ga0207652_10000553 3300025921 Bacteria 37682
306 Ga0207646_10001806 3300025922 Bacteria 25880
307 Ga0207646_10018188 3300025922 Bacteria 6559
308 Ga0207646_10038411 3300025922 Bacteria 4313
309 Ga0207646_10090198 3300025922 Bacteria 2744
310 Ga0207646_10159909 3300025922 Bacteria 2032
311 Ga0207681_10052722 3300025923 Bacteria 2759
312 Ga0207681_10129450 3300025923 Bacteria 1864
313 Ga0207681_10199212 3300025923 Bacteria 1536
314 Ga0207650_10029765 3300025925 Bacteria 3927
315 Ga0207650_10040303 3300025925 Bacteria 3417
316 Ga0207650_10180210 3300025925 Bacteria 1683
317 Ga0207659_10216183 3300025926 Bacteria 1539
318 Ga0207690_10006978 3300025932 Bacteria 6696
319 Ga0207706_10016175 3300025933 Bacteria 6740
320 Ga0207706_10034278 3300025933 Bacteria 4516
321 Ga0207706_10177131 3300025933 Bacteria 1873
322 Ga0207686_10043619 3300025934 Bacteria 2749
323 Ga0207709_10111550 3300025935 Bacteria 1830
324 Ga0207709_10130296 3300025935 Bacteria 1713
325 Ga0207670_10062456 3300025936 Bacteria 2546
326 Ga0207670_10072660 3300025936 Bacteria 2382
327 Ga0207691_10140973 3300025940 Bacteria 2125
328 Ga0207691_10274901 3300025940 Bacteria 1450
329 Ga0207711_10394353 3300025941 Bacteria 1285
330 Ga0207689_10000141 3300025942 Bacteria 61620
331 Ga0207689_10026534 3300025942 Bacteria 4852
332 Ga0207661_10102738 3300025944 Bacteria 2404
333 Ga0207679_10001160 3300025945 Bacteria 16780
334 Ga0207667_10001531 3300025949 Bacteria 29047
335 Ga0207712_10060592 3300025961 Bacteria 2683
336 Ga0207668_10002407 3300025972 Bacteria 10941
337 Ga0207640_10000986 3300025981 Bacteria 15781
338 Ga0207640_10202143 3300025981 Bacteria 1506
339 Ga0207658_10304430 3300025986 Bacteria 1374
340 Ga0207658_10316490 3300025986 Bacteria 1350
341 Ga0207658_10533818 3300025986 Bacteria 1048
342 Ga0207639_10002524 3300026041 Bacteria 12276
343 Ga0207678_10002927 3300026067 Bacteria 15486
344 Ga0207708_10020127 3300026075 Bacteria 5032
345 Ga0207702_10000986 3300026078 Bacteria 29140
346 Ga0207641_10082874 3300026088 Bacteria 2787
347 Ga0207641_10105938 3300026088 Bacteria 2484
348 Ga0207648_10003434 3300026089 Bacteria 16627
349 Ga0207648_10031784 3300026089 Bacteria 4665
350 Ga0207648_10088658 3300026089 Bacteria 2701
351 Ga0207648_10227967 3300026089 Bacteria 1657
352 Ga0207674_10000412 3300026116 Bacteria 55670
353 Ga0207674_10022329 3300026116 Bacteria 6795
354 Ga0207674_10098340 3300026116 Bacteria 2910
355 Ga0207675_100022600 3300026118 Bacteria 5854
356 Ga0207675_100029538 3300026118 Bacteria 5107
357 Ga0207675_100076624 3300026118 Bacteria 3132
358 Ga0207675_100157543 3300026118 Bacteria 2164
359 Ga0207675_100264755 3300026118 Bacteria 1667
360 Ga0209981_1000603 3300027378 Bacteria 4535
361 Ga0209996_1000182 3300027395 Bacteria 8068
362 Ga0210000_1015202 3300027462 Bacteria 1157
363 Ga0209995_1001092 3300027471 Bacteria 4166
364 Ga0209999_1001064 3300027543 Bacteria 4668
365 Ga0209970_1000754 3300027614 Bacteria 5641
366 Ga0209983_1001869 3300027665 Bacteria 4680
367 Ga0209588_1000014 3300027671 Bacteria 133062
368 Ga0209588_1006238 3300027671 Bacteria 3456
369 Ga0209588_1023325 3300027671 Bacteria 1949
370 Ga0209588_1025030 3300027671 Bacteria 1887
371 Ga0209588_1051865 3300027671 Bacteria 1327
372 Ga0209971_1000336 3300027682 Bacteria 12991
373 Ga0209966_1001628 3300027695 Bacteria 3839
374 Ga0209966_1020761 3300027695 Bacteria 1275
375 Ga0209998_10000256 3300027717 Bacteria 17465
376 Ga0209813_10003276 3300027866 Bacteria 3779
377 Ga0209974_10000509 3300027876 Bacteria 12986
378 Ga0207428_10000009 3300027907 Bacteria 410565
379 Ga0207428_10003480 3300027907 Bacteria 15273
380 Ga0207428_10008368 3300027907 Bacteria 9345
381 Ga0207428_10010309 3300027907 Bacteria 8352
382 Ga0207428_10024614 3300027907 Bacteria 5054
383 Ga0207428_10180064 3300027907 Bacteria 1597
384 Ga0268265_10006793 3300028380 Bacteria 7744
385 Ga0268265_10019666 3300028380 Bacteria 4700
386 Ga0268265_10020538 3300028380 Bacteria 4610
387 Ga0268265_10138363 3300028380 Bacteria 2035
388 Ga0268265_10184635 3300028380 Bacteria 1795
389 Ga0268264_10035662 3300028381 Bacteria 4095
390 Ga0268264_10058832 3300028381 Bacteria 3219
391 Ga0268264_10107380 3300028381 Bacteria 2438
392 Ga0268264_10184195 3300028381 Bacteria 1899
393 Ga0307513_10116433 3300031456 Bacteria 2652
394 Ga0307408_100000739 3300031548 Bacteria 26410
395 Ga0307405_10457008 3300031731 Bacteria 1014
396 Ga0307413_10083873 3300031824 Bacteria 2052
397 Ga0307412_10000207 3300031911 Bacteria 40047
398 Ga0307416_100010841 3300032002 Bacteria 6043
399 Ga0307414_10008565 3300032004 Bacteria 5812
400 Ga0373959_0030134 3300034820 Bacteria 1092
401 Ga0373928_0011976 3300035084 Bacteria 1725
402 Ga0373940_0001624 3300035088 Bacteria 4130
403 Ga0373952_0016040 3300035092 Bacteria 1518
404 Ga0373932_0004496 3300035112 Bacteria 3294
405 Ga0373932_0009664 3300035112 Bacteria 2323
406 Ga0373939_0010504 3300035114 Bacteria 2317
407 Ga0373960_0052706 3300035121 Bacteria 1212
408 Ga0373961_0072407 3300035241 Bacteria 1068
409 Ga0373962_0001746 3300035242 Bacteria 5170
410 Ga0373962_0004216 3300035242 Bacteria 3467
411 Ga0373924_0022374 3300035410 Bacteria 2472
412 Ga0373931_0002758 3300035691 Bacteria 7817
413 Ga0373931_0003440 3300035691 Bacteria 7110
414 Ga0373931_0007012 3300035691 Bacteria 5302
415 Ga0373931_0088572 3300035691 Bacteria 1720
416 Ga0373927_0207007 3300035695 Bacteria 1288
417 Ga0373933_0004287 3300035724 Bacteria 7835
418 Ga0373937_0009713 3300036401 Bacteria 8388
419 Ga0395899_0156079 3300037312 Bacteria 1615
420 Ga0395900_0005351 3300037418 Bacteria 13450
421 Ga0395900_0041823 3300037418 Bacteria 4723
422 Ga0395898_0022324 3300037466 Bacteria 6409
423 Ga0395901_0024766 3300038443 Bacteria 6161
424 Ga0395901_0080715 3300038443 Bacteria 3397
425 Ga0242420_024447 3300038996 Bacteria 1094
426 Ga0439453_0008025 3300041408 Bacteria 1688
427 Ga0439441_019471 3300042001 Bacteria 1235
428 Ga0439443_017615 3300042003 Bacteria 1100
429 Ga0439450_019076 3300042008 Bacteria 1448
430 Ga0439458_0008499 3300042157 Bacteria 2287
431 Ga0439435_0000682 3300042436 Bacteria 5649
432 Ga0439459_0001595 3300042438 Bacteria 3377
433 Ga0439464_0018171 3300042439 Bacteria 1912
434 Ga0439460_0000204 3300042461 Bacteria 11677
435 Ga0439460_0041007 3300042461 Bacteria 1359
436 Ga0439460_0069645 3300042461 Bacteria 1088
437 Ga0451577_0004021 3300042876 Bacteria 15813
438 Ga0451577_0025225 3300042876 Bacteria 5396
439 Ga0451577_0029956 3300042876 Bacteria 4916
440 Ga0451577_0185037 3300042876 Bacteria 1878
441 Ga0453683_0013754 3300044673 Bacteria 5267
442 Ga0453683_0018982 3300044673 Bacteria 4410
443 Ga0453683_0047362 3300044673 Bacteria 2695
444 Ga0466961_0179361 3300044693 Bacteria 1315
445 Ga0466963_0308753 3300044694 Bacteria 1112
446 Ga0466963_0321279 3300044694 Bacteria 1089
447 Ga0453684_0024564 3300044712 Bacteria 8802
448 Ga0453684_0119674 3300044712 Bacteria 3182
449 Ga0453684_0597149 3300044712 Bacteria 1210
450 Ga0466971_0088024 3300044719 Bacteria 1420
451 Ga0466957_0111917 3300044842 Bacteria 1732
452 Ga0451576_0003501 3300045051 Bacteria 21460
453 Ga0451576_0006531 3300045051 Bacteria 14270
454 Ga0451576_0008864 3300045051 Bacteria 11747
455 Ga0451576_0110654 3300045051 Bacteria 2858
456 Ga0451576_0136026 3300045051 Bacteria 2562
457 Ga0451576_0172080 3300045051 Bacteria 2260
458 Ga0451576_0268925 3300045051 Bacteria 1782
459 Ga0451576_0291761 3300045051 Bacteria 1705
460 Ga0451576_0355329 3300045051 Bacteria 1534
461 Ga0466958_0123141 3300045836 Bacteria 1624
462 Ga0466967_0021096 3300045976 Bacteria 5280
463 Ga0466967_0041079 3300045976 Bacteria 3985
464 Ga0495629_0089378 3300046459 Bacteria 2149
465 Ga0495651_0002666 3300046462 Bacteria 13854
466 Ga0495653_0052566 3300046463 Bacteria 3122
467 Ga0495580_0000221 3300046472 Bacteria 44116
468 Ga0495662_0001302 3300046476 Bacteria 12345
469 Ga0495608_0036306 3300046511 Bacteria 3318
470 Ga0495643_0011139 3300046522 Bacteria 5494
471 Ga0495642_0010304 3300046528 Bacteria 3580
472 Ga0495642_0019848 3300046528 Bacteria 2635
473 Ga0495642_0045389 3300046528 Bacteria 1796
474 Ga0495642_0070928 3300046528 Bacteria 1457
475 Ga0495652_0007485 3300046529 Bacteria 10063
476 Ga0495640_0094608 3300046533 Bacteria 1968
477 Ga0495587_0004484 3300046536 Bacteria 9185
478 Ga0495597_0013154 3300046542 Bacteria 3972
479 Ga0495667_0023914 3300046559 Bacteria 4115
480 Ga0495656_0020334 3300046615 Bacteria 2574
481 Ga0495668_0016681 3300046616 Bacteria 4270
482 Ga0495634_0134050 3300046642 Bacteria 1577
483 Ga0495625_0024298 3300046660 Bacteria 4614
484 Ga0495661_0007818 3300046665 Bacteria 7438
485 Ga0495599_0047824 3300046678 Bacteria 2681
486 Ga0495623_0013846 3300046679 Bacteria 5230
487 Ga0495669_0217699 3300046684 Bacteria 915
488 Ga0495604_0003465 3300047317 Bacteria 12576
489 Ga0495604_0138821 3300047317 Bacteria 1739
490 Ga0495674_0094635 3300047319 Bacteria 2548
491 Ga0495680_0008103 3300047322 Bacteria 9575
492 Ga0495687_104495 3300047443 Bacteria 1055
493 Ga0495675_0021885 3300047444 Bacteria 4073
494 Ga0496102_0027825 3300048905 Bacteria 5049
495 Ga0496102_0063825 3300048905 Bacteria 3373
496 Ga0496103_0119792 3300048906 Bacteria 1676
497 Ga0496103_0206819 3300048906 Bacteria 1262
498 Ga0496105_0081092 3300048908 Bacteria 2680
499 Ga0496106_0621696 3300048909 Bacteria 864
500 Ga0496107_0100630 3300048910 Bacteria 2119
501 Ga0496109_0387025 3300048912 Bacteria 1321
502 Ga0496110_0024349 3300048913 Bacteria 5159
503 Ga0496114_0254312 3300048917 Bacteria 1546
504 Ga0496125_0002869 3300048928 Bacteria 21699
505 Ga0501033_0038656 3300049570 Bacteria 3566
506 Ga0501033_0215099 3300049570 Bacteria 1370
507 Ga0501033_0215200 3300049570 Bacteria 1369
508 Ga0501036_0294734 3300049572 Bacteria 1357
509 Ga0501036_0316188 3300049572 Bacteria 1305
510 Ga0501036_0524330 3300049572 Bacteria 985
511 Ga0501036_0569596 3300049572 Bacteria 940
512 Ga0501038_0543342 3300049574 Bacteria 884
513 Ga0501040_0031830 3300049576 Bacteria 3566
514 Ga0501040_0082993 3300049576 Bacteria 2222
515 Ga0501040_0320137 3300049576 Bacteria 1109
516 Ga0501041_0089162 3300049577 Bacteria 1904
517 Ga0501041_0130127 3300049577 Bacteria 1568
518 Ga0501041_0165543 3300049577 Bacteria 1383
519 Ga0501041_0354154 3300049577 Bacteria 928
520 Ga0501042_0004324 3300049578 Bacteria 9054
521 Ga0501042_0289831 3300049578 Bacteria 1182
522 Ga0501043_0053772 3300049579 Bacteria 3162
523 Ga0501046_0000467 3300049580 Bacteria 40463
524 Ga0501046_0035975 3300049580 Bacteria 3987
525 Ga0501047_0186885 3300049581 Bacteria 1937
526 Ga0501048_0024540 3300049582 Bacteria 4401
527 Ga0501048_0122291 3300049582 Bacteria 1839
528 Ga0501048_0149857 3300049582 Bacteria 1650
529 Ga0501048_0223919 3300049582 Bacteria 1335
530 Ga0501067_0143267 3300049583 Bacteria 1331
531 Ga0501067_0196653 3300049583 Bacteria 1123
532 Ga0501068_0036790 3300049584 Bacteria 2929
533 Ga0501068_0273265 3300049584 Bacteria 1079
534 Ga0501071_0003987 3300049587 Bacteria 9318
535 Ga0501071_0016561 3300049587 Bacteria 5072
536 Ga0501071_0107518 3300049587 Bacteria 2060
537 Ga0501072_0002766 3300049588 Bacteria 13186
538 Ga0501072_0038539 3300049588 Bacteria 3751
539 Ga0501072_0190218 3300049588 Bacteria 1637
540 Ga0501072_0281643 3300049588 Bacteria 1322
541 Ga0501073_0351406 3300049589 Bacteria 1018
542 Ga0501074_0058512 3300049590 Bacteria 2777
543 Ga0501074_0061501 3300049590 Bacteria 2705
544 Ga0501074_0141738 3300049590 Bacteria 1719
545 Ga0501074_0431674 3300049590 Bacteria 934
546 Ga0501075_0000822 3300049591 Bacteria 19492
547 Ga0501075_0028741 3300049591 Bacteria 4106
548 Ga0501075_0028921 3300049591 Bacteria 4095
549 Ga0501075_0037993 3300049591 Bacteria 3599
550 Ga0501075_0044001 3300049591 Bacteria 3349
551 Ga0501075_0060115 3300049591 Bacteria 2863
552 Ga0501075_0077971 3300049591 Bacteria 2508
553 Ga0501075_0106373 3300049591 Bacteria 2132
554 Ga0501075_0117601 3300049591 Bacteria 2021
555 Ga0501075_0227872 3300049591 Bacteria 1421
556 Ga0501076_0000350 3300049592 Bacteria 28487
557 Ga0501076_0004894 3300049592 Bacteria 9580
558 Ga0501076_0010031 3300049592 Bacteria 7009
559 Ga0501076_0026791 3300049592 Bacteria 4468
560 Ga0501076_0051012 3300049592 Bacteria 3274
561 Ga0501076_0118376 3300049592 Bacteria 2144
562 Ga0501076_0139582 3300049592 Bacteria 1968
563 Ga0501077_0009938 3300049593 Bacteria 5922
564 Ga0501077_0015886 3300049593 Bacteria 4742
565 Ga0501077_0048020 3300049593 Bacteria 2712
566 Ga0501077_0193968 3300049593 Bacteria 1290
567 Ga0501077_0322734 3300049593 Bacteria 984
568 Ga0501079_0001606 3300049741 Bacteria 16096
569 Ga0501079_0011540 3300049741 Bacteria 6745
570 Ga0501079_0013286 3300049741 Bacteria 6278
571 Ga0501079_0013584 3300049741 Bacteria 6211
572 Ga0501079_0073634 3300049741 Bacteria 2640
573 Ga0501079_0074632 3300049741 Bacteria 2622
574 Ga0501079_0172980 3300049741 Bacteria 1684
575 Ga0501079_0500539 3300049741 Bacteria 955
576 Ga0501080_0198740 3300049742 Bacteria 1841
577 Ga0501080_0203404 3300049742 Bacteria 1817
578 Ga0501080_0218875 3300049742 Bacteria 1743
579 Ga0501080_0263904 3300049742 Bacteria 1568
580 Ga0501081_0005117 3300049743 Bacteria 8439
581 Ga0501081_0008068 3300049743 Bacteria 6834
582 Ga0501081_0009568 3300049743 Bacteria 6320
583 Ga0501081_0033617 3300049743 Bacteria 3485
584 Ga0501081_0069472 3300049743 Bacteria 2454
585 Ga0501081_0131110 3300049743 Bacteria 1791
586 Ga0501083_0009494 3300049744 Bacteria 6872
587 Ga0501045_0002799 3300049824 Bacteria 11923
588 Ga0501045_0020911 3300049824 Bacteria 4679
589 Ga0501045_0024543 3300049824 Bacteria 4329
590 Ga0501045_0045808 3300049824 Bacteria 3184
591 Ga0501045_0210811 3300049824 Bacteria 1447
592 Ga0501045_0245806 3300049824 Bacteria 1332
593 Ga0501045_0396424 3300049824 Bacteria 1027
594 nmdc:mga04h51_453_c1 3300050495 Bacteria 9862
595 nmdc:mga05p37_107301_c1 3300050507 Bacteria 3436
596 nmdc:mga05p37_134125_c1 3300050507 Bacteria 3038
597 nmdc:mga05p37_138_c1 3300050507 Bacteria 67838
598 nmdc:mga05p37_15169_c1 3300050507 Bacteria 9252
599 nmdc:mga05p37_157750_c1 3300050507 Bacteria 2772
600 nmdc:mga05p37_158198_c1 3300050507 Bacteria 2275
601 nmdc:mga05p37_191326_c1 3300050507 Bacteria 2484
602 nmdc:mga05p37_25130_c1 3300050507 Bacteria 5800
603 nmdc:mga05p37_3179_c1 3300050507 Bacteria 19103
604 nmdc:mga05p37_327177_c1 3300050507 Bacteria 1812
605 nmdc:mga05p37_3506_c1 3300050507 Bacteria 18343
606 nmdc:mga05p37_4758_c1 3300050507 Bacteria 15863
607 nmdc:mga05p37_523903_c1 3300050507 Bacteria 1355
608 nmdc:mga05p37_545409_c1 3300050507 Bacteria 1321
609 nmdc:mga05p37_71372_c1 3300050507 Bacteria 4272
610 nmdc:mga05p37_73867_c1 3300050507 Bacteria 4197
611 nmdc:mga05p37_820835_c1 3300050507 Bacteria 1014
612 nmdc:mga05p37_9165_c1 3300050507 Bacteria 11699
613 nmdc:mga05p37_92015_c1 3300050507 Bacteria 3737
614 nmdc:mga09592_1011_c1 3300050508 Bacteria 22343
615 nmdc:mga09592_118774_c1 3300050508 Bacteria 2270
616 nmdc:mga09592_197516_c1 3300050508 Bacteria 1742
617 nmdc:mga09592_2443_c1 3300050508 Bacteria 14995
618 nmdc:mga09592_250915_c1 3300050508 Bacteria 1534
619 nmdc:mga09592_49161_c1 3300050508 Bacteria 3556
620 nmdc:mga09592_494_c1 3300050508 Bacteria 29628
621 nmdc:mga09592_70054_c1 3300050508 Bacteria 2975
622 nmdc:mga09592_95375_c1 3300050508 Bacteria 2545
623 nmdc:mga0qj67_105345_c1 3300050509 Bacteria 2275
624 nmdc:mga0qj67_20245_c1 3300050509 Bacteria 5093
625 nmdc:mga0qj67_4291_c1 3300050509 Bacteria 10334
626 nmdc:mga0qj67_4502_c1 3300050509 Bacteria 10099
627 nmdc:mga0qj67_73580_c1 3300050509 Bacteria 2729
628 nmdc:mga0qj67_8757_c1 3300050509 Bacteria 7509
629 nmdc:mga0qj67_98_c1 3300050509 Bacteria 57947
630 nmdc:mga06r32_14735_c1 3300050510 Bacteria 7096
631 nmdc:mga06r32_15_c1 3300050510 Bacteria 106010
632 nmdc:mga06r32_181045_c1 3300050510 Bacteria 2093
633 nmdc:mga06r32_27064_c1 3300050510 Bacteria 5353
634 nmdc:mga06r32_315_c1 3300050510 Bacteria 40418
635 nmdc:mga06r32_33925_c1 3300050510 Bacteria 4810
636 nmdc:mga06r32_37312_c1 3300050510 Bacteria 4597
637 nmdc:mga06r32_418_c1 3300050510 Bacteria 35763
638 nmdc:mga06r32_434590_c1 3300050510 Bacteria 1293
639 nmdc:mga06r32_44960_c1 3300050510 Bacteria 4208
640 nmdc:mga06r32_5202_c1 3300050510 Bacteria 11692
641 nmdc:mga06r32_53486_c1 3300050510 Bacteria 3868
642 nmdc:mga06r32_9766_c1 3300050510 Bacteria 8665
643 nmdc:mga08y16_1060_c1 3300050511 Bacteria 27061
644 nmdc:mga08y16_260323_c1 3300050511 Bacteria 1791
645 nmdc:mga08y16_307719_c1 3300050511 Bacteria 1632
646 nmdc:mga08y16_37104_c1 3300050511 Bacteria 5118
647 nmdc:mga08y16_38931_c1 3300050511 Bacteria 4990
648 nmdc:mga08y16_40_c1 3300050511 Bacteria 130773
649 nmdc:mga08y16_699343_c1 3300050511 Bacteria 1014
650 nmdc:mga08y16_91_c1 3300050511 Bacteria 19179
651 nmdc:mga0n895_1247_c1 3300050512 Bacteria 18773
652 nmdc:mga0n895_142048_c1 3300050512 Bacteria 2430
653 nmdc:mga0n895_1512_c1 3300050512 Bacteria 17445
654 nmdc:mga0n895_22594_c1 3300050512 Bacteria 5899
655 nmdc:mga0n895_39538_c1 3300050512 Bacteria 4577
656 nmdc:mga0n895_404959_c1 3300050512 Bacteria 1380
657 nmdc:mga0n895_441544_c1 3300050512 Bacteria 1314
658 nmdc:mga0n895_536410_c1 3300050512 Bacteria 1177
659 nmdc:mga0n895_93543_c1 3300050512 Bacteria 3010
660 nmdc:mga0rr50_135381_c1 3300050513 Bacteria 1977
661 nmdc:mga0rr50_143710_c1 3300050513 Bacteria 1922
662 nmdc:mga0rr50_15088_c1 3300050513 Bacteria 5091
663 nmdc:mga0rr50_15451_c1 3300050513 Bacteria 5041
664 nmdc:mga0rr50_190871_c1 3300050513 Bacteria 1679
665 nmdc:mga0rr50_195529_c1 3300050513 Bacteria 1660
666 nmdc:mga0rr50_273696_c1 3300050513 Bacteria 1408
667 nmdc:mga08x19_12184_c1 3300050514 Bacteria 5176
668 nmdc:mga08x19_85356_c1 3300050514 Bacteria 2078
669 nmdc:mga0a205_11257_c1 3300050515 Bacteria 8233
670 nmdc:mga0a205_17436_c1 3300050515 Bacteria 6733
671 nmdc:mga0a205_187967_c1 3300050515 Bacteria 1958
672 nmdc:mga0a205_24649_c1 3300050515 Bacteria 5724
673 nmdc:mga0a205_32594_c1 3300050515 Bacteria 4996
674 nmdc:mga0a205_378942_c1 3300050515 Bacteria 1280
675 nmdc:mga0a205_420228_c1 3300050515 Bacteria 1199
676 nmdc:mga0a205_6560_c1 3300050515 Bacteria 10524
677 nmdc:mga0a205_91559_c1 3300050515 Bacteria 2939
678 Ga0495601_0000934 3300053077 Bacteria 15872
679 Ga0495595_0034563 3300053084 Bacteria 2286
680 Ga0500577_0123078 3300053142 Bacteria 1081
681 Ga0501084_0009357 3300054114 Bacteria 8109
682 Ga0501084_0026496 3300054114 Bacteria 4838
683 Ga0501084_0033932 3300054114 Bacteria 4267
684 Ga0501084_0118135 3300054114 Bacteria 2229
685 Ga0501082_0001833 3300060353 Bacteria 18711
686 Ga0501082_0003649 3300060353 Bacteria 13441
687 Ga0501082_0024663 3300060353 Bacteria 5183
688 Ga0501082_0025892 3300060353 Bacteria 5056
689 Ga0501082_0027196 3300060353 Bacteria 4926
690 Ga0501082_0072802 3300060353 Bacteria 2959
691 Ga0501082_0174960 3300060353 Bacteria 1866
692 Ga0530510_0002054 3300061734 Bacteria 13822
693 Ga0530510_0079283 3300061734 Bacteria 2388
694 Ga0530510_0166289 3300061734 Bacteria 1633
695 2644401273 2643221672 Bacteria 6322190
696 2824705496 2824704595 Bacteria 9667483
697 2842751565 2842747753 Bacteria 5578255
698 2900642644 2900634093 Bacteria 10263517
699 8002286742 8002285264 Bacteria 6717907
700 Ga0495592_0053918
701 JGI26129J50193_1000765
702 JGI25404J52841_10037115
703 Ga0065715_10100061
704 Ga0070676_10000671
705 Ga0070676_10007040
706 Ga0070683_100164067
707 Ga0070690_100056057
708 Ga0070670_100039225
709 Ga0070670_100184780
710 Ga0068869_100017694
711 Ga0068869_100028275
712 Ga0070666_10074768
713 Ga0070680_100003078
714 Ga0070680_100116665
715 Ga0070682_100019038
716 Ga0070660_100007427
717 Ga0070691_10001482
718 Ga0070691_10005679
719 Ga0070691_10041733
720 Ga0070661_100011652
721 Ga0070668_100003095
722 Ga0070668_100013677
723 Ga0070669_100010583
724 Ga0070669_100069287
725 Ga0070669_100305921
726 Ga0070675_100324383
727 Ga0070659_100000378
728 Ga0070667_100031677
729 Ga0070667_100123166
730 Ga0070667_100326546
731 Ga0070701_10078408
732 Ga0070711_100105079
733 Ga0070705_100001984
734 Ga0070705_100069266
735 Ga0070705_100099299
736 Ga0070700_100031315
737 Ga0070694_100000180
738 Ga0070694_100008191
739 Ga0070694_100051245
740 Ga0070694_100069186
741 Ga0070708_100006859
742 Ga0070708_100007769
743 Ga0070708_100017627
744 Ga0070708_100026088
745 Ga0070708_100036829
746 Ga0070708_100223077
747 Ga0070708_100256949
748 Ga0070663_100000411
749 Ga0070662_100007636
750 Ga0070662_100088065
751 Ga0070662_100177163
752 Ga0070681_10005266
753 Ga0070681_10115315
754 Ga0070681_10634455
755 Ga0068867_100144810
756 Ga0068867_100144813
757 Ga0068867_100346644
758 Ga0070706_100002529
759 Ga0070706_100021306
760 Ga0070706_100078894
761 Ga0070706_100240194
762 Ga0070706_100330477
763 Ga0070706_100330950
764 Ga0070706_100431211
765 Ga0070707_100008063
766 Ga0070707_100064154
767 Ga0070707_100091259
768 Ga0070707_100130005
769 Ga0070698_100001598
770 Ga0070698_100036902
771 Ga0070698_100070457
772 Ga0070698_100094100
773 Ga0070698_100176589
774 Ga0070698_100215425
775 Ga0070698_100282861
776 Ga0070699_100026770
777 Ga0070699_100028604
778 Ga0070699_100033681
779 Ga0070699_100042334
780 Ga0070699_100100252
781 Ga0070699_100195829
782 Ga0070699_100209902
783 Ga0070699_100324779
784 Ga0070699_100386606
785 Ga0070679_100003620
786 Ga0070679_100206127
787 Ga0070684_100247803
788 Ga0070697_100001896
789 Ga0070697_100005548
790 Ga0070697_100120175
791 Ga0070697_100180859
792 Ga0070697_100320139
793 Ga0068853_100000344
794 Ga0070672_100314461
795 Ga0070695_100000324
796 Ga0070695_100012280
797 Ga0070695_100022314
798 Ga0070695_100030642
799 Ga0070695_100043067
800 Ga0070696_100016488
801 Ga0070696_100017783
802 Ga0070696_100027972
803 Ga0070696_100075344
804 Ga0070696_100081298
805 Ga0070696_100137255
806 Ga0070693_100000444
807 Ga0070693_100066427
808 Ga0070665_100017846
809 Ga0070665_100752912
810 Ga0070704_100004554
811 Ga0070704_100024273
812 Ga0068855_100004550
813 Ga0070664_100003289
814 Ga0068857_100008826
815 Ga0068857_100377408
816 Ga0068857_100431793
817 Ga0068854_100001108
818 Ga0068856_100001066
819 Ga0068859_100286819
820 Ga0068864_100290387
821 Ga0068866_10071343
822 Ga0068861_100014057
823 Ga0068861_100051266
824 Ga0068861_100179341
825 Ga0068861_100373894
826 Ga0068863_100049127
827 Ga0068863_100068915
828 Ga0068858_100293581
829 Ga0068858_100332125
830 Ga0068860_100124869
831 Ga0068860_100129145
832 Ga0068860_100163210
833 Ga0068860_100182857
834 Ga0068860_100272594
835 Ga0068862_100007015
836 Ga0068862_100025870
837 Ga0068862_100026077
838 Ga0068862_100039291
839 Ga0068862_100165521
840 Ga0068862_100342900
841 Ga0081455_10000041
842 Ga0081455_10000882
843 Ga0081455_10025615
844 Ga0081538_10029736
845 Ga0081540_1000091
846 Ga0081540_1003214
847 Ga0081539_10000266
848 Ga0075368_10001440
849 Ga0075363_100012495
850 Ga0070712_100069042
851 Ga0075367_10003360
852 Ga0075427_10013182
853 Ga0075366_10084214
854 Ga0097621_100512292
855 Ga0068871_100288551
856 Ga0075428_100000159
857 Ga0075428_100001683
858 Ga0075428_100003162
859 Ga0075428_100013632
860 Ga0075428_100017673
861 Ga0075428_100021600
862 Ga0075428_100024043
863 Ga0075428_100047930
864 Ga0075428_100157660
865 Ga0075428_100268016
866 Ga0075428_100346419
867 Ga0075430_100000022
868 Ga0075430_100007740
869 Ga0075430_100024569
870 Ga0075430_100027411
871 Ga0075430_100057101
872 Ga0075430_100064037
873 Ga0075430_100157277
874 Ga0075430_100451721
875 Ga0075431_100000058
876 Ga0075431_100005240
877 Ga0075431_100008769
878 Ga0075431_100010677
879 Ga0075431_100010992
880 Ga0075431_100012252
881 Ga0075431_100021774
882 Ga0075431_100037522
883 Ga0075431_100038803
884 Ga0075431_100214395
885 Ga0075431_100381253
886 Ga0075431_100542345
887 Ga0075433_10000322
888 Ga0075433_10009434
889 Ga0075433_10092681
890 Ga0075433_10331582
891 Ga0075434_100002809
892 Ga0075434_100005649
893 Ga0075434_100010207
894 Ga0075434_100061335
895 Ga0075434_100073407
896 Ga0075434_100191919
897 Ga0075434_100281413
898 Ga0075434_100470009
899 Ga0075434_100473695
900 Ga0075429_100000072
901 Ga0075429_100001141
902 Ga0075429_100048188
903 Ga0075429_100065029
904 Ga0075429_100069998
905 Ga0075429_100097284
906 Ga0075429_100117001
907 Ga0075429_100212690
908 Ga0075429_100443368
909 Ga0068865_100011450
910 Ga0068865_100228254
911 Ga0075436_100023349
912 Ga0075436_100048441
913 Ga0075436_100063857
914 Ga0075436_100236461
915 Ga0097620_100286815
916 Ga0075435_100024255
917 Ga0075435_100095031
918 Ga0075435_100180379
919 Ga0075435_100306747
920 Ga0099794_10000986
921 Ga0099794_10046425
922 Ga0099794_10084462
923 Ga0105240_10317845
924 Ga0105240_10439455
925 Ga0111539_10000353
926 Ga0111539_10004083
927 Ga0111539_10014325
928 Ga0111539_10023137
929 Ga0111539_10032294
930 Ga0111539_10033857
931 Ga0111539_10081263
932 Ga0111539_10144645
933 Ga0111539_10397399
934 Ga0105245_10057491
935 Ga0105247_10235975
936 Ga0114129_10000046
937 Ga0114129_10006267
938 Ga0114129_10014694
939 Ga0114129_10017939
940 Ga0114129_10019878
941 Ga0114129_10050965
942 Ga0114129_10127048
943 Ga0114129_10146039
944 Ga0114129_10237129
945 Ga0114129_10267258
946 Ga0114129_10273270
947 Ga0114129_10304934
948 Ga0114129_10759708
949 Ga0114129_11071209
950 Ga0105243_10089024
951 Ga0105243_10192757
952 Ga0105241_10073202
953 Ga0105241_10190879
954 Ga0105242_10011961
955 Ga0105242_10144589
956 Ga0105248_10237925
957 Ga0105237_10163756
958 Ga0105249_10100098
959 Ga0105249_10482552
960 Ga0157373_10000079
961 Ga0157371_10089821
962 Ga0157369_10162534
963 Ga0157378_10079383
964 Ga0157378_10459780
965 Ga0163162_10019100
966 Ga0157372_10002520
967 Ga0157375_10032184
968 Ga0163163_10217026
969 Ga0157380_10169218
970 Ga0157379_10218778
971 Ga0182007_10037352
972 Ga0207653_10001179
973 Ga0207653_10020592
974 Ga0207653_10056412
975 Ga0207653_10069124
976 Ga0207642_10156620
977 Ga0207680_10092642
978 Ga0207685_10090996
979 Ga0207699_10009512
980 Ga0207645_10000683
981 Ga0207645_10079119
982 Ga0207643_10000087
983 Ga0207684_10014094
984 Ga0207684_10020517
985 Ga0207684_10020798
986 Ga0207684_10027632
987 Ga0207684_10107621
988 Ga0207684_10108475
989 Ga0207684_10373306
990 Ga0207684_10466986
991 Ga0207654_10006561
992 Ga0207654_10052220
993 Ga0207707_10000197
994 Ga0207707_10163337
995 Ga0207707_10217978
996 Ga0207693_10029816
997 Ga0207693_10159041
998 Ga0207660_10001135
999 Ga0207660_10049606
1000 Ga0207660_10080556
1001 Ga0207662_10195352
1002 Ga0207657_10000264
1003 Ga0207649_10006541
1004 Ga0207652_10000553
1005 Ga0207646_10001806
1006 Ga0207646_10018188
1007 Ga0207646_10038411
1008 Ga0207646_10090198
1009 Ga0207646_10159909
1010 Ga0207681_10052722
1011 Ga0207681_10129450
1012 Ga0207681_10199212
1013 Ga0207650_10029765
1014 Ga0207650_10040303
1015 Ga0207650_10180210
1016 Ga0207659_10216183
1017 Ga0207690_10006978
1018 Ga0207706_10016175
1019 Ga0207706_10034278
1020 Ga0207706_10177131
1021 Ga0207686_10043619
1022 Ga0207709_10111550
1023 Ga0207709_10130296
1024 Ga0207670_10062456
1025 Ga0207670_10072660
1026 Ga0207691_10140973
1027 Ga0207691_10274901
1028 Ga0207711_10394353
1029 Ga0207689_10000141
1030 Ga0207689_10026534
1031 Ga0207661_10102738
1032 Ga0207679_10001160
1033 Ga0207667_10001531
1034 Ga0207712_10060592
1035 Ga0207668_10002407
1036 Ga0207640_10000986
1037 Ga0207640_10202143
1038 Ga0207658_10304430
1039 Ga0207658_10316490
1040 Ga0207658_10533818
1041 Ga0207639_10002524
1042 Ga0207678_10002927
1043 Ga0207708_10020127
1044 Ga0207702_10000986
1045 Ga0207641_10082874
1046 Ga0207641_10105938
1047 Ga0207648_10003434
1048 Ga0207648_10031784
1049 Ga0207648_10088658
1050 Ga0207648_10227967
1051 Ga0207674_10000412
1052 Ga0207674_10022329
1053 Ga0207674_10098340
1054 Ga0207675_100022600
1055 Ga0207675_100029538
1056 Ga0207675_100076624
1057 Ga0207675_100157543
1058 Ga0207675_100264755
1059 Ga0209981_1000603
1060 Ga0209996_1000182
1061 Ga0210000_1015202
1062 Ga0209995_1001092
1063 Ga0209999_1001064
1064 Ga0209970_1000754
1065 Ga0209983_1001869
1066 Ga0209588_1000014
1067 Ga0209588_1006238
1068 Ga0209588_1023325
1069 Ga0209588_1025030
1070 Ga0209588_1051865
1071 Ga0209971_1000336
1072 Ga0209966_1001628
1073 Ga0209966_1020761
1074 Ga0209998_10000256
1075 Ga0209813_10003276
1076 Ga0209974_10000509
1077 Ga0207428_10000009
1078 Ga0207428_10003480
1079 Ga0207428_10008368
1080 Ga0207428_10010309
1081 Ga0207428_10024614
1082 Ga0207428_10180064
1083 Ga0268265_10006793
1084 Ga0268265_10019666
1085 Ga0268265_10020538
1086 Ga0268265_10138363
1087 Ga0268265_10184635
1088 Ga0268264_10035662
1089 Ga0268264_10058832
1090 Ga0268264_10107380
1091 Ga0268264_10184195
1092 Ga0307513_10116433
1093 Ga0307408_100000739
1094 Ga0307405_10457008
1095 Ga0307413_10083873
1096 Ga0307412_10000207
1097 Ga0307416_100010841
1098 Ga0307414_10008565
1099 Ga0373959_0030134
1100 Ga0373928_0011976
1101 Ga0373940_0001624
1102 Ga0373952_0016040
1103 Ga0373932_0004496
1104 Ga0373932_0009664
1105 Ga0373939_0010504
1106 Ga0373960_0052706
1107 Ga0373961_0072407
1108 Ga0373962_0001746
1109 Ga0373962_0004216
1110 Ga0373924_0022374
1111 Ga0373931_0002758
1112 Ga0373931_0003440
1113 Ga0373931_0007012
1114 Ga0373931_0088572
1115 Ga0373927_0207007
1116 Ga0373933_0004287
1117 Ga0373937_0009713
1118 Ga0395899_0156079
1119 Ga0395900_0005351
1120 Ga0395900_0041823
1121 Ga0395898_0022324
1122 Ga0395901_0024766
1123 Ga0395901_0080715
1124 Ga0242420_024447
1125 Ga0439453_0008025
1126 Ga0439441_019471
1127 Ga0439443_017615
1128 Ga0439450_019076
1129 Ga0439458_0008499
1130 Ga0439435_0000682
1131 Ga0439459_0001595
1132 Ga0439464_0018171
1133 Ga0439460_0000204
1134 Ga0439460_0041007
1135 Ga0439460_0069645
1136 Ga0451577_0004021
1137 Ga0451577_0025225
1138 Ga0451577_0029956
1139 Ga0451577_0185037
1140 Ga0453683_0013754
1141 Ga0453683_0018982
1142 Ga0453683_0047362
1143 Ga0466961_0179361
1144 Ga0466963_0308753
1145 Ga0466963_0321279
1146 Ga0453684_0024564
1147 Ga0453684_0119674
1148 Ga0453684_0597149
1149 Ga0466971_0088024
1150 Ga0466957_0111917
1151 Ga0451576_0003501
1152 Ga0451576_0006531
1153 Ga0451576_0008864
1154 Ga0451576_0110654
1155 Ga0451576_0136026
1156 Ga0451576_0172080
1157 Ga0451576_0268925
1158 Ga0451576_0291761
1159 Ga0451576_0355329
1160 Ga0466958_0123141
1161 Ga0466967_0021096
1162 Ga0466967_0041079
1163 Ga0495629_0089378
1164 Ga0495651_0002666
1165 Ga0495653_0052566
1166 Ga0495580_0000221
1167 Ga0495662_0001302
1168 Ga0495608_0036306
1169 Ga0495643_0011139
1170 Ga0495642_0010304
1171 Ga0495642_0019848
1172 Ga0495642_0045389
1173 Ga0495642_0070928
1174 Ga0495652_0007485
1175 Ga0495640_0094608
1176 Ga0495587_0004484
1177 Ga0495597_0013154
1178 Ga0495667_0023914
1179 Ga0495656_0020334
1180 Ga0495668_0016681
1181 Ga0495634_0134050
1182 Ga0495625_0024298
1183 Ga0495661_0007818
1184 Ga0495599_0047824
1185 Ga0495623_0013846
1186 Ga0495669_0217699
1187 Ga0495604_0003465
1188 Ga0495604_0138821
1189 Ga0495674_0094635
1190 Ga0495680_0008103
1191 Ga0495687_104495
1192 Ga0495675_0021885
1193 Ga0496102_0027825
1194 Ga0496102_0063825
1195 Ga0496103_0119792
1196 Ga0496103_0206819
1197 Ga0496105_0081092
1198 Ga0496106_0621696
1199 Ga0496107_0100630
1200 Ga0496109_0387025
1201 Ga0496110_0024349
1202 Ga0496114_0254312
1203 Ga0496125_0002869
1204 Ga0501033_0038656
1205 Ga0501033_0215099
1206 Ga0501033_0215200
1207 Ga0501036_0294734
1208 Ga0501036_0316188
1209 Ga0501036_0524330
1210 Ga0501036_0569596
1211 Ga0501038_0543342
1212 Ga0501040_0031830
1213 Ga0501040_0082993
1214 Ga0501040_0320137
1215 Ga0501041_0089162
1216 Ga0501041_0130127
1217 Ga0501041_0165543
1218 Ga0501041_0354154
1219 Ga0501042_0004324
1220 Ga0501042_0289831
1221 Ga0501043_0053772
1222 Ga0501046_0000467
1223 Ga0501046_0035975
1224 Ga0501047_0186885
1225 Ga0501048_0024540
1226 Ga0501048_0122291
1227 Ga0501048_0149857
1228 Ga0501048_0223919
1229 Ga0501067_0143267
1230 Ga0501067_0196653
1231 Ga0501068_0036790
1232 Ga0501068_0273265
1233 Ga0501071_0003987
1234 Ga0501071_0016561
1235 Ga0501071_0107518
1236 Ga0501072_0002766
1237 Ga0501072_0038539
1238 Ga0501072_0190218
1239 Ga0501072_0281643
1240 Ga0501073_0351406
1241 Ga0501074_0058512
1242 Ga0501074_0061501
1243 Ga0501074_0141738
1244 Ga0501074_0431674
1245 Ga0501075_0000822
1246 Ga0501075_0028741
1247 Ga0501075_0028921
1248 Ga0501075_0037993
1249 Ga0501075_0044001
1250 Ga0501075_0060115
1251 Ga0501075_0077971
1252 Ga0501075_0106373
1253 Ga0501075_0117601
1254 Ga0501075_0227872
1255 Ga0501076_0000350
1256 Ga0501076_0004894
1257 Ga0501076_0010031
1258 Ga0501076_0026791
1259 Ga0501076_0051012
1260 Ga0501076_0118376
1261 Ga0501076_0139582
1262 Ga0501077_0009938
1263 Ga0501077_0015886
1264 Ga0501077_0048020
1265 Ga0501077_0193968
1266 Ga0501077_0322734
1267 Ga0501079_0001606
1268 Ga0501079_0011540
1269 Ga0501079_0013286
1270 Ga0501079_0013584
1271 Ga0501079_0073634
1272 Ga0501079_0074632
1273 Ga0501079_0172980
1274 Ga0501079_0500539
1275 Ga0501080_0198740
1276 Ga0501080_0203404
1277 Ga0501080_0218875
1278 Ga0501080_0263904
1279 Ga0501081_0005117
1280 Ga0501081_0008068
1281 Ga0501081_0009568
1282 Ga0501081_0033617
1283 Ga0501081_0069472
1284 Ga0501081_0131110
1285 Ga0501083_0009494
1286 Ga0501045_0002799
1287 Ga0501045_0020911
1288 Ga0501045_0024543
1289 Ga0501045_0045808
1290 Ga0501045_0210811
1291 Ga0501045_0245806
1292 Ga0501045_0396424
1293 nmdc:mga04h51_453_c1
1294 nmdc:mga05p37_107301_c1
1295 nmdc:mga05p37_134125_c1
1296 nmdc:mga05p37_138_c1
1297 nmdc:mga05p37_15169_c1
1298 nmdc:mga05p37_157750_c1
1299 nmdc:mga05p37_158198_c1
1300 nmdc:mga05p37_191326_c1
1301 nmdc:mga05p37_25130_c1
1302 nmdc:mga05p37_3179_c1
1303 nmdc:mga05p37_327177_c1
1304 nmdc:mga05p37_3506_c1
1305 nmdc:mga05p37_4758_c1
1306 nmdc:mga05p37_523903_c1
1307 nmdc:mga05p37_545409_c1
1308 nmdc:mga05p37_71372_c1
1309 nmdc:mga05p37_73867_c1
1310 nmdc:mga05p37_820835_c1
1311 nmdc:mga05p37_9165_c1
1312 nmdc:mga05p37_92015_c1
1313 nmdc:mga09592_1011_c1
1314 nmdc:mga09592_118774_c1
1315 nmdc:mga09592_197516_c1
1316 nmdc:mga09592_2443_c1
1317 nmdc:mga09592_250915_c1
1318 nmdc:mga09592_49161_c1
1319 nmdc:mga09592_494_c1
1320 nmdc:mga09592_70054_c1
1321 nmdc:mga09592_95375_c1
1322 nmdc:mga0qj67_105345_c1
1323 nmdc:mga0qj67_20245_c1
1324 nmdc:mga0qj67_4291_c1
1325 nmdc:mga0qj67_4502_c1
1326 nmdc:mga0qj67_73580_c1
1327 nmdc:mga0qj67_8757_c1
1328 nmdc:mga0qj67_98_c1
1329 nmdc:mga06r32_14735_c1
1330 nmdc:mga06r32_15_c1
1331 nmdc:mga06r32_181045_c1
1332 nmdc:mga06r32_27064_c1
1333 nmdc:mga06r32_315_c1
1334 nmdc:mga06r32_33925_c1
1335 nmdc:mga06r32_37312_c1
1336 nmdc:mga06r32_418_c1
1337 nmdc:mga06r32_434590_c1
1338 nmdc:mga06r32_44960_c1
1339 nmdc:mga06r32_5202_c1
1340 nmdc:mga06r32_53486_c1
1341 nmdc:mga06r32_9766_c1
1342 nmdc:mga08y16_1060_c1
1343 nmdc:mga08y16_260323_c1
1344 nmdc:mga08y16_307719_c1
1345 nmdc:mga08y16_37104_c1
1346 nmdc:mga08y16_38931_c1
1347 nmdc:mga08y16_40_c1
1348 nmdc:mga08y16_699343_c1
1349 nmdc:mga08y16_91_c1
1350 nmdc:mga0n895_1247_c1
1351 nmdc:mga0n895_142048_c1
1352 nmdc:mga0n895_1512_c1
1353 nmdc:mga0n895_22594_c1
1354 nmdc:mga0n895_39538_c1
1355 nmdc:mga0n895_404959_c1
1356 nmdc:mga0n895_441544_c1
1357 nmdc:mga0n895_536410_c1
1358 nmdc:mga0n895_93543_c1
1359 nmdc:mga0rr50_135381_c1
1360 nmdc:mga0rr50_143710_c1
1361 nmdc:mga0rr50_15088_c1
1362 nmdc:mga0rr50_15451_c1
1363 nmdc:mga0rr50_190871_c1
1364 nmdc:mga0rr50_195529_c1
1365 nmdc:mga0rr50_273696_c1
1366 nmdc:mga08x19_12184_c1
1367 nmdc:mga08x19_85356_c1
1368 nmdc:mga0a205_11257_c1
1369 nmdc:mga0a205_17436_c1
1370 nmdc:mga0a205_187967_c1
1371 nmdc:mga0a205_24649_c1
1372 nmdc:mga0a205_32594_c1
1373 nmdc:mga0a205_378942_c1
1374 nmdc:mga0a205_420228_c1
1375 nmdc:mga0a205_6560_c1
1376 nmdc:mga0a205_91559_c1
1377 Ga0495601_0000934
1378 Ga0495595_0034563
1379 Ga0500577_0123078
1380 Ga0501084_0009357
1381 Ga0501084_0026496
1382 Ga0501084_0033932
1383 Ga0501084_0118135
1384 Ga0501082_0001833
1385 Ga0501082_0003649
1386 Ga0501082_0024663
1387 Ga0501082_0025892
1388 Ga0501082_0027196
1389 Ga0501082_0072802
1390 Ga0501082_0174960
1391 Ga0530510_0002054
1392 Ga0530510_0079283
1393 Ga0530510_0166289
1394 2644401273
1395 2824705496
1396 2842751565
1397 2900642644
1398 8002286742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

50

321

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5743 8 276
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5074 5 256
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.4966 8 276
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4778 8 278
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.4588 8 280
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8812 11 275 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8282 11 275 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7908 14 275 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7842 12 276 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7731 12 275 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1F7QST7-F1-model_v4 ABC transporter permease 0.96 20 228 GO:0005886
GO:0006865
GO:0022857
AF-A0A0P7WKI4-F1-model_v4 Branched-chain amino acid transport system permease protein 0.9593 7 286 GO:0005886
GO:0006865
GO:0022857
AF-A0A7W3Q9L1-F1-model_v4 deleted 0.9583 5 285
AF-A0A436D355-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9573 5 265 GO:0005886
GO:0006865
GO:0022857
AF-A0A257LLJ4-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9554 8 257 GO:0005886
GO:0006865
GO:0022857

Map