F476035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 303 | 699 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10147153|Ga0265338_101471532 |
| Length | 343 |
| Sequence | LEPQIRLSLGPEVNPLAQSQIASQVALKDESWTSSLVLRGVRKTFVDVVAVERLDLEVARGECFGLLGPNGAGKTTTIEICEGLTPPDAGSVELLGLNWHSGANELRQRIGIQLQETQFPDKLTVEETIRLFRSFYRQGISVEESIQTAQLEEKRRSRVGGLSGGQKQRLAMACALVGNPELLFLDEPTTGLDPQARRHLWDLVDRLKQTGRTIILTTHYMEEAERLCDRVGIMDHGKIIAIGTPQQLISSLGGEHVAEFAVTEAKSGESTVNMVALMSIPGVKSHRVDAGLHQLSVTELHSVVPRIFAALAEQELHLSEFRTHSATLEDVFVGLTGRNLRDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 181 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 201 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 285 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.57 |
| Metatranscriptomes | 0.43 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 5.87 |
| Rhizosphere | 93.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10039775 | 3300005327 | Bacteria | 3794 |
| 2 | Ga0070658_10076902 | 3300005327 | Bacteria | 2737 |
| 3 | Ga0070676_10009702 | 3300005328 | Bacteria | 5206 |
| 4 | Ga0070683_100000497 | 3300005329 | Bacteria | 27743 |
| 5 | Ga0070683_100044867 | 3300005329 | Bacteria | 4078 |
| 6 | Ga0070683_100066308 | 3300005329 | Bacteria | 3363 |
| 7 | Ga0070683_100097786 | 3300005329 | Bacteria | 2761 |
| 8 | Ga0068869_100023516 | 3300005334 | Bacteria | 4257 |
| 9 | Ga0068869_100214756 | 3300005334 | Bacteria | 1522 |
| 10 | Ga0070680_100064868 | 3300005336 | Bacteria | 2993 |
| 11 | Ga0070680_100115577 | 3300005336 | Bacteria | 2236 |
| 12 | Ga0070680_100458440 | 3300005336 | Bacteria | 1089 |
| 13 | Ga0070660_100012266 | 3300005339 | Bacteria | 6116 |
| 14 | Ga0070660_100034793 | 3300005339 | Bacteria | 3809 |
| 15 | Ga0070660_100074586 | 3300005339 | Bacteria | 2655 |
| 16 | Ga0070689_100068427 | 3300005340 | Bacteria | 2769 |
| 17 | Ga0070691_10004603 | 3300005341 | Bacteria | 6267 |
| 18 | Ga0070691_10036564 | 3300005341 | Bacteria | 2315 |
| 19 | Ga0070687_100023150 | 3300005343 | Bacteria | 2949 |
| 20 | Ga0070668_100071010 | 3300005347 | Bacteria | 2712 |
| 21 | Ga0070669_100001748 | 3300005353 | Bacteria | 15648 |
| 22 | Ga0070675_100005979 | 3300005354 | Bacteria | 9328 |
| 23 | Ga0070675_100132673 | 3300005354 | Bacteria | 2123 |
| 24 | Ga0070671_100001564 | 3300005355 | Bacteria | 17217 |
| 25 | Ga0070671_100072473 | 3300005355 | Bacteria | 2876 |
| 26 | Ga0070674_100003280 | 3300005356 | Bacteria | 9051 |
| 27 | Ga0070673_100059007 | 3300005364 | Bacteria | 3036 |
| 28 | Ga0070673_100189298 | 3300005364 | Bacteria | 1766 |
| 29 | Ga0070659_100025518 | 3300005366 | Bacteria | 4540 |
| 30 | Ga0070667_100144405 | 3300005367 | Bacteria | 2086 |
| 31 | Ga0070714_100012757 | 3300005435 | Bacteria | 6714 |
| 32 | Ga0070714_100166348 | 3300005435 | Bacteria | 1999 |
| 33 | Ga0070713_100015995 | 3300005436 | Bacteria | 5630 |
| 34 | Ga0070713_100069771 | 3300005436 | Bacteria | 2965 |
| 35 | Ga0070713_100111793 | 3300005436 | Bacteria | 2383 |
| 36 | Ga0070713_100490536 | 3300005436 | Bacteria | 1158 |
| 37 | Ga0070711_100038821 | 3300005439 | Bacteria | 3204 |
| 38 | Ga0070711_100115374 | 3300005439 | Bacteria | 1978 |
| 39 | Ga0070711_100290706 | 3300005439 | Bacteria | 1296 |
| 40 | Ga0070705_100003221 | 3300005440 | Bacteria | 8015 |
| 41 | Ga0070705_100036336 | 3300005440 | Bacteria | 2769 |
| 42 | Ga0070694_100054221 | 3300005444 | Bacteria | 2716 |
| 43 | Ga0070694_100085911 | 3300005444 | Bacteria | 2198 |
| 44 | Ga0070663_100334758 | 3300005455 | Bacteria | 1221 |
| 45 | Ga0070678_100003224 | 3300005456 | Bacteria | 9059 |
| 46 | Ga0070662_100003892 | 3300005457 | Bacteria | 9358 |
| 47 | Ga0070662_100147286 | 3300005457 | Bacteria | 1830 |
| 48 | Ga0070662_100254748 | 3300005457 | Bacteria | 1412 |
| 49 | Ga0070681_10000441 | 3300005458 | Bacteria | 33817 |
| 50 | Ga0070681_10001537 | 3300005458 | Bacteria | 20425 |
| 51 | Ga0070681_10004802 | 3300005458 | Bacteria | 12956 |
| 52 | Ga0070681_10074738 | 3300005458 | Bacteria | 3349 |
| 53 | Ga0070681_10205038 | 3300005458 | Bacteria | 1889 |
| 54 | Ga0068867_100000309 | 3300005459 | Bacteria | 32165 |
| 55 | Ga0068867_100012468 | 3300005459 | Bacteria | 6016 |
| 56 | Ga0068867_100103844 | 3300005459 | Bacteria | 2174 |
| 57 | Ga0070685_10009147 | 3300005466 | Bacteria | 5111 |
| 58 | Ga0070699_100009238 | 3300005518 | Bacteria | 8544 |
| 59 | Ga0070679_100001789 | 3300005530 | Bacteria | 19379 |
| 60 | Ga0070679_100002960 | 3300005530 | Bacteria | 15486 |
| 61 | Ga0070679_100003023 | 3300005530 | Bacteria | 15360 |
| 62 | Ga0070679_100049650 | 3300005530 | Bacteria | 4179 |
| 63 | Ga0070679_100112648 | 3300005530 | Bacteria | 2706 |
| 64 | Ga0070684_100002594 | 3300005535 | Bacteria | 13351 |
| 65 | Ga0070684_100016923 | 3300005535 | Bacteria | 5972 |
| 66 | Ga0070684_100093560 | 3300005535 | Bacteria | 2676 |
| 67 | Ga0070684_100340789 | 3300005535 | Bacteria | 1378 |
| 68 | Ga0070697_100012402 | 3300005536 | Bacteria | 6678 |
| 69 | Ga0068853_100043338 | 3300005539 | Bacteria | 3849 |
| 70 | Ga0068853_100117196 | 3300005539 | Bacteria | 2372 |
| 71 | Ga0068853_100262910 | 3300005539 | Bacteria | 1587 |
| 72 | Ga0068853_100370414 | 3300005539 | Bacteria | 1336 |
| 73 | Ga0070672_100073195 | 3300005543 | Bacteria | 2730 |
| 74 | Ga0070695_100003895 | 3300005545 | Bacteria | 8710 |
| 75 | Ga0070695_100024875 | 3300005545 | Bacteria | 3693 |
| 76 | Ga0070695_100064259 | 3300005545 | Bacteria | 2387 |
| 77 | Ga0070696_100010195 | 3300005546 | Bacteria | 6288 |
| 78 | Ga0070696_100012252 | 3300005546 | Bacteria | 5747 |
| 79 | Ga0070696_100064549 | 3300005546 | Bacteria | 2566 |
| 80 | Ga0070693_100001942 | 3300005547 | Bacteria | 9464 |
| 81 | Ga0070693_100096630 | 3300005547 | Bacteria | 1791 |
| 82 | Ga0070665_100133396 | 3300005548 | Bacteria | 2485 |
| 83 | Ga0070704_100016010 | 3300005549 | Bacteria | 4727 |
| 84 | Ga0070704_100031426 | 3300005549 | Bacteria | 3572 |
| 85 | Ga0070704_100204006 | 3300005549 | Bacteria | 1598 |
| 86 | Ga0068855_100009276 | 3300005563 | Bacteria | 11886 |
| 87 | Ga0068855_100040881 | 3300005563 | Bacteria | 5499 |
| 88 | Ga0068855_100200751 | 3300005563 | Bacteria | 2245 |
| 89 | Ga0070664_100038330 | 3300005564 | Bacteria | 4033 |
| 90 | Ga0070664_100272772 | 3300005564 | Bacteria | 1524 |
| 91 | Ga0070664_100376321 | 3300005564 | Bacteria | 1295 |
| 92 | Ga0068857_100001612 | 3300005577 | Bacteria | 18104 |
| 93 | Ga0068857_100033001 | 3300005577 | Bacteria | 4578 |
| 94 | Ga0068857_100049444 | 3300005577 | Bacteria | 3730 |
| 95 | Ga0068854_100000233 | 3300005578 | Bacteria | 37869 |
| 96 | Ga0068856_100004846 | 3300005614 | Bacteria | 13330 |
| 97 | Ga0068856_100041063 | 3300005614 | Bacteria | 4545 |
| 98 | Ga0068856_100066505 | 3300005614 | Bacteria | 3561 |
| 99 | Ga0068856_100372998 | 3300005614 | Bacteria | 1446 |
| 100 | Ga0068856_100506229 | 3300005614 | Bacteria | 1229 |
| 101 | Ga0068856_100513782 | 3300005614 | Bacteria | 1219 |
| 102 | Ga0070702_100005809 | 3300005615 | Bacteria | 5787 |
| 103 | Ga0068859_100077697 | 3300005617 | Bacteria | 3360 |
| 104 | Ga0068859_100146789 | 3300005617 | Bacteria | 2434 |
| 105 | Ga0068859_100298922 | 3300005617 | Bacteria | 1703 |
| 106 | Ga0068864_100042025 | 3300005618 | Bacteria | 3911 |
| 107 | Ga0068864_100431062 | 3300005618 | Bacteria | 1258 |
| 108 | Ga0068866_10007873 | 3300005718 | Bacteria | 4472 |
| 109 | Ga0068861_100032981 | 3300005719 | Bacteria | 3817 |
| 110 | Ga0068861_100232516 | 3300005719 | Bacteria | 1564 |
| 111 | Ga0068858_100005708 | 3300005842 | Bacteria | 12162 |
| 112 | Ga0068858_100076781 | 3300005842 | Bacteria | 3103 |
| 113 | Ga0068860_100001540 | 3300005843 | Bacteria | 24832 |
| 114 | Ga0081455_10030790 | 3300005937 | Bacteria | 4869 |
| 115 | Ga0070717_10002009 | 3300006028 | Bacteria | 14214 |
| 116 | Ga0097621_100117304 | 3300006237 | Bacteria | 2255 |
| 117 | Ga0068871_100098532 | 3300006358 | Bacteria | 2446 |
| 118 | Ga0068871_100099279 | 3300006358 | Bacteria | 2437 |
| 119 | Ga0075428_100060430 | 3300006844 | Bacteria | 4150 |
| 120 | Ga0075428_100405643 | 3300006844 | Bacteria | 1460 |
| 121 | Ga0075431_100013860 | 3300006847 | Bacteria | 8142 |
| 122 | Ga0075431_100017316 | 3300006847 | Bacteria | 7323 |
| 123 | Ga0075431_100039998 | 3300006847 | Bacteria | 4831 |
| 124 | Ga0075433_10070382 | 3300006852 | Bacteria | 3074 |
| 125 | Ga0075434_100015810 | 3300006871 | Bacteria | 7245 |
| 126 | Ga0075434_100023568 | 3300006871 | Bacteria | 6001 |
| 127 | Ga0075429_100026199 | 3300006880 | Bacteria | 5060 |
| 128 | Ga0075429_100033910 | 3300006880 | Bacteria | 4436 |
| 129 | Ga0068865_100000964 | 3300006881 | Bacteria | 16411 |
| 130 | Ga0068865_100071845 | 3300006881 | Bacteria | 2456 |
| 131 | Ga0068865_100089115 | 3300006881 | Bacteria | 2234 |
| 132 | Ga0075436_100003059 | 3300006914 | Bacteria | 11458 |
| 133 | Ga0075436_100017485 | 3300006914 | Bacteria | 4910 |
| 134 | Ga0097620_100077697 | 3300006931 | Bacteria | 3360 |
| 135 | Ga0097620_100146784 | 3300006931 | Bacteria | 2434 |
| 136 | Ga0097620_100298939 | 3300006931 | Bacteria | 1703 |
| 137 | Ga0075435_100316686 | 3300007076 | Bacteria | 1335 |
| 138 | Ga0099794_10056931 | 3300007265 | Bacteria | 1893 |
| 139 | Ga0099795_10002880 | 3300007788 | Bacteria | 4163 |
| 140 | Ga0105240_10001183 | 3300009093 | Bacteria | 45676 |
| 141 | Ga0105240_10001383 | 3300009093 | Bacteria | 41701 |
| 142 | Ga0105240_10004420 | 3300009093 | Bacteria | 21434 |
| 143 | Ga0105240_10006165 | 3300009093 | Bacteria | 17671 |
| 144 | Ga0105240_10010543 | 3300009093 | Bacteria | 12979 |
| 145 | Ga0105240_10149863 | 3300009093 | Bacteria | 2779 |
| 146 | Ga0105240_10218330 | 3300009093 | Bacteria | 2223 |
| 147 | Ga0105240_10358815 | 3300009093 | Bacteria | 1651 |
| 148 | Ga0111539_10185779 | 3300009094 | Bacteria | 2427 |
| 149 | Ga0111539_10572655 | 3300009094 | Bacteria | 1315 |
| 150 | Ga0105245_10004774 | 3300009098 | Bacteria | 11957 |
| 151 | Ga0105245_10027240 | 3300009098 | Bacteria | 5036 |
| 152 | Ga0105245_10064625 | 3300009098 | Bacteria | 3307 |
| 153 | Ga0105245_10237463 | 3300009098 | Bacteria | 1765 |
| 154 | Ga0105247_10173112 | 3300009101 | Bacteria | 1436 |
| 155 | Ga0114129_10008584 | 3300009147 | Bacteria | 14567 |
| 156 | Ga0114129_10008737 | 3300009147 | Bacteria | 14446 |
| 157 | Ga0114129_10401377 | 3300009147 | Bacteria | 1806 |
| 158 | Ga0114129_10439525 | 3300009147 | Bacteria | 1713 |
| 159 | Ga0114129_10580631 | 3300009147 | Bacteria | 1454 |
| 160 | Ga0114129_10647649 | 3300009147 | Bacteria | 1364 |
| 161 | Ga0105243_10000865 | 3300009148 | Bacteria | 28639 |
| 162 | Ga0105243_10013671 | 3300009148 | Bacteria | 6141 |
| 163 | Ga0105243_10191376 | 3300009148 | Bacteria | 1787 |
| 164 | Ga0105243_10370596 | 3300009148 | Bacteria | 1321 |
| 165 | Ga0105241_10007408 | 3300009174 | Bacteria | 8075 |
| 166 | Ga0105241_10178866 | 3300009174 | Bacteria | 1758 |
| 167 | Ga0105241_10298267 | 3300009174 | Bacteria | 1382 |
| 168 | Ga0105242_10002781 | 3300009176 | Bacteria | 13699 |
| 169 | Ga0105242_10004104 | 3300009176 | Bacteria | 11327 |
| 170 | Ga0105248_10000002 | 3300009177 | Bacteria | 1054120 |
| 171 | Ga0105248_10020812 | 3300009177 | Bacteria | 7267 |
| 172 | Ga0105248_10089389 | 3300009177 | Bacteria | 3467 |
| 173 | Ga0105248_10102209 | 3300009177 | Bacteria | 3231 |
| 174 | Ga0105248_10143817 | 3300009177 | Bacteria | 2691 |
| 175 | Ga0105237_10004190 | 3300009545 | Bacteria | 16791 |
| 176 | Ga0105237_10025780 | 3300009545 | Bacteria | 6012 |
| 177 | Ga0105237_10043134 | 3300009545 | Bacteria | 4546 |
| 178 | Ga0105238_10002578 | 3300009551 | Bacteria | 18075 |
| 179 | Ga0105238_10005105 | 3300009551 | Bacteria | 12979 |
| 180 | Ga0105238_10024186 | 3300009551 | Bacteria | 6193 |
| 181 | Ga0105238_10255264 | 3300009551 | Bacteria | 1732 |
| 182 | Ga0105249_10007387 | 3300009553 | Bacteria | 9587 |
| 183 | Ga0105249_10028228 | 3300009553 | Bacteria | 5066 |
| 184 | Ga0099796_10000303 | 3300010159 | Bacteria | 7806 |
| 185 | Ga0105239_10006055 | 3300010375 | Bacteria | 14080 |
| 186 | Ga0105239_10011224 | 3300010375 | Bacteria | 9998 |
| 187 | Ga0105239_10024652 | 3300010375 | Bacteria | 6627 |
| 188 | Ga0105239_10048978 | 3300010375 | Bacteria | 4633 |
| 189 | Ga0105239_10383989 | 3300010375 | Bacteria | 1588 |
| 190 | Ga0105246_10013968 | 3300011119 | Bacteria | 5042 |
| 191 | Ga0105246_10062783 | 3300011119 | Bacteria | 2589 |
| 192 | Ga0105246_10193546 | 3300011119 | Bacteria | 1576 |
| 193 | Ga0157371_10013679 | 3300013102 | Bacteria | 6157 |
| 194 | Ga0157370_10001341 | 3300013104 | Bacteria | 30545 |
| 195 | Ga0157370_10016832 | 3300013104 | Bacteria | 7389 |
| 196 | Ga0157370_10021792 | 3300013104 | Bacteria | 6383 |
| 197 | Ga0157370_10034818 | 3300013104 | Bacteria | 4900 |
| 198 | Ga0157370_10137098 | 3300013104 | Bacteria | 2280 |
| 199 | Ga0157370_10252085 | 3300013104 | Bacteria | 1633 |
| 200 | Ga0157369_10004665 | 3300013105 | Bacteria | 16113 |
| 201 | Ga0157369_10006133 | 3300013105 | Bacteria | 13948 |
| 202 | Ga0157369_10015840 | 3300013105 | Bacteria | 8492 |
| 203 | Ga0157369_10046333 | 3300013105 | Bacteria | 4725 |
| 204 | Ga0157369_10046615 | 3300013105 | Bacteria | 4710 |
| 205 | Ga0157374_10011723 | 3300013296 | Bacteria | 7604 |
| 206 | Ga0157374_10032820 | 3300013296 | Bacteria | 4731 |
| 207 | Ga0157378_10000659 | 3300013297 | Bacteria | 32533 |
| 208 | Ga0157378_10001261 | 3300013297 | Bacteria | 22795 |
| 209 | Ga0157378_10324634 | 3300013297 | Bacteria | 1496 |
| 210 | Ga0163162_10035542 | 3300013306 | Bacteria | 4963 |
| 211 | Ga0157372_10002875 | 3300013307 | Bacteria | 18614 |
| 212 | Ga0157372_10005961 | 3300013307 | Bacteria | 12955 |
| 213 | Ga0157372_10008909 | 3300013307 | Bacteria | 10661 |
| 214 | Ga0157372_10011183 | 3300013307 | Bacteria | 9544 |
| 215 | Ga0157372_10106849 | 3300013307 | Bacteria | 3202 |
| 216 | Ga0157372_10119655 | 3300013307 | Bacteria | 3023 |
| 217 | Ga0157372_10308828 | 3300013307 | Bacteria | 1841 |
| 218 | Ga0157372_10412047 | 3300013307 | Bacteria | 1575 |
| 219 | Ga0157372_10507486 | 3300013307 | Bacteria | 1406 |
| 220 | Ga0157375_10012857 | 3300013308 | Bacteria | 7435 |
| 221 | Ga0157375_10016710 | 3300013308 | Bacteria | 6602 |
| 222 | Ga0157375_10097572 | 3300013308 | Bacteria | 3014 |
| 223 | Ga0157380_10212218 | 3300014326 | Bacteria | 1726 |
| 224 | Ga0157380_10251812 | 3300014326 | Bacteria | 1599 |
| 225 | Ga0157380_10288372 | 3300014326 | Bacteria | 1506 |
| 226 | Ga0157376_10252739 | 3300014969 | Bacteria | 1647 |
| 227 | Ga0163161_10015790 | 3300017792 | Bacteria | 5266 |
| 228 | Ga0163161_10214112 | 3300017792 | Bacteria | 1489 |
| 229 | Ga0206356_11887767 | 3300020070 | Bacteria | 2325 |
| 230 | Ga0207699_10056091 | 3300025906 | Bacteria | 2347 |
| 231 | Ga0207699_10127230 | 3300025906 | Bacteria | 1656 |
| 232 | Ga0207645_10005052 | 3300025907 | Bacteria | 9665 |
| 233 | Ga0207645_10150171 | 3300025907 | Bacteria | 1521 |
| 234 | Ga0207643_10001129 | 3300025908 | Bacteria | 15875 |
| 235 | Ga0207684_10251547 | 3300025910 | Bacteria | 1525 |
| 236 | Ga0207654_10015545 | 3300025911 | Bacteria | 3951 |
| 237 | Ga0207654_10161682 | 3300025911 | Bacteria | 1447 |
| 238 | Ga0207654_10172260 | 3300025911 | Bacteria | 1406 |
| 239 | Ga0207707_10000987 | 3300025912 | Bacteria | 27338 |
| 240 | Ga0207707_10002717 | 3300025912 | Bacteria | 15796 |
| 241 | Ga0207707_10002760 | 3300025912 | Bacteria | 15659 |
| 242 | Ga0207707_10011352 | 3300025912 | Bacteria | 7755 |
| 243 | Ga0207707_10031722 | 3300025912 | Bacteria | 4625 |
| 244 | Ga0207707_10094990 | 3300025912 | Bacteria | 2606 |
| 245 | Ga0207695_10003003 | 3300025913 | Bacteria | 24250 |
| 246 | Ga0207695_10003666 | 3300025913 | Bacteria | 21419 |
| 247 | Ga0207695_10012862 | 3300025913 | Bacteria | 10018 |
| 248 | Ga0207695_10015372 | 3300025913 | Bacteria | 9010 |
| 249 | Ga0207695_10038902 | 3300025913 | Bacteria | 5115 |
| 250 | Ga0207695_10156207 | 3300025913 | Bacteria | 2216 |
| 251 | Ga0207671_10019844 | 3300025914 | Bacteria | 5130 |
| 252 | Ga0207671_10265384 | 3300025914 | Bacteria | 1352 |
| 253 | Ga0207693_10039760 | 3300025915 | Bacteria | 3704 |
| 254 | Ga0207663_10024305 | 3300025916 | Bacteria | 3489 |
| 255 | Ga0207663_10048605 | 3300025916 | Bacteria | 2627 |
| 256 | Ga0207663_10139217 | 3300025916 | Bacteria | 1688 |
| 257 | Ga0207660_10006741 | 3300025917 | Bacteria | 7436 |
| 258 | Ga0207660_10010991 | 3300025917 | Bacteria | 5886 |
| 259 | Ga0207660_10029149 | 3300025917 | Bacteria | 3782 |
| 260 | Ga0207662_10013560 | 3300025918 | Bacteria | 4559 |
| 261 | Ga0207657_10021277 | 3300025919 | Bacteria | 6109 |
| 262 | Ga0207657_10057745 | 3300025919 | Bacteria | 3343 |
| 263 | Ga0207657_10197003 | 3300025919 | Bacteria | 1622 |
| 264 | Ga0207649_10031377 | 3300025920 | Bacteria | 3157 |
| 265 | Ga0207649_10112669 | 3300025920 | Bacteria | 1820 |
| 266 | Ga0207649_10163862 | 3300025920 | Bacteria | 1543 |
| 267 | Ga0207652_10001801 | 3300025921 | Bacteria | 18612 |
| 268 | Ga0207652_10008781 | 3300025921 | Bacteria | 8136 |
| 269 | Ga0207652_10009001 | 3300025921 | Bacteria | 8045 |
| 270 | Ga0207652_10065911 | 3300025921 | Bacteria | 3137 |
| 271 | Ga0207652_10169534 | 3300025921 | Bacteria | 1958 |
| 272 | Ga0207652_10471015 | 3300025921 | Bacteria | 1132 |
| 273 | Ga0207646_10123495 | 3300025922 | Bacteria | 2327 |
| 274 | Ga0207681_10013396 | 3300025923 | Bacteria | 5075 |
| 275 | Ga0207694_10003089 | 3300025924 | Bacteria | 13330 |
| 276 | Ga0207694_10005174 | 3300025924 | Bacteria | 10073 |
| 277 | Ga0207694_10006757 | 3300025924 | Bacteria | 8712 |
| 278 | Ga0207694_10007780 | 3300025924 | Bacteria | 8115 |
| 279 | Ga0207659_10011148 | 3300025926 | Bacteria | 5672 |
| 280 | Ga0207687_10009224 | 3300025927 | Bacteria | 6456 |
| 281 | Ga0207687_10032394 | 3300025927 | Bacteria | 3540 |
| 282 | Ga0207687_10213504 | 3300025927 | Bacteria | 1515 |
| 283 | Ga0207700_10041874 | 3300025928 | Bacteria | 3354 |
| 284 | Ga0207700_10054190 | 3300025928 | Bacteria | 3009 |
| 285 | Ga0207664_10062105 | 3300025929 | Bacteria | 2983 |
| 286 | Ga0207664_10285312 | 3300025929 | Bacteria | 1449 |
| 287 | Ga0207690_10038767 | 3300025932 | Bacteria | 3104 |
| 288 | Ga0207690_10043386 | 3300025932 | Bacteria | 2960 |
| 289 | Ga0207690_10050129 | 3300025932 | Bacteria | 2786 |
| 290 | Ga0207706_10000005 | 3300025933 | Bacteria | 224460 |
| 291 | Ga0207706_10016085 | 3300025933 | Bacteria | 6760 |
| 292 | Ga0207706_10266169 | 3300025933 | Bacteria | 1496 |
| 293 | Ga0207706_10409333 | 3300025933 | Bacteria | 1175 |
| 294 | Ga0207706_10435923 | 3300025933 | Bacteria | 1135 |
| 295 | Ga0207686_10000123 | 3300025934 | Bacteria | 62530 |
| 296 | Ga0207709_10001959 | 3300025935 | Bacteria | 13455 |
| 297 | Ga0207709_10078736 | 3300025935 | Bacteria | 2117 |
| 298 | Ga0207709_10101568 | 3300025935 | Bacteria | 1902 |
| 299 | Ga0207669_10002038 | 3300025937 | Bacteria | 8561 |
| 300 | Ga0207704_10001280 | 3300025938 | Bacteria | 11246 |
| 301 | Ga0207704_10214283 | 3300025938 | Bacteria | 1420 |
| 302 | Ga0207665_10104944 | 3300025939 | Bacteria | 1978 |
| 303 | Ga0207691_10113308 | 3300025940 | Bacteria | 2410 |
| 304 | Ga0207711_10000842 | 3300025941 | Bacteria | 29652 |
| 305 | Ga0207711_10001497 | 3300025941 | Bacteria | 21763 |
| 306 | Ga0207711_10120233 | 3300025941 | Bacteria | 2344 |
| 307 | Ga0207711_10380149 | 3300025941 | Bacteria | 1310 |
| 308 | Ga0207689_10005606 | 3300025942 | Bacteria | 11186 |
| 309 | Ga0207689_10065388 | 3300025942 | Bacteria | 2991 |
| 310 | Ga0207661_10011015 | 3300025944 | Bacteria | 6535 |
| 311 | Ga0207661_10032308 | 3300025944 | Bacteria | 4053 |
| 312 | Ga0207661_10043381 | 3300025944 | Bacteria | 3549 |
| 313 | Ga0207661_10069894 | 3300025944 | Bacteria | 2864 |
| 314 | Ga0207661_10150472 | 3300025944 | Bacteria | 2011 |
| 315 | Ga0207661_10151116 | 3300025944 | Bacteria | 2007 |
| 316 | Ga0207661_10198862 | 3300025944 | Bacteria | 1761 |
| 317 | Ga0207679_10013030 | 3300025945 | Bacteria | 5441 |
| 318 | Ga0207667_10000332 | 3300025949 | Bacteria | 64962 |
| 319 | Ga0207667_10003900 | 3300025949 | Bacteria | 18344 |
| 320 | Ga0207667_10005708 | 3300025949 | Bacteria | 15179 |
| 321 | Ga0207712_10005953 | 3300025961 | Bacteria | 7693 |
| 322 | Ga0207668_10027060 | 3300025972 | Bacteria | 3733 |
| 323 | Ga0207640_10000870 | 3300025981 | Bacteria | 17150 |
| 324 | Ga0207640_10232366 | 3300025981 | Bacteria | 1419 |
| 325 | Ga0207658_10054755 | 3300025986 | Bacteria | 2953 |
| 326 | Ga0207658_10174052 | 3300025986 | Bacteria | 1776 |
| 327 | Ga0207677_10131340 | 3300026023 | Bacteria | 1902 |
| 328 | Ga0207703_10002747 | 3300026035 | Bacteria | 15075 |
| 329 | Ga0207703_10145025 | 3300026035 | Bacteria | 2064 |
| 330 | Ga0207703_10212200 | 3300026035 | Bacteria | 1727 |
| 331 | Ga0207703_10467254 | 3300026035 | Bacteria | 1181 |
| 332 | Ga0207639_10074665 | 3300026041 | Bacteria | 2663 |
| 333 | Ga0207639_10400693 | 3300026041 | Bacteria | 1236 |
| 334 | Ga0207639_10404686 | 3300026041 | Bacteria | 1230 |
| 335 | Ga0207678_10072069 | 3300026067 | Bacteria | 2960 |
| 336 | Ga0207678_10354848 | 3300026067 | Bacteria | 1265 |
| 337 | Ga0207702_10004800 | 3300026078 | Bacteria | 11916 |
| 338 | Ga0207702_10028305 | 3300026078 | Bacteria | 4657 |
| 339 | Ga0207702_10109507 | 3300026078 | Bacteria | 2453 |
| 340 | Ga0207702_10121746 | 3300026078 | Bacteria | 2336 |
| 341 | Ga0207702_10201337 | 3300026078 | Bacteria | 1846 |
| 342 | Ga0207648_10000008 | 3300026089 | Bacteria | 208822 |
| 343 | Ga0207648_10024869 | 3300026089 | Bacteria | 5340 |
| 344 | Ga0207676_10521429 | 3300026095 | Bacteria | 1131 |
| 345 | Ga0207674_10000300 | 3300026116 | Bacteria | 62723 |
| 346 | Ga0207674_10002379 | 3300026116 | Bacteria | 23783 |
| 347 | Ga0207674_10003778 | 3300026116 | Bacteria | 18471 |
| 348 | Ga0207674_10007051 | 3300026116 | Bacteria | 13138 |
| 349 | Ga0207675_100049160 | 3300026118 | Bacteria | 3937 |
| 350 | Ga0207675_100278659 | 3300026118 | Bacteria | 1624 |
| 351 | Ga0207675_100458635 | 3300026118 | Bacteria | 1264 |
| 352 | Ga0207683_10009983 | 3300026121 | Bacteria | 8101 |
| 353 | Ga0207683_10292163 | 3300026121 | Bacteria | 1490 |
| 354 | Ga0207698_10010253 | 3300026142 | Bacteria | 6009 |
| 355 | Ga0209179_1003094 | 3300027512 | Bacteria | 2351 |
| 356 | Ga0209588_1024375 | 3300027671 | Bacteria | 1910 |
| 357 | Ga0209588_1028027 | 3300027671 | Bacteria | 1792 |
| 358 | Ga0209971_1019249 | 3300027682 | Bacteria | 1621 |
| 359 | Ga0209974_10015189 | 3300027876 | Bacteria | 2556 |
| 360 | Ga0265354_1000189 | 3300028016 | Bacteria | 11333 |
| 361 | Ga0268266_10096961 | 3300028379 | Bacteria | 2593 |
| 362 | Ga0265318_10011338 | 3300028577 | Bacteria | 3840 |
| 363 | Ga0265323_10000932 | 3300028653 | Bacteria | 15376 |
| 364 | Ga0265336_10001161 | 3300028666 | Bacteria | 12590 |
| 365 | Ga0265338_10024486 | 3300028800 | Bacteria | 6165 |
| 366 | Ga0265338_10039023 | 3300028800 | Bacteria | 4488 |
| 367 | Ga0265338_10039150 | 3300028800 | Bacteria | 4479 |
| 368 | Ga0265338_10056370 | 3300028800 | Bacteria | 3486 |
| 369 | Ga0265338_10063395 | 3300028800 | Bacteria | 3223 |
| 370 | Ga0265338_10147153 | 3300028800 | Bacteria | 1836 |
| 371 | Ga0265770_1003323 | 3300030878 | Bacteria | 2186 |
| 372 | Ga0265760_10002519 | 3300031090 | Bacteria | 5344 |
| 373 | Ga0265330_10004148 | 3300031235 | Bacteria | 7412 |
| 374 | Ga0265330_10009553 | 3300031235 | Bacteria | 4603 |
| 375 | Ga0265330_10026239 | 3300031235 | Bacteria | 2636 |
| 376 | Ga0265320_10022135 | 3300031240 | Bacteria | 3406 |
| 377 | Ga0265325_10013390 | 3300031241 | Bacteria | 4670 |
| 378 | Ga0265340_10026021 | 3300031247 | Bacteria | 2961 |
| 379 | Ga0265339_10000457 | 3300031249 | Bacteria | 31937 |
| 380 | Ga0265339_10000474 | 3300031249 | Bacteria | 31375 |
| 381 | Ga0265339_10069814 | 3300031249 | Bacteria | 1874 |
| 382 | Ga0265331_10015412 | 3300031250 | Bacteria | 4035 |
| 383 | Ga0265331_10056265 | 3300031250 | Bacteria | 1868 |
| 384 | Ga0265316_10001044 | 3300031344 | Bacteria | 30001 |
| 385 | Ga0265316_10012825 | 3300031344 | Bacteria | 7485 |
| 386 | Ga0265316_10017055 | 3300031344 | Bacteria | 6286 |
| 387 | Ga0265316_10033866 | 3300031344 | Bacteria | 4155 |
| 388 | Ga0265316_10084425 | 3300031344 | Bacteria | 2432 |
| 389 | Ga0307408_100028718 | 3300031548 | Bacteria | 3847 |
| 390 | Ga0307408_100163729 | 3300031548 | Bacteria | 1769 |
| 391 | Ga0307408_100359729 | 3300031548 | Bacteria | 1238 |
| 392 | Ga0307408_100514742 | 3300031548 | Bacteria | 1050 |
| 393 | Ga0265313_10007313 | 3300031595 | Bacteria | 7577 |
| 394 | Ga0265313_10009170 | 3300031595 | Bacteria | 6455 |
| 395 | Ga0265313_10046341 | 3300031595 | Bacteria | 2111 |
| 396 | Ga0265314_10000261 | 3300031711 | Bacteria | 77506 |
| 397 | Ga0265314_10001995 | 3300031711 | Bacteria | 21647 |
| 398 | Ga0265314_10007657 | 3300031711 | Bacteria | 9339 |
| 399 | Ga0265314_10013305 | 3300031711 | Bacteria | 6654 |
| 400 | Ga0265314_10016081 | 3300031711 | Bacteria | 5923 |
| 401 | Ga0265314_10148423 | 3300031711 | Bacteria | 1441 |
| 402 | Ga0265342_10001022 | 3300031712 | Bacteria | 27535 |
| 403 | Ga0265342_10006082 | 3300031712 | Bacteria | 9057 |
| 404 | Ga0265342_10051431 | 3300031712 | Bacteria | 2458 |
| 405 | Ga0307405_10012382 | 3300031731 | Bacteria | 4513 |
| 406 | Ga0307405_10028517 | 3300031731 | Bacteria | 3253 |
| 407 | Ga0307410_10000285 | 3300031852 | Bacteria | 19565 |
| 408 | Ga0307410_10040015 | 3300031852 | Bacteria | 3082 |
| 409 | Ga0307410_10276514 | 3300031852 | Bacteria | 1316 |
| 410 | Ga0307406_10070480 | 3300031901 | Bacteria | 2289 |
| 411 | Ga0307407_10006354 | 3300031903 | Bacteria | 5237 |
| 412 | Ga0307407_10142808 | 3300031903 | Bacteria | 1546 |
| 413 | Ga0307412_10075856 | 3300031911 | Bacteria | 2308 |
| 414 | Ga0307412_10237809 | 3300031911 | Bacteria | 1407 |
| 415 | Ga0307409_100026816 | 3300031995 | Bacteria | 4071 |
| 416 | Ga0307409_100040386 | 3300031995 | Bacteria | 3473 |
| 417 | Ga0307409_100053537 | 3300031995 | Bacteria | 3101 |
| 418 | Ga0307409_100295479 | 3300031995 | Bacteria | 1504 |
| 419 | Ga0307416_100005552 | 3300032002 | Bacteria | 7762 |
| 420 | Ga0307416_100035999 | 3300032002 | Bacteria | 3789 |
| 421 | Ga0307416_100089039 | 3300032002 | Bacteria | 2641 |
| 422 | Ga0307414_10004400 | 3300032004 | Bacteria | 7652 |
| 423 | Ga0307414_10117335 | 3300032004 | Bacteria | 2039 |
| 424 | Ga0307411_10107604 | 3300032005 | Bacteria | 1987 |
| 425 | Ga0307411_10189400 | 3300032005 | Bacteria | 1569 |
| 426 | Ga0307415_100039686 | 3300032126 | Bacteria | 3114 |
| 427 | Ga0307415_100204440 | 3300032126 | Bacteria | 1570 |
| 428 | Ga0373926_0013943 | 3300035083 | Bacteria | 2729 |
| 429 | Ga0373944_0002300 | 3300035089 | Bacteria | 4862 |
| 430 | Ga0373923_0012458 | 3300035111 | Bacteria | 3144 |
| 431 | Ga0373936_0028798 | 3300035113 | Bacteria | 2185 |
| 432 | Ga0373941_0031698 | 3300035115 | Bacteria | 1577 |
| 433 | Ga0373945_0010724 | 3300035116 | Bacteria | 3020 |
| 434 | Ga0373953_0015245 | 3300035117 | Bacteria | 2781 |
| 435 | Ga0373954_0022191 | 3300035118 | Bacteria | 2877 |
| 436 | Ga0373954_0044644 | 3300035118 | Bacteria | 2069 |
| 437 | Ga0373954_0092125 | 3300035118 | Bacteria | 1456 |
| 438 | Ga0373957_0039068 | 3300035120 | Bacteria | 1779 |
| 439 | Ga0373943_0005645 | 3300035170 | Bacteria | 5613 |
| 440 | Ga0373943_0044694 | 3300035170 | Bacteria | 2156 |
| 441 | Ga0373946_0005284 | 3300035171 | Bacteria | 4656 |
| 442 | Ga0373955_0037364 | 3300035172 | Bacteria | 2581 |
| 443 | Ga0373955_0109328 | 3300035172 | Bacteria | 1597 |
| 444 | Ga0373955_0259037 | 3300035172 | Bacteria | 1044 |
| 445 | Ga0373931_0044005 | 3300035691 | Bacteria | 2354 |
| 446 | Ga0373927_0002599 | 3300035695 | Bacteria | 13156 |
| 447 | Ga0373927_0003663 | 3300035695 | Bacteria | 10949 |
| 448 | Ga0373927_0017817 | 3300035695 | Bacteria | 4671 |
| 449 | Ga0373927_0022906 | 3300035695 | Bacteria | 4092 |
| 450 | Ga0373933_0013032 | 3300035724 | Bacteria | 4602 |
| 451 | Ga0373933_0031506 | 3300035724 | Bacteria | 3076 |
| 452 | Ga0373947_0000975 | 3300035725 | Bacteria | 17477 |
| 453 | Ga0373947_0086905 | 3300035725 | Bacteria | 1944 |
| 454 | Ga0373947_0103620 | 3300035725 | Bacteria | 1791 |
| 455 | Ga0373947_0195993 | 3300035725 | Bacteria | 1320 |
| 456 | Ga0373937_0009964 | 3300036401 | Bacteria | 8286 |
| 457 | Ga0373937_0036661 | 3300036401 | Bacteria | 4469 |
| 458 | Ga0373937_0076033 | 3300036401 | Bacteria | 3101 |
| 459 | Ga0373937_0108009 | 3300036401 | Bacteria | 2587 |
| 460 | Ga0373925_0001709 | 3300037068 | Bacteria | 18501 |
| 461 | Ga0373925_0017306 | 3300037068 | Bacteria | 5223 |
| 462 | Ga0436364_1031302 | 3300037853 | Bacteria | 2654 |
| 463 | Ga0400489_90906 | 3300039093 | Bacteria | 2368 |
| 464 | Ga0436365_0549141 | 3300039437 | Bacteria | 7475 |
| 465 | Ga0436365_1319592 | 3300039437 | Bacteria | 6280 |
| 466 | Ga0436360_1020218 | 3300039438 | Bacteria | 3720 |
| 467 | Ga0436361_0745744 | 3300039447 | Bacteria | 1195 |
| 468 | Ga0439455_0004315 | 3300042012 | Bacteria | 2810 |
| 469 | Ga0450910_011487 | 3300042147 | Bacteria | 1271 |
| 470 | Ga0451577_0000932 | 3300042876 | Bacteria | 42989 |
| 471 | Ga0451577_0003861 | 3300042876 | Bacteria | 16272 |
| 472 | Ga0453684_0000577 | 3300044712 | Bacteria | 136326 |
| 473 | Ga0495603_0002024 | 3300046455 | Bacteria | 11933 |
| 474 | Ga0495629_0003783 | 3300046459 | Bacteria | 11396 |
| 475 | Ga0495629_0265239 | 3300046459 | Bacteria | 1180 |
| 476 | Ga0495641_0051079 | 3300046461 | Bacteria | 1889 |
| 477 | Ga0495651_0000096 | 3300046462 | Bacteria | 64781 |
| 478 | Ga0495651_0000672 | 3300046462 | Bacteria | 26582 |
| 479 | Ga0495653_0046413 | 3300046463 | Bacteria | 3364 |
| 480 | Ga0495653_0084832 | 3300046463 | Bacteria | 2332 |
| 481 | Ga0495580_0115609 | 3300046472 | Bacteria | 1863 |
| 482 | Ga0495582_0003153 | 3300046473 | Bacteria | 9254 |
| 483 | Ga0495582_0003312 | 3300046473 | Bacteria | 9053 |
| 484 | Ga0495582_0059121 | 3300046473 | Bacteria | 2115 |
| 485 | Ga0495639_0000175 | 3300046475 | Bacteria | 33683 |
| 486 | Ga0495639_0073206 | 3300046475 | Bacteria | 1585 |
| 487 | Ga0495608_0006128 | 3300046511 | Bacteria | 8532 |
| 488 | Ga0495608_0034153 | 3300046511 | Bacteria | 3435 |
| 489 | Ga0495608_0081488 | 3300046511 | Bacteria | 2102 |
| 490 | Ga0495618_0087101 | 3300046514 | Bacteria | 1997 |
| 491 | Ga0495628_0002142 | 3300046516 | Bacteria | 17885 |
| 492 | Ga0495628_0021894 | 3300046516 | Bacteria | 5252 |
| 493 | Ga0495628_0090695 | 3300046516 | Bacteria | 2366 |
| 494 | Ga0495628_0115180 | 3300046516 | Bacteria | 2065 |
| 495 | Ga0495630_0005659 | 3300046517 | Bacteria | 8830 |
| 496 | Ga0495630_0039106 | 3300046517 | Bacteria | 3548 |
| 497 | Ga0495630_0046284 | 3300046517 | Bacteria | 3252 |
| 498 | Ga0495630_0190852 | 3300046517 | Bacteria | 1563 |
| 499 | Ga0495652_0008631 | 3300046529 | Bacteria | 9289 |
| 500 | Ga0495652_0024887 | 3300046529 | Bacteria | 5297 |
| 501 | Ga0495652_0138416 | 3300046529 | Bacteria | 1917 |
| 502 | Ga0495665_0000126 | 3300046531 | Bacteria | 36841 |
| 503 | Ga0495665_0045001 | 3300046531 | Bacteria | 2344 |
| 504 | Ga0495586_0030050 | 3300046535 | Bacteria | 2908 |
| 505 | Ga0495586_0196439 | 3300046535 | Bacteria | 1143 |
| 506 | Ga0495587_0023206 | 3300046536 | Bacteria | 3813 |
| 507 | Ga0495587_0073191 | 3300046536 | Bacteria | 1991 |
| 508 | Ga0495587_0148852 | 3300046536 | Bacteria | 1334 |
| 509 | Ga0495645_0079964 | 3300046543 | Bacteria | 2347 |
| 510 | Ga0495645_0088352 | 3300046543 | Bacteria | 2217 |
| 511 | Ga0495667_0001699 | 3300046559 | Bacteria | 14621 |
| 512 | Ga0495667_0049766 | 3300046559 | Bacteria | 2766 |
| 513 | Ga0495634_0025120 | 3300046642 | Bacteria | 4174 |
| 514 | Ga0495635_0016425 | 3300046663 | Bacteria | 5170 |
| 515 | Ga0495588_0000742 | 3300046674 | Bacteria | 14870 |
| 516 | Ga0495657_0005455 | 3300046675 | Bacteria | 10072 |
| 517 | Ga0495657_0041352 | 3300046675 | Bacteria | 3155 |
| 518 | Ga0495657_0191163 | 3300046675 | Bacteria | 1251 |
| 519 | Ga0495599_0002944 | 3300046678 | Bacteria | 9901 |
| 520 | Ga0495599_0003824 | 3300046678 | Bacteria | 8842 |
| 521 | Ga0495623_0018113 | 3300046679 | Bacteria | 4548 |
| 522 | Ga0495623_0156108 | 3300046679 | Bacteria | 1345 |
| 523 | Ga0495646_0004263 | 3300046680 | Bacteria | 9000 |
| 524 | Ga0495658_0000622 | 3300046683 | Bacteria | 19288 |
| 525 | Ga0495613_0120053 | 3300046689 | Bacteria | 1888 |
| 526 | Ga0495613_0185380 | 3300046689 | Bacteria | 1472 |
| 527 | Ga0495624_0209542 | 3300046690 | Bacteria | 1182 |
| 528 | Ga0495624_0243096 | 3300046690 | Bacteria | 1089 |
| 529 | Ga0495600_0043815 | 3300046809 | Bacteria | 2919 |
| 530 | Ga0495581_0003733 | 3300047315 | Bacteria | 8776 |
| 531 | Ga0495581_0117810 | 3300047315 | Bacteria | 1545 |
| 532 | Ga0495604_0002583 | 3300047317 | Bacteria | 14505 |
| 533 | Ga0495604_0005994 | 3300047317 | Bacteria | 9651 |
| 534 | Ga0495604_0038772 | 3300047317 | Bacteria | 3749 |
| 535 | Ga0495604_0172479 | 3300047317 | Bacteria | 1520 |
| 536 | Ga0495604_0286786 | 3300047317 | Bacteria | 1110 |
| 537 | Ga0495674_0009734 | 3300047319 | Bacteria | 9124 |
| 538 | Ga0495674_0049256 | 3300047319 | Unclassified | 3724 |
| 539 | Ga0495674_0087608 | 3300047319 | Bacteria | 2664 |
| 540 | Ga0495674_0256193 | 3300047319 | Bacteria | 1439 |
| 541 | Ga0495674_0316798 | 3300047319 | Bacteria | 1271 |
| 542 | Ga0495674_0355722 | 3300047319 | Bacteria | 1188 |
| 543 | Ga0495680_0000034 | 3300047322 | Bacteria | 107708 |
| 544 | Ga0495680_0039538 | 3300047322 | Bacteria | 3762 |
| 545 | Ga0495675_0001342 | 3300047444 | Bacteria | 14908 |
| 546 | Ga0495675_0045131 | 3300047444 | Bacteria | 2806 |
| 547 | Ga0495675_0109537 | 3300047444 | Bacteria | 1724 |
| 548 | Ga0495675_0115711 | 3300047444 | Bacteria | 1672 |
| 549 | Ga0495675_0187021 | 3300047444 | Bacteria | 1266 |
| 550 | Ga0495675_0226708 | 3300047444 | Bacteria | 1129 |
| 551 | Ga0495684_0000646 | 3300047471 | Bacteria | 28009 |
| 552 | Ga0495684_0004482 | 3300047471 | Bacteria | 10910 |
| 553 | Ga0495684_0032650 | 3300047471 | Bacteria | 3997 |
| 554 | Ga0495684_0157293 | 3300047471 | Bacteria | 1697 |
| 555 | Ga0495684_0201423 | 3300047471 | Bacteria | 1467 |
| 556 | Ga0495593_0000199 | 3300047673 | Bacteria | 31561 |
| 557 | Ga0495593_0068308 | 3300047673 | Bacteria | 1849 |
| 558 | Ga0495602_0124710 | 3300048088 | Bacteria | 2065 |
| 559 | Ga0495614_0007404 | 3300048089 | Bacteria | 4887 |
| 560 | Ga0496100_0061882 | 3300048903 | Bacteria | 2468 |
| 561 | Ga0496100_0071551 | 3300048903 | Bacteria | 2316 |
| 562 | Ga0496101_0063871 | 3300048904 | Bacteria | 2681 |
| 563 | Ga0496101_0311079 | 3300048904 | Bacteria | 1235 |
| 564 | Ga0496101_0347576 | 3300048904 | Bacteria | 1165 |
| 565 | Ga0496102_0062017 | 3300048905 | Bacteria | 3423 |
| 566 | Ga0496102_0088833 | 3300048905 | Bacteria | 2858 |
| 567 | Ga0496102_0198903 | 3300048905 | Bacteria | 1889 |
| 568 | Ga0496102_0216865 | 3300048905 | Bacteria | 1804 |
| 569 | Ga0496102_0286372 | 3300048905 | Bacteria | 1553 |
| 570 | Ga0496102_0360239 | 3300048905 | Bacteria | 1369 |
| 571 | Ga0496103_0270881 | 3300048906 | Bacteria | 1092 |
| 572 | Ga0496104_0004692 | 3300048907 | Bacteria | 11902 |
| 573 | Ga0496104_0018077 | 3300048907 | Bacteria | 6428 |
| 574 | Ga0496104_0041304 | 3300048907 | Bacteria | 4325 |
| 575 | Ga0496104_0145616 | 3300048907 | Bacteria | 2275 |
| 576 | Ga0496105_0044598 | 3300048908 | Bacteria | 3658 |
| 577 | Ga0496106_0042683 | 3300048909 | Bacteria | 3401 |
| 578 | Ga0496106_0083072 | 3300048909 | Bacteria | 2463 |
| 579 | Ga0496107_0142294 | 3300048910 | Bacteria | 1773 |
| 580 | Ga0496108_0010855 | 3300048911 | Bacteria | 7394 |
| 581 | Ga0496108_0059514 | 3300048911 | Bacteria | 3212 |
| 582 | Ga0496108_0154035 | 3300048911 | Bacteria | 1984 |
| 583 | Ga0496108_0185433 | 3300048911 | Bacteria | 1802 |
| 584 | Ga0496109_0011387 | 3300048912 | Bacteria | 7643 |
| 585 | Ga0496109_0416476 | 3300048912 | Bacteria | 1269 |
| 586 | Ga0496110_0033866 | 3300048913 | Bacteria | 4421 |
| 587 | Ga0496111_0210217 | 3300048914 | Bacteria | 1445 |
| 588 | Ga0496112_0000744 | 3300048915 | Bacteria | 22725 |
| 589 | Ga0496112_0007979 | 3300048915 | Bacteria | 9440 |
| 590 | Ga0496112_0009902 | 3300048915 | Bacteria | 8619 |
| 591 | Ga0496112_0047615 | 3300048915 | Bacteria | 4207 |
| 592 | Ga0496112_0143435 | 3300048915 | Bacteria | 2357 |
| 593 | Ga0496112_0144641 | 3300048915 | Bacteria | 2346 |
| 594 | Ga0496113_0000426 | 3300048916 | Bacteria | 20476 |
| 595 | Ga0496113_0002320 | 3300048916 | Bacteria | 10995 |
| 596 | Ga0496113_0018528 | 3300048916 | Bacteria | 4851 |
| 597 | Ga0496113_0233477 | 3300048916 | Bacteria | 1467 |
| 598 | Ga0496114_0249901 | 3300048917 | Bacteria | 1560 |
| 599 | Ga0496115_0049677 | 3300048918 | Bacteria | 3358 |
| 600 | Ga0496115_0081763 | 3300048918 | Bacteria | 2631 |
| 601 | Ga0496126_0001121 | 3300048929 | Bacteria | 44841 |
| 602 | Ga0501031_0062022 | 3300049568 | Bacteria | 2436 |
| 603 | Ga0501031_0108905 | 3300049568 | Bacteria | 1809 |
| 604 | Ga0501032_0000238 | 3300049569 | Bacteria | 45642 |
| 605 | Ga0501033_0250363 | 3300049570 | Bacteria | 1256 |
| 606 | Ga0501034_0032395 | 3300049571 | Bacteria | 5307 |
| 607 | Ga0501034_0050238 | 3300049571 | Bacteria | 4206 |
| 608 | Ga0501034_0126680 | 3300049571 | Bacteria | 2538 |
| 609 | Ga0501034_0158075 | 3300049571 | Bacteria | 2239 |
| 610 | Ga0501036_0020992 | 3300049572 | Bacteria | 5484 |
| 611 | Ga0501036_0037224 | 3300049572 | Bacteria | 4116 |
| 612 | Ga0501036_0125412 | 3300049572 | Bacteria | 2168 |
| 613 | Ga0501037_0033834 | 3300049573 | Bacteria | 3774 |
| 614 | Ga0501037_0054099 | 3300049573 | Bacteria | 2936 |
| 615 | Ga0501038_0016573 | 3300049574 | Bacteria | 6680 |
| 616 | Ga0501038_0070585 | 3300049574 | Bacteria | 2965 |
| 617 | Ga0501038_0176632 | 3300049574 | Bacteria | 1725 |
| 618 | Ga0501038_0198596 | 3300049574 | Bacteria | 1611 |
| 619 | Ga0501039_0005219 | 3300049575 | Bacteria | 9836 |
| 620 | Ga0501039_0013177 | 3300049575 | Bacteria | 6319 |
| 621 | Ga0501040_0112675 | 3300049576 | Bacteria | 1903 |
| 622 | Ga0501040_0141970 | 3300049576 | Bacteria | 1692 |
| 623 | Ga0501040_0157314 | 3300049576 | Bacteria | 1605 |
| 624 | Ga0501041_0023604 | 3300049577 | Bacteria | 3689 |
| 625 | Ga0501041_0151286 | 3300049577 | Bacteria | 1449 |
| 626 | Ga0501042_0326152 | 3300049578 | Bacteria | 1109 |
| 627 | Ga0501043_0023740 | 3300049579 | Bacteria | 4810 |
| 628 | Ga0501043_0059264 | 3300049579 | Bacteria | 3004 |
| 629 | Ga0501046_0016583 | 3300049580 | Bacteria | 6164 |
| 630 | Ga0501046_0073691 | 3300049580 | Bacteria | 2649 |
| 631 | Ga0501047_0009783 | 3300049581 | Bacteria | 9061 |
| 632 | Ga0501047_0020624 | 3300049581 | Bacteria | 6328 |
| 633 | Ga0501047_0030744 | 3300049581 | Bacteria | 5175 |
| 634 | Ga0501047_0075517 | 3300049581 | Bacteria | 3243 |
| 635 | Ga0501047_0301168 | 3300049581 | Bacteria | 1446 |
| 636 | Ga0501048_0021788 | 3300049582 | Bacteria | 4690 |
| 637 | Ga0501067_0208265 | 3300049583 | Bacteria | 1089 |
| 638 | Ga0501068_0004498 | 3300049584 | Bacteria | 7589 |
| 639 | Ga0501069_0007160 | 3300049585 | Bacteria | 5847 |
| 640 | Ga0501069_0020196 | 3300049585 | Bacteria | 3607 |
| 641 | Ga0501072_0038938 | 3300049588 | Bacteria | 3732 |
| 642 | Ga0501072_0083846 | 3300049588 | Bacteria | 2527 |
| 643 | Ga0501072_0146731 | 3300049588 | Bacteria | 1881 |
| 644 | Ga0501073_0079872 | 3300049589 | Bacteria | 2276 |
| 645 | Ga0501074_0035048 | 3300049590 | Bacteria | 3637 |
| 646 | Ga0501075_0048078 | 3300049591 | Bacteria | 3206 |
| 647 | Ga0501075_0136923 | 3300049591 | Bacteria | 1865 |
| 648 | Ga0501075_0144331 | 3300049591 | Bacteria | 1814 |
| 649 | Ga0501076_0019020 | 3300049592 | Bacteria | 5241 |
| 650 | Ga0501076_0106700 | 3300049592 | Bacteria | 2261 |
| 651 | Ga0501076_0202838 | 3300049592 | Bacteria | 1620 |
| 652 | Ga0501077_0031050 | 3300049593 | Bacteria | 3399 |
| 653 | Ga0501249_003203 | 3300049679 | Unclassified | 3295 |
| 654 | Ga0501256_005441 | 3300049685 | Bacteria | 1122 |
| 655 | Ga0501259_007145 | 3300049688 | Bacteria | 1785 |
| 656 | Ga0501079_0035661 | 3300049741 | Bacteria | 3830 |
| 657 | Ga0501079_0059519 | 3300049741 | Bacteria | 2946 |
| 658 | Ga0501080_0001278 | 3300049742 | Bacteria | 20899 |
| 659 | Ga0501080_0019896 | 3300049742 | Bacteria | 6216 |
| 660 | Ga0501080_0064732 | 3300049742 | Bacteria | 3400 |
| 661 | Ga0501080_0189296 | 3300049742 | Bacteria | 1891 |
| 662 | Ga0501080_0246801 | 3300049742 | Bacteria | 1628 |
| 663 | Ga0501081_0052128 | 3300049743 | Bacteria | 2822 |
| 664 | Ga0501081_0122166 | 3300049743 | Bacteria | 1856 |
| 665 | Ga0501081_0250693 | 3300049743 | Bacteria | 1292 |
| 666 | Ga0501083_0035705 | 3300049744 | Bacteria | 3394 |
| 667 | Ga0501083_0047336 | 3300049744 | Bacteria | 2905 |
| 668 | Ga0501083_0088428 | 3300049744 | Bacteria | 2048 |
| 669 | Ga0501035_0133107 | 3300049822 | Bacteria | 2166 |
| 670 | Ga0501035_0207918 | 3300049822 | Bacteria | 1676 |
| 671 | Ga0501035_0255713 | 3300049822 | Bacteria | 1486 |
| 672 | Ga0501044_0023762 | 3300049823 | Bacteria | 6518 |
| 673 | Ga0501044_0044285 | 3300049823 | Bacteria | 4618 |
| 674 | Ga0501044_0162508 | 3300049823 | Bacteria | 2209 |
| 675 | nmdc:mga05p37_580_c1 | 3300050507 | Bacteria | 40207 |
| 676 | nmdc:mga09592_143903_c1 | 3300050508 | Bacteria | 2055 |
| 677 | nmdc:mga09592_35717_c1 | 3300050508 | Bacteria | 4161 |
| 678 | nmdc:mga09592_77562_c1 | 3300050508 | Bacteria | 2826 |
| 679 | nmdc:mga0qj67_297747_c1 | 3300050509 | Bacteria | 1307 |
| 680 | nmdc:mga0qj67_53394_c1 | 3300050509 | Bacteria | 3199 |
| 681 | nmdc:mga06r32_19415_c1 | 3300050510 | Bacteria | 6238 |
| 682 | nmdc:mga06r32_20507_c1 | 3300050510 | Bacteria | 6087 |
| 683 | nmdc:mga06r32_277571_c1 | 3300050510 | Bacteria | 1663 |
| 684 | nmdc:mga08y16_356467_c1 | 3300050511 | Bacteria | 1502 |
| 685 | nmdc:mga0n895_10802_c1 | 3300050512 | Bacteria | 8102 |
| 686 | nmdc:mga0n895_369018_c1 | 3300050512 | Bacteria | 1453 |
| 687 | nmdc:mga0n895_95961_c1 | 3300050512 | Bacteria | 2970 |
| 688 | nmdc:mga08x19_11195_c1 | 3300050514 | Bacteria | 5399 |
| 689 | nmdc:mga08x19_33927_c1 | 3300050514 | Bacteria | 3223 |
| 690 | Ga0495612_0030282 | 3300053078 | Bacteria | 2179 |
| 691 | Ga0495619_0106758 | 3300053085 | Bacteria | 1910 |
| 692 | Ga0500641_0006748 | 3300053096 | Bacteria | 4082 |
| 693 | Ga0501084_0104401 | 3300054114 | Bacteria | 2380 |
| 694 | Ga0501082_0009288 | 3300060353 | Bacteria | 8476 |
| 695 | Ga0501082_0023603 | 3300060353 | Bacteria | 5305 |
| 696 | Ga0501082_0062636 | 3300060353 | Bacteria | 3202 |
| 697 | Ga0501082_0138667 | 3300060353 | Bacteria | 2111 |
| 698 | Ga0501082_0317555 | 3300060353 | Bacteria | 1357 |
| 699 | Ga0501082_0434138 | 3300060353 | Bacteria | 1147 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047317 | Ga0495604_0286786 | Ga0495604_0286786_19_855 | 272 |
| 2 | 3300006028 | Ga0070717_10002009 | Ga0070717_100020098 | 281 |
| 3 | 3300025933 | Ga0207706_10409333 | Ga0207706_104093332 | 281 |
| 4 | 3300006844 | Ga0075428_100405643 | Ga0075428_1004056432 | 282 |
| 5 | 3300009147 | Ga0114129_10580631 | Ga0114129_105806312 | 282 |
| 6 | 3300050508 | nmdc:mga09592_143903_c1 | nmdc:mga09592_143903_c1_876_1814 | 282 |
| 7 | 3300046690 | Ga0495624_0243096 | Ga0495624_0243096_38_904 | 286 |
| 8 | 3300007076 | Ga0075435_100316686 | Ga0075435_1003166861 | 287 |
| 9 | 3300026121 | Ga0207683_10292163 | Ga0207683_102921631 | 287 |
| 10 | 3300031995 | Ga0307409_100295479 | Ga0307409_1002954793 | 289 |
| 11 | 3300032004 | Ga0307414_10004400 | Ga0307414_100044005 | 289 |
| 12 | 3300049578 | Ga0501042_0326152 | Ga0501042_0326152_13_894 | 289 |
| 13 | 3300049568 | Ga0501031_0108905 | Ga0501031_0108905_181_1059 | 290 |
| 14 | 3300049576 | Ga0501040_0141970 | Ga0501040_0141970_406_1284 | 290 |
| 15 | 3300049577 | Ga0501041_0151286 | Ga0501041_0151286_417_1295 | 290 |
| 16 | 3300049588 | Ga0501072_0083846 | Ga0501072_0083846_369_1247 | 290 |
| 17 | 3300049590 | Ga0501074_0035048 | Ga0501074_0035048_2309_3187 | 290 |
| 18 | 3300049592 | Ga0501076_0106700 | Ga0501076_0106700_1034_1912 | 290 |
| 19 | 3300049741 | Ga0501079_0035661 | Ga0501079_0035661_1062_1940 | 290 |
| 20 | 3300049743 | Ga0501081_0052128 | Ga0501081_0052128_1341_2219 | 290 |
| 21 | 3300049743 | Ga0501081_0250693 | Ga0501081_0250693_359_1276 | 290 |
| 22 | 3300060353 | Ga0501082_0062636 | Ga0501082_0062636_965_1843 | 290 |
| 23 | 3300048918 | Ga0496115_0049677 | Ga0496115_0049677_189_1148 | 292 |
| 24 | 3300007265 | Ga0099794_10056931 | Ga0099794_100569312 | 293 |
| 25 | 3300027671 | Ga0209588_1024375 | Ga0209588_10243752 | 293 |
| 26 | 3300005327 | Ga0070658_10076902 | Ga0070658_100769022 | 295 |
| 27 | 3300005339 | Ga0070660_100012266 | Ga0070660_1000122662 | 295 |
| 28 | 3300005458 | Ga0070681_10000441 | Ga0070681_1000044114 | 295 |
| 29 | 3300005530 | Ga0070679_100003023 | Ga0070679_1000030236 | 295 |
| 30 | 3300005563 | Ga0068855_100009276 | Ga0068855_1000092761 | 295 |
| 31 | 3300005614 | Ga0068856_100041063 | Ga0068856_1000410632 | 295 |
| 32 | 3300009093 | Ga0105240_10004420 | Ga0105240_100044206 | 295 |
| 33 | 3300013102 | Ga0157371_10013679 | Ga0157371_100136793 | 295 |
| 34 | 3300013104 | Ga0157370_10021792 | Ga0157370_100217926 | 295 |
| 35 | 3300013105 | Ga0157369_10046615 | Ga0157369_100466152 | 295 |
| 36 | 3300013307 | Ga0157372_10002875 | Ga0157372_1000287513 | 295 |
| 37 | 3300025912 | Ga0207707_10011352 | Ga0207707_100113522 | 295 |
| 38 | 3300025917 | Ga0207660_10010991 | Ga0207660_100109916 | 295 |
| 39 | 3300025919 | Ga0207657_10021277 | Ga0207657_100212775 | 295 |
| 40 | 3300025921 | Ga0207652_10009001 | Ga0207652_100090016 | 295 |
| 41 | 3300025924 | Ga0207694_10006757 | Ga0207694_100067572 | 295 |
| 42 | 3300025949 | Ga0207667_10000332 | Ga0207667_1000033240 | 295 |
| 43 | 3300026078 | Ga0207702_10109507 | Ga0207702_101095071 | 295 |
| 44 | 3300026142 | Ga0207698_10010253 | Ga0207698_100102531 | 295 |
| 45 | 3300006237 | Ga0097621_100117304 | Ga0097621_1001173042 | 297 |
| 46 | 3300007788 | Ga0099795_10002880 | Ga0099795_100028803 | 297 |
| 47 | 3300010159 | Ga0099796_10000303 | Ga0099796_100003036 | 297 |
| 48 | 3300027512 | Ga0209179_1003094 | Ga0209179_10030942 | 297 |
| 49 | 3300036401 | Ga0373937_0076033 | Ga0373937_0076033_424_1335 | 297 |
| 50 | 3300049576 | Ga0501040_0112675 | Ga0501040_0112675_646_1587 | 297 |
| 51 | 3300049591 | Ga0501075_0144331 | Ga0501075_0144331_495_1436 | 297 |
| 52 | 3300049741 | Ga0501079_0059519 | Ga0501079_0059519_1550_2491 | 297 |
| 53 | 3300060353 | Ga0501082_0434138 | Ga0501082_0434138_76_1017 | 297 |
| 54 | 3300009094 | Ga0111539_10185779 | Ga0111539_101857792 | 298 |
| 55 | 3300009094 | Ga0111539_10572655 | Ga0111539_105726552 | 298 |
| 56 | 3300025932 | Ga0207690_10050129 | Ga0207690_100501293 | 298 |
| 57 | 3300027876 | Ga0209974_10015189 | Ga0209974_100151892 | 298 |
| 58 | 3300050511 | nmdc:mga08y16_356467_c1 | nmdc:mga08y16_356467_c1_159_1100 | 298 |
| 59 | 3300006847 | Ga0075431_100039998 | Ga0075431_1000399983 | 299 |
| 60 | 3300006880 | Ga0075429_100026199 | Ga0075429_1000261993 | 299 |
| 61 | 3300050508 | nmdc:mga09592_77562_c1 | nmdc:mga09592_77562_c1_799_1734 | 299 |
| 62 | 3300050510 | nmdc:mga06r32_277571_c1 | nmdc:mga06r32_277571_c1_175_1110 | 299 |
| 63 | 3300005336 | Ga0070680_100115577 | Ga0070680_1001155773 | 300 |
| 64 | 3300039438 | Ga0436360_1020218 | Ga0436360_1020218_1376_2284 | 300 |
| 65 | 3300005618 | Ga0068864_100042025 | Ga0068864_1000420252 | 301 |
| 66 | 3300035115 | Ga0373941_0031698 | Ga0373941_0031698_631_1566 | 301 |
| 67 | 3300035691 | Ga0373931_0044005 | Ga0373931_0044005_394_1329 | 301 |
| 68 | 3300048907 | Ga0496104_0004692 | Ga0496104_0004692_2732_3667 | 301 |
| 69 | 3300048911 | Ga0496108_0185433 | Ga0496108_0185433_202_1137 | 301 |
| 70 | 3300048912 | Ga0496109_0011387 | Ga0496109_0011387_4786_5721 | 301 |
| 71 | 3300048912 | Ga0496109_0416476 | Ga0496109_0416476_41_976 | 301 |
| 72 | 3300048913 | Ga0496110_0033866 | Ga0496110_0033866_193_1128 | 301 |
| 73 | 3300048914 | Ga0496111_0210217 | Ga0496111_0210217_98_1033 | 301 |
| 74 | 3300048915 | Ga0496112_0000744 | Ga0496112_0000744_14738_15673 | 301 |
| 75 | 3300048915 | Ga0496112_0007979 | Ga0496112_0007979_8384_9319 | 301 |
| 76 | 3300048916 | Ga0496113_0000426 | Ga0496113_0000426_15721_16656 | 301 |
| 77 | 3300048916 | Ga0496113_0002320 | Ga0496113_0002320_21_956 | 301 |
| 78 | 3300050512 | nmdc:mga0n895_369018_c1 | nmdc:mga0n895_369018_c1_340_1251 | 301 |
| 79 | 3300050514 | nmdc:mga08x19_33927_c1 | nmdc:mga08x19_33927_c1_1753_2664 | 301 |
| 80 | 3300005439 | Ga0070711_100115374 | Ga0070711_1001153742 | 302 |
| 81 | 3300048904 | Ga0496101_0347576 | Ga0496101_0347576_151_1086 | 302 |
| 82 | 3300048905 | Ga0496102_0088833 | Ga0496102_0088833_796_1731 | 302 |
| 83 | 3300048910 | Ga0496107_0142294 | Ga0496107_0142294_33_968 | 302 |
| 84 | 3300049744 | Ga0501083_0047336 | Ga0501083_0047336_526_1437 | 302 |
| 85 | 3300005435 | Ga0070714_100166348 | Ga0070714_1001663482 | 303 |
| 86 | 3300005458 | Ga0070681_10001537 | Ga0070681_1000153717 | 303 |
| 87 | 3300005458 | Ga0070681_10074738 | Ga0070681_100747382 | 303 |
| 88 | 3300005530 | Ga0070679_100002960 | Ga0070679_10000296011 | 303 |
| 89 | 3300005530 | Ga0070679_100112648 | Ga0070679_1001126482 | 303 |
| 90 | 3300005563 | Ga0068855_100200751 | Ga0068855_1002007512 | 303 |
| 91 | 3300005614 | Ga0068856_100066505 | Ga0068856_1000665053 | 303 |
| 92 | 3300006914 | Ga0075436_100003059 | Ga0075436_1000030598 | 303 |
| 93 | 3300009093 | Ga0105240_10001183 | Ga0105240_1000118331 | 303 |
| 94 | 3300009093 | Ga0105240_10149863 | Ga0105240_101498632 | 303 |
| 95 | 3300009174 | Ga0105241_10298267 | Ga0105241_102982672 | 303 |
| 96 | 3300009551 | Ga0105238_10255264 | Ga0105238_102552642 | 303 |
| 97 | 3300013104 | Ga0157370_10016832 | Ga0157370_100168325 | 303 |
| 98 | 3300013104 | Ga0157370_10137098 | Ga0157370_101370982 | 303 |
| 99 | 3300013105 | Ga0157369_10015840 | Ga0157369_100158402 | 303 |
| 100 | 3300013105 | Ga0157369_10046333 | Ga0157369_100463332 | 303 |
| 101 | 3300013307 | Ga0157372_10005961 | Ga0157372_100059614 | 303 |
| 102 | 3300013307 | Ga0157372_10106849 | Ga0157372_101068493 | 303 |
| 103 | 3300013307 | Ga0157372_10308828 | Ga0157372_103088282 | 303 |
| 104 | 3300025911 | Ga0207654_10161682 | Ga0207654_101616822 | 303 |
| 105 | 3300025912 | Ga0207707_10000987 | Ga0207707_1000098711 | 303 |
| 106 | 3300025912 | Ga0207707_10094990 | Ga0207707_100949902 | 303 |
| 107 | 3300025913 | Ga0207695_10012862 | Ga0207695_100128626 | 303 |
| 108 | 3300025913 | Ga0207695_10038902 | Ga0207695_100389022 | 303 |
| 109 | 3300025917 | Ga0207660_10029149 | Ga0207660_100291492 | 303 |
| 110 | 3300025921 | Ga0207652_10008781 | Ga0207652_100087815 | 303 |
| 111 | 3300025921 | Ga0207652_10065911 | Ga0207652_100659112 | 303 |
| 112 | 3300025921 | Ga0207652_10169534 | Ga0207652_101695342 | 303 |
| 113 | 3300025929 | Ga0207664_10285312 | Ga0207664_102853122 | 303 |
| 114 | 3300025981 | Ga0207640_10232366 | Ga0207640_102323662 | 303 |
| 115 | 3300026041 | Ga0207639_10404686 | Ga0207639_104046862 | 303 |
| 116 | 3300026078 | Ga0207702_10201337 | Ga0207702_102013372 | 303 |
| 117 | 3300050514 | nmdc:mga08x19_11195_c1 | nmdc:mga08x19_11195_c1_3450_4370 | 303 |
| 118 | 3300009545 | Ga0105237_10025780 | Ga0105237_100257801 | 304 |
| 119 | 3300025915 | Ga0207693_10039760 | Ga0207693_100397603 | 304 |
| 120 | 3300031711 | Ga0265314_10001995 | Ga0265314_1000199520 | 304 |
| 121 | 3300042876 | Ga0451577_0000932 | Ga0451577_0000932_3699_4622 | 304 |
| 122 | 3300044712 | Ga0453684_0000577 | Ga0453684_0000577_3628_4551 | 304 |
| 123 | 3300048905 | Ga0496102_0360239 | Ga0496102_0360239_73_1008 | 304 |
| 124 | 3300049581 | Ga0501047_0075517 | Ga0501047_0075517_720_1643 | 304 |
| 125 | 3300049742 | Ga0501080_0189296 | Ga0501080_0189296_643_1566 | 304 |
| 126 | 3300060353 | Ga0501082_0317555 | Ga0501082_0317555_287_1210 | 304 |
| 127 | 3300039093 | Ga0400489_90906 | Ga0400489_90906_175_1191 | 305 |
| 128 | 3300042876 | Ga0451577_0003861 | Ga0451577_0003861_3924_4853 | 305 |
| 129 | 3300049591 | Ga0501075_0048078 | Ga0501075_0048078_1857_2786 | 305 |
| 130 | 3300005436 | Ga0070713_100490536 | Ga0070713_1004905361 | 306 |
| 131 | 3300014326 | Ga0157380_10288372 | Ga0157380_102883721 | 306 |
| 132 | 3300035695 | Ga0373927_0022906 | Ga0373927_0022906_303_1250 | 306 |
| 133 | 3300039437 | Ga0436365_0549141 | Ga0436365_0549141_3159_4094 | 306 |
| 134 | 3300049583 | Ga0501067_0208265 | Ga0501067_0208265_16_942 | 306 |
| 135 | 3300049585 | Ga0501069_0007160 | Ga0501069_0007160_4909_5835 | 306 |
| 136 | 3300053096 | Ga0500641_0006748 | Ga0500641_0006748_319_1251 | 306 |
| 137 | 3300005329 | Ga0070683_100044867 | Ga0070683_1000448673 | 307 |
| 138 | 3300005436 | Ga0070713_100111793 | Ga0070713_1001117932 | 307 |
| 139 | 3300005439 | Ga0070711_100038821 | Ga0070711_1000388214 | 307 |
| 140 | 3300005458 | Ga0070681_10205038 | Ga0070681_102050382 | 307 |
| 141 | 3300005614 | Ga0068856_100506229 | Ga0068856_1005062292 | 307 |
| 142 | 3300005617 | Ga0068859_100298922 | Ga0068859_1002989222 | 307 |
| 143 | 3300005842 | Ga0068858_100076781 | Ga0068858_1000767813 | 307 |
| 144 | 3300006358 | Ga0068871_100098532 | Ga0068871_1000985321 | 307 |
| 145 | 3300006931 | Ga0097620_100298939 | Ga0097620_1002989392 | 307 |
| 146 | 3300009093 | Ga0105240_10218330 | Ga0105240_102183302 | 307 |
| 147 | 3300009177 | Ga0105248_10143817 | Ga0105248_101438173 | 307 |
| 148 | 3300020070 | Ga0206356_11887767 | Ga0206356_118877673 | 307 |
| 149 | 3300025906 | Ga0207699_10056091 | Ga0207699_100560912 | 307 |
| 150 | 3300025913 | Ga0207695_10156207 | Ga0207695_101562072 | 307 |
| 151 | 3300025916 | Ga0207663_10048605 | Ga0207663_100486052 | 307 |
| 152 | 3300025933 | Ga0207706_10435923 | Ga0207706_104359231 | 307 |
| 153 | 3300025941 | Ga0207711_10380149 | Ga0207711_103801492 | 307 |
| 154 | 3300025944 | Ga0207661_10043381 | Ga0207661_100433812 | 307 |
| 155 | 3300026035 | Ga0207703_10212200 | Ga0207703_102122002 | 307 |
| 156 | 3300026078 | Ga0207702_10121746 | Ga0207702_101217462 | 307 |
| 157 | 3300031595 | Ga0265313_10007313 | Ga0265313_100073134 | 307 |
| 158 | 3300035083 | Ga0373926_0013943 | Ga0373926_0013943_413_1363 | 307 |
| 159 | 3300035089 | Ga0373944_0002300 | Ga0373944_0002300_816_1766 | 307 |
| 160 | 3300035113 | Ga0373936_0028798 | Ga0373936_0028798_58_1008 | 307 |
| 161 | 3300035116 | Ga0373945_0010724 | Ga0373945_0010724_992_1942 | 307 |
| 162 | 3300035170 | Ga0373943_0005645 | Ga0373943_0005645_4143_5093 | 307 |
| 163 | 3300035171 | Ga0373946_0005284 | Ga0373946_0005284_3603_4553 | 307 |
| 164 | 3300035172 | Ga0373955_0109328 | Ga0373955_0109328_481_1410 | 307 |
| 165 | 3300035695 | Ga0373927_0002599 | Ga0373927_0002599_9203_10153 | 307 |
| 166 | 3300035725 | Ga0373947_0000975 | Ga0373947_0000975_16146_17096 | 307 |
| 167 | 3300037068 | Ga0373925_0001709 | Ga0373925_0001709_1219_2169 | 307 |
| 168 | 3300046455 | Ga0495603_0002024 | Ga0495603_0002024_5828_6778 | 307 |
| 169 | 3300046459 | Ga0495629_0003783 | Ga0495629_0003783_6703_7653 | 307 |
| 170 | 3300046461 | Ga0495641_0051079 | Ga0495641_0051079_33_983 | 307 |
| 171 | 3300046473 | Ga0495582_0003153 | Ga0495582_0003153_383_1333 | 307 |
| 172 | 3300046475 | Ga0495639_0000175 | Ga0495639_0000175_20619_21569 | 307 |
| 173 | 3300046517 | Ga0495630_0005659 | Ga0495630_0005659_6343_7293 | 307 |
| 174 | 3300046529 | Ga0495652_0024887 | Ga0495652_0024887_3452_4381 | 307 |
| 175 | 3300046531 | Ga0495665_0000126 | Ga0495665_0000126_34648_35598 | 307 |
| 176 | 3300046536 | Ga0495587_0073191 | Ga0495587_0073191_508_1437 | 307 |
| 177 | 3300046674 | Ga0495588_0000742 | Ga0495588_0000742_3129_4079 | 307 |
| 178 | 3300046678 | Ga0495599_0002944 | Ga0495599_0002944_7160_8089 | 307 |
| 179 | 3300046683 | Ga0495658_0000622 | Ga0495658_0000622_16146_17096 | 307 |
| 180 | 3300047315 | Ga0495581_0003733 | Ga0495581_0003733_4950_5900 | 307 |
| 181 | 3300047444 | Ga0495675_0226708 | Ga0495675_0226708_105_1034 | 307 |
| 182 | 3300047471 | Ga0495684_0157293 | Ga0495684_0157293_677_1612 | 307 |
| 183 | 3300047673 | Ga0495593_0000199 | Ga0495593_0000199_28090_29040 | 307 |
| 184 | 3300048089 | Ga0495614_0007404 | Ga0495614_0007404_937_1887 | 307 |
| 185 | 3300005328 | Ga0070676_10009702 | Ga0070676_100097024 | 308 |
| 186 | 3300005334 | Ga0068869_100023516 | Ga0068869_1000235162 | 308 |
| 187 | 3300005339 | Ga0070660_100074586 | Ga0070660_1000745862 | 308 |
| 188 | 3300005341 | Ga0070691_10036564 | Ga0070691_100365642 | 308 |
| 189 | 3300005347 | Ga0070668_100071010 | Ga0070668_1000710102 | 308 |
| 190 | 3300005356 | Ga0070674_100003280 | Ga0070674_1000032803 | 308 |
| 191 | 3300005367 | Ga0070667_100144405 | Ga0070667_1001444051 | 308 |
| 192 | 3300005435 | Ga0070714_100012757 | Ga0070714_1000127575 | 308 |
| 193 | 3300005436 | Ga0070713_100015995 | Ga0070713_1000159953 | 308 |
| 194 | 3300005440 | Ga0070705_100003221 | Ga0070705_1000032216 | 308 |
| 195 | 3300005444 | Ga0070694_100054221 | Ga0070694_1000542211 | 308 |
| 196 | 3300005444 | Ga0070694_100085911 | Ga0070694_1000859112 | 308 |
| 197 | 3300005455 | Ga0070663_100334758 | Ga0070663_1003347582 | 308 |
| 198 | 3300005456 | Ga0070678_100003224 | Ga0070678_1000032242 | 308 |
| 199 | 3300005457 | Ga0070662_100003892 | Ga0070662_10000389210 | 308 |
| 200 | 3300005458 | Ga0070681_10004802 | Ga0070681_100048022 | 308 |
| 201 | 3300005459 | Ga0068867_100000309 | Ga0068867_10000030918 | 308 |
| 202 | 3300005530 | Ga0070679_100049650 | Ga0070679_1000496503 | 308 |
| 203 | 3300005539 | Ga0068853_100262910 | Ga0068853_1002629103 | 308 |
| 204 | 3300005545 | Ga0070695_100003895 | Ga0070695_1000038953 | 308 |
| 205 | 3300005546 | Ga0070696_100010195 | Ga0070696_1000101955 | 308 |
| 206 | 3300005547 | Ga0070693_100001942 | Ga0070693_1000019427 | 308 |
| 207 | 3300005548 | Ga0070665_100133396 | Ga0070665_1001333962 | 308 |
| 208 | 3300005578 | Ga0068854_100000233 | Ga0068854_10000023310 | 308 |
| 209 | 3300005614 | Ga0068856_100372998 | Ga0068856_1003729981 | 308 |
| 210 | 3300005615 | Ga0070702_100005809 | Ga0070702_1000058095 | 308 |
| 211 | 3300005718 | Ga0068866_10007873 | Ga0068866_100078734 | 308 |
| 212 | 3300005719 | Ga0068861_100032981 | Ga0068861_1000329812 | 308 |
| 213 | 3300005843 | Ga0068860_100001540 | Ga0068860_10000154015 | 308 |
| 214 | 3300006358 | Ga0068871_100099279 | Ga0068871_1000992792 | 308 |
| 215 | 3300006881 | Ga0068865_100000964 | Ga0068865_1000009644 | 308 |
| 216 | 3300009147 | Ga0114129_10008737 | Ga0114129_1000873713 | 308 |
| 217 | 3300009148 | Ga0105243_10000865 | Ga0105243_100008652 | 308 |
| 218 | 3300009174 | Ga0105241_10178866 | Ga0105241_101788663 | 308 |
| 219 | 3300009176 | Ga0105242_10002781 | Ga0105242_1000278112 | 308 |
| 220 | 3300009553 | Ga0105249_10028228 | Ga0105249_100282284 | 308 |
| 221 | 3300010375 | Ga0105239_10011224 | Ga0105239_100112247 | 308 |
| 222 | 3300013297 | Ga0157378_10001261 | Ga0157378_1000126121 | 308 |
| 223 | 3300013306 | Ga0163162_10035542 | Ga0163162_100355422 | 308 |
| 224 | 3300013307 | Ga0157372_10412047 | Ga0157372_104120472 | 308 |
| 225 | 3300013308 | Ga0157375_10097572 | Ga0157375_100975724 | 308 |
| 226 | 3300017792 | Ga0163161_10015790 | Ga0163161_100157905 | 308 |
| 227 | 3300025907 | Ga0207645_10005052 | Ga0207645_1000505212 | 308 |
| 228 | 3300025911 | Ga0207654_10172260 | Ga0207654_101722602 | 308 |
| 229 | 3300025912 | Ga0207707_10002760 | Ga0207707_1000276010 | 308 |
| 230 | 3300025921 | Ga0207652_10471015 | Ga0207652_104710152 | 308 |
| 231 | 3300025928 | Ga0207700_10054190 | Ga0207700_100541902 | 308 |
| 232 | 3300025929 | Ga0207664_10062105 | Ga0207664_100621052 | 308 |
| 233 | 3300025933 | Ga0207706_10000005 | Ga0207706_10000005159 | 308 |
| 234 | 3300025934 | Ga0207686_10000123 | Ga0207686_1000012335 | 308 |
| 235 | 3300025935 | Ga0207709_10001959 | Ga0207709_100019597 | 308 |
| 236 | 3300025937 | Ga0207669_10002038 | Ga0207669_100020384 | 308 |
| 237 | 3300025938 | Ga0207704_10001280 | Ga0207704_1000128010 | 308 |
| 238 | 3300025942 | Ga0207689_10005606 | Ga0207689_100056064 | 308 |
| 239 | 3300025972 | Ga0207668_10027060 | Ga0207668_100270603 | 308 |
| 240 | 3300025981 | Ga0207640_10000870 | Ga0207640_100008702 | 308 |
| 241 | 3300025986 | Ga0207658_10054755 | Ga0207658_100547553 | 308 |
| 242 | 3300026035 | Ga0207703_10145025 | Ga0207703_101450252 | 308 |
| 243 | 3300026067 | Ga0207678_10354848 | Ga0207678_103548482 | 308 |
| 244 | 3300026089 | Ga0207648_10000008 | Ga0207648_10000008121 | 308 |
| 245 | 3300026118 | Ga0207675_100049160 | Ga0207675_1000491602 | 308 |
| 246 | 3300026121 | Ga0207683_10009983 | Ga0207683_100099838 | 308 |
| 247 | 3300027671 | Ga0209588_1028027 | Ga0209588_10280272 | 308 |
| 248 | 3300028379 | Ga0268266_10096961 | Ga0268266_100969612 | 308 |
| 249 | 3300031249 | Ga0265339_10000457 | Ga0265339_1000045717 | 308 |
| 250 | 3300031548 | Ga0307408_100359729 | Ga0307408_1003597292 | 308 |
| 251 | 3300031712 | Ga0265342_10006082 | Ga0265342_100060824 | 308 |
| 252 | 3300031852 | Ga0307410_10276514 | Ga0307410_102765141 | 308 |
| 253 | 3300031911 | Ga0307412_10237809 | Ga0307412_102378091 | 308 |
| 254 | 3300032002 | Ga0307416_100089039 | Ga0307416_1000890393 | 308 |
| 255 | 3300032126 | Ga0307415_100204440 | Ga0307415_1002044402 | 308 |
| 256 | 3300039447 | Ga0436361_0745744 | Ga0436361_0745744_200_1150 | 308 |
| 257 | 3300048903 | Ga0496100_0071551 | Ga0496100_0071551_927_1859 | 308 |
| 258 | 3300048904 | Ga0496101_0311079 | Ga0496101_0311079_274_1206 | 308 |
| 259 | 3300048909 | Ga0496106_0042683 | Ga0496106_0042683_1182_2114 | 308 |
| 260 | 3300048917 | Ga0496114_0249901 | Ga0496114_0249901_98_1030 | 308 |
| 261 | 3300048918 | Ga0496115_0081763 | Ga0496115_0081763_531_1481 | 308 |
| 262 | 3300049570 | Ga0501033_0250363 | Ga0501033_0250363_126_1061 | 308 |
| 263 | 3300049572 | Ga0501036_0020992 | Ga0501036_0020992_1479_2420 | 308 |
| 264 | 3300049577 | Ga0501041_0023604 | Ga0501041_0023604_1481_2422 | 308 |
| 265 | 3300049588 | Ga0501072_0146731 | Ga0501072_0146731_375_1316 | 308 |
| 266 | 3300049592 | Ga0501076_0019020 | Ga0501076_0019020_4095_5036 | 308 |
| 267 | 3300049592 | Ga0501076_0202838 | Ga0501076_0202838_32_967 | 308 |
| 268 | 3300049742 | Ga0501080_0246801 | Ga0501080_0246801_540_1481 | 308 |
| 269 | 3300049822 | Ga0501035_0207918 | Ga0501035_0207918_167_1102 | 308 |
| 270 | 3300050507 | nmdc:mga05p37_580_c1 | nmdc:mga05p37_580_c1_36727_37677 | 308 |
| 271 | 3300050512 | nmdc:mga0n895_95961_c1 | nmdc:mga0n895_95961_c1_173_1111 | 308 |
| 272 | 3300005334 | Ga0068869_100214756 | Ga0068869_1002147562 | 309 |
| 273 | 3300005355 | Ga0070671_100001564 | Ga0070671_1000015642 | 309 |
| 274 | 3300005459 | Ga0068867_100103844 | Ga0068867_1001038442 | 309 |
| 275 | 3300005518 | Ga0070699_100009238 | Ga0070699_1000092386 | 309 |
| 276 | 3300005536 | Ga0070697_100012402 | Ga0070697_1000124023 | 309 |
| 277 | 3300005546 | Ga0070696_100012252 | Ga0070696_1000122526 | 309 |
| 278 | 3300005549 | Ga0070704_100031426 | Ga0070704_1000314263 | 309 |
| 279 | 3300005549 | Ga0070704_100204006 | Ga0070704_1002040062 | 309 |
| 280 | 3300005719 | Ga0068861_100232516 | Ga0068861_1002325162 | 309 |
| 281 | 3300006852 | Ga0075433_10070382 | Ga0075433_100703822 | 309 |
| 282 | 3300006871 | Ga0075434_100023568 | Ga0075434_1000235685 | 309 |
| 283 | 3300006881 | Ga0068865_100071845 | Ga0068865_1000718452 | 309 |
| 284 | 3300006914 | Ga0075436_100017485 | Ga0075436_1000174852 | 309 |
| 285 | 3300009093 | Ga0105240_10358815 | Ga0105240_103588151 | 309 |
| 286 | 3300009148 | Ga0105243_10013671 | Ga0105243_100136714 | 309 |
| 287 | 3300025935 | Ga0207709_10101568 | Ga0207709_101015682 | 309 |
| 288 | 3300025938 | Ga0207704_10214283 | Ga0207704_102142832 | 309 |
| 289 | 3300026023 | Ga0207677_10131340 | Ga0207677_101313402 | 309 |
| 290 | 3300026118 | Ga0207675_100278659 | Ga0207675_1002786592 | 309 |
| 291 | 3300028653 | Ga0265323_10000932 | Ga0265323_1000093212 | 309 |
| 292 | 3300031852 | Ga0307410_10040015 | Ga0307410_100400153 | 309 |
| 293 | 3300031903 | Ga0307407_10142808 | Ga0307407_101428082 | 309 |
| 294 | 3300031995 | Ga0307409_100053537 | Ga0307409_1000535373 | 309 |
| 295 | 3300035170 | Ga0373943_0044694 | Ga0373943_0044694_1091_2032 | 309 |
| 296 | 3300035725 | Ga0373947_0086905 | Ga0373947_0086905_65_1006 | 309 |
| 297 | 3300042012 | Ga0439455_0004315 | Ga0439455_0004315_1802_2737 | 309 |
| 298 | 3300042147 | Ga0450910_011487 | Ga0450910_011487_102_1061 | 309 |
| 299 | 3300046473 | Ga0495582_0059121 | Ga0495582_0059121_640_1581 | 309 |
| 300 | 3300047315 | Ga0495581_0117810 | Ga0495581_0117810_581_1522 | 309 |
| 301 | 3300048905 | Ga0496102_0198903 | Ga0496102_0198903_650_1585 | 309 |
| 302 | 3300048906 | Ga0496103_0270881 | Ga0496103_0270881_47_982 | 309 |
| 303 | 3300005329 | Ga0070683_100000497 | Ga0070683_10000049715 | 310 |
| 304 | 3300005336 | Ga0070680_100064868 | Ga0070680_1000648682 | 310 |
| 305 | 3300005336 | Ga0070680_100458440 | Ga0070680_1004584401 | 310 |
| 306 | 3300005339 | Ga0070660_100034793 | Ga0070660_1000347932 | 310 |
| 307 | 3300005341 | Ga0070691_10004603 | Ga0070691_100046033 | 310 |
| 308 | 3300005436 | Ga0070713_100069771 | Ga0070713_1000697711 | 310 |
| 309 | 3300005440 | Ga0070705_100036336 | Ga0070705_1000363362 | 310 |
| 310 | 3300005457 | Ga0070662_100254748 | Ga0070662_1002547482 | 310 |
| 311 | 3300005530 | Ga0070679_100001789 | Ga0070679_1000017894 | 310 |
| 312 | 3300005535 | Ga0070684_100002594 | Ga0070684_1000025942 | 310 |
| 313 | 3300005535 | Ga0070684_100093560 | Ga0070684_1000935602 | 310 |
| 314 | 3300005535 | Ga0070684_100340789 | Ga0070684_1003407891 | 310 |
| 315 | 3300005539 | Ga0068853_100043338 | Ga0068853_1000433384 | 310 |
| 316 | 3300005539 | Ga0068853_100370414 | Ga0068853_1003704141 | 310 |
| 317 | 3300005545 | Ga0070695_100064259 | Ga0070695_1000642592 | 310 |
| 318 | 3300005546 | Ga0070696_100064549 | Ga0070696_1000645492 | 310 |
| 319 | 3300005547 | Ga0070693_100096630 | Ga0070693_1000966302 | 310 |
| 320 | 3300005549 | Ga0070704_100016010 | Ga0070704_1000160106 | 310 |
| 321 | 3300005563 | Ga0068855_100040881 | Ga0068855_1000408815 | 310 |
| 322 | 3300005564 | Ga0070664_100272772 | Ga0070664_1002727722 | 310 |
| 323 | 3300005577 | Ga0068857_100001612 | Ga0068857_10000161211 | 310 |
| 324 | 3300005577 | Ga0068857_100049444 | Ga0068857_1000494444 | 310 |
| 325 | 3300005614 | Ga0068856_100004846 | Ga0068856_10000484614 | 310 |
| 326 | 3300005842 | Ga0068858_100005708 | Ga0068858_1000057089 | 310 |
| 327 | 3300006844 | Ga0075428_100060430 | Ga0075428_1000604302 | 310 |
| 328 | 3300006847 | Ga0075431_100017316 | Ga0075431_1000173166 | 310 |
| 329 | 3300006871 | Ga0075434_100015810 | Ga0075434_1000158106 | 310 |
| 330 | 3300006880 | Ga0075429_100033910 | Ga0075429_1000339104 | 310 |
| 331 | 3300009093 | Ga0105240_10001383 | Ga0105240_1000138326 | 310 |
| 332 | 3300009093 | Ga0105240_10010543 | Ga0105240_1001054312 | 310 |
| 333 | 3300009098 | Ga0105245_10064625 | Ga0105245_100646253 | 310 |
| 334 | 3300009098 | Ga0105245_10237463 | Ga0105245_102374631 | 310 |
| 335 | 3300009101 | Ga0105247_10173112 | Ga0105247_101731122 | 310 |
| 336 | 3300009147 | Ga0114129_10008584 | Ga0114129_100085847 | 310 |
| 337 | 3300009147 | Ga0114129_10439525 | Ga0114129_104395252 | 310 |
| 338 | 3300009148 | Ga0105243_10370596 | Ga0105243_103705962 | 310 |
| 339 | 3300009174 | Ga0105241_10007408 | Ga0105241_100074088 | 310 |
| 340 | 3300009177 | Ga0105248_10020812 | Ga0105248_100208124 | 310 |
| 341 | 3300009545 | Ga0105237_10004190 | Ga0105237_100041905 | 310 |
| 342 | 3300009551 | Ga0105238_10002578 | Ga0105238_1000257814 | 310 |
| 343 | 3300009551 | Ga0105238_10005105 | Ga0105238_1000510512 | 310 |
| 344 | 3300009551 | Ga0105238_10024186 | Ga0105238_100241864 | 310 |
| 345 | 3300009553 | Ga0105249_10007387 | Ga0105249_100073879 | 310 |
| 346 | 3300010375 | Ga0105239_10006055 | Ga0105239_1000605511 | 310 |
| 347 | 3300010375 | Ga0105239_10048978 | Ga0105239_100489782 | 310 |
| 348 | 3300011119 | Ga0105246_10013968 | Ga0105246_100139684 | 310 |
| 349 | 3300011119 | Ga0105246_10062783 | Ga0105246_100627832 | 310 |
| 350 | 3300013104 | Ga0157370_10034818 | Ga0157370_100348182 | 310 |
| 351 | 3300013104 | Ga0157370_10252085 | Ga0157370_102520852 | 310 |
| 352 | 3300013105 | Ga0157369_10004665 | Ga0157369_100046654 | 310 |
| 353 | 3300013297 | Ga0157378_10324634 | Ga0157378_103246342 | 310 |
| 354 | 3300013307 | Ga0157372_10008909 | Ga0157372_100089098 | 310 |
| 355 | 3300013307 | Ga0157372_10011183 | Ga0157372_100111839 | 310 |
| 356 | 3300013308 | Ga0157375_10016710 | Ga0157375_100167102 | 310 |
| 357 | 3300014969 | Ga0157376_10252739 | Ga0157376_102527392 | 310 |
| 358 | 3300025910 | Ga0207684_10251547 | Ga0207684_102515472 | 310 |
| 359 | 3300025911 | Ga0207654_10015545 | Ga0207654_100155452 | 310 |
| 360 | 3300025912 | Ga0207707_10002717 | Ga0207707_100027172 | 310 |
| 361 | 3300025913 | Ga0207695_10003003 | Ga0207695_1000300313 | 310 |
| 362 | 3300025913 | Ga0207695_10015372 | Ga0207695_100153728 | 310 |
| 363 | 3300025914 | Ga0207671_10265384 | Ga0207671_102653842 | 310 |
| 364 | 3300025916 | Ga0207663_10024305 | Ga0207663_100243052 | 310 |
| 365 | 3300025917 | Ga0207660_10006741 | Ga0207660_100067412 | 310 |
| 366 | 3300025919 | Ga0207657_10057745 | Ga0207657_100577454 | 310 |
| 367 | 3300025921 | Ga0207652_10001801 | Ga0207652_100018015 | 310 |
| 368 | 3300025922 | Ga0207646_10123495 | Ga0207646_101234952 | 310 |
| 369 | 3300025924 | Ga0207694_10003089 | Ga0207694_100030892 | 310 |
| 370 | 3300025924 | Ga0207694_10005174 | Ga0207694_100051746 | 310 |
| 371 | 3300025924 | Ga0207694_10007780 | Ga0207694_100077805 | 310 |
| 372 | 3300025927 | Ga0207687_10032394 | Ga0207687_100323942 | 310 |
| 373 | 3300025927 | Ga0207687_10213504 | Ga0207687_102135041 | 310 |
| 374 | 3300025928 | Ga0207700_10041874 | Ga0207700_100418742 | 310 |
| 375 | 3300025933 | Ga0207706_10266169 | Ga0207706_102661692 | 310 |
| 376 | 3300025941 | Ga0207711_10001497 | Ga0207711_1000149710 | 310 |
| 377 | 3300025942 | Ga0207689_10065388 | Ga0207689_100653882 | 310 |
| 378 | 3300025944 | Ga0207661_10032308 | Ga0207661_100323082 | 310 |
| 379 | 3300025944 | Ga0207661_10069894 | Ga0207661_100698942 | 310 |
| 380 | 3300025944 | Ga0207661_10198862 | Ga0207661_101988622 | 310 |
| 381 | 3300025949 | Ga0207667_10005708 | Ga0207667_1000570814 | 310 |
| 382 | 3300025961 | Ga0207712_10005953 | Ga0207712_100059532 | 310 |
| 383 | 3300026035 | Ga0207703_10002747 | Ga0207703_100027476 | 310 |
| 384 | 3300026041 | Ga0207639_10074665 | Ga0207639_100746651 | 310 |
| 385 | 3300026078 | Ga0207702_10004800 | Ga0207702_100048004 | 310 |
| 386 | 3300026116 | Ga0207674_10000300 | Ga0207674_1000030034 | 310 |
| 387 | 3300026116 | Ga0207674_10002379 | Ga0207674_100023799 | 310 |
| 388 | 3300027682 | Ga0209971_1019249 | Ga0209971_10192492 | 310 |
| 389 | 3300028016 | Ga0265354_1000189 | Ga0265354_10001893 | 310 |
| 390 | 3300028666 | Ga0265336_10001161 | Ga0265336_100011618 | 310 |
| 391 | 3300030878 | Ga0265770_1003323 | Ga0265770_10033231 | 310 |
| 392 | 3300031090 | Ga0265760_10002519 | Ga0265760_100025192 | 310 |
| 393 | 3300031250 | Ga0265331_10015412 | Ga0265331_100154122 | 310 |
| 394 | 3300031344 | Ga0265316_10033866 | Ga0265316_100338662 | 310 |
| 395 | 3300031711 | Ga0265314_10007657 | Ga0265314_100076574 | 310 |
| 396 | 3300031711 | Ga0265314_10013305 | Ga0265314_100133052 | 310 |
| 397 | 3300035111 | Ga0373923_0012458 | Ga0373923_0012458_261_1199 | 310 |
| 398 | 3300035117 | Ga0373953_0015245 | Ga0373953_0015245_852_1790 | 310 |
| 399 | 3300035118 | Ga0373954_0022191 | Ga0373954_0022191_567_1505 | 310 |
| 400 | 3300035118 | Ga0373954_0044644 | Ga0373954_0044644_324_1262 | 310 |
| 401 | 3300035118 | Ga0373954_0092125 | Ga0373954_0092125_239_1183 | 310 |
| 402 | 3300035120 | Ga0373957_0039068 | Ga0373957_0039068_143_1081 | 310 |
| 403 | 3300035172 | Ga0373955_0037364 | Ga0373955_0037364_1470_2408 | 310 |
| 404 | 3300035695 | Ga0373927_0003663 | Ga0373927_0003663_8169_9110 | 310 |
| 405 | 3300035695 | Ga0373927_0017817 | Ga0373927_0017817_3550_4494 | 310 |
| 406 | 3300035724 | Ga0373933_0013032 | Ga0373933_0013032_855_1793 | 310 |
| 407 | 3300035724 | Ga0373933_0031506 | Ga0373933_0031506_580_1518 | 310 |
| 408 | 3300035725 | Ga0373947_0103620 | Ga0373947_0103620_761_1699 | 310 |
| 409 | 3300035725 | Ga0373947_0195993 | Ga0373947_0195993_293_1231 | 310 |
| 410 | 3300036401 | Ga0373937_0009964 | Ga0373937_0009964_683_1621 | 310 |
| 411 | 3300036401 | Ga0373937_0036661 | Ga0373937_0036661_2767_3705 | 310 |
| 412 | 3300036401 | Ga0373937_0108009 | Ga0373937_0108009_1102_2040 | 310 |
| 413 | 3300037068 | Ga0373925_0017306 | Ga0373925_0017306_1625_2563 | 310 |
| 414 | 3300037853 | Ga0436364_1031302 | Ga0436364_1031302_781_1725 | 310 |
| 415 | 3300039437 | Ga0436365_1319592 | Ga0436365_1319592_1360_2304 | 310 |
| 416 | 3300046459 | Ga0495629_0265239 | Ga0495629_0265239_209_1147 | 310 |
| 417 | 3300046462 | Ga0495651_0000096 | Ga0495651_0000096_50276_51220 | 310 |
| 418 | 3300046462 | Ga0495651_0000672 | Ga0495651_0000672_14590_15534 | 310 |
| 419 | 3300046463 | Ga0495653_0046413 | Ga0495653_0046413_1594_2538 | 310 |
| 420 | 3300046463 | Ga0495653_0084832 | Ga0495653_0084832_74_1018 | 310 |
| 421 | 3300046472 | Ga0495580_0115609 | Ga0495580_0115609_650_1588 | 310 |
| 422 | 3300046473 | Ga0495582_0003312 | Ga0495582_0003312_1131_2069 | 310 |
| 423 | 3300046475 | Ga0495639_0073206 | Ga0495639_0073206_229_1167 | 310 |
| 424 | 3300046511 | Ga0495608_0006128 | Ga0495608_0006128_5116_6060 | 310 |
| 425 | 3300046511 | Ga0495608_0034153 | Ga0495608_0034153_823_1767 | 310 |
| 426 | 3300046511 | Ga0495608_0081488 | Ga0495608_0081488_995_1939 | 310 |
| 427 | 3300046514 | Ga0495618_0087101 | Ga0495618_0087101_320_1264 | 310 |
| 428 | 3300046516 | Ga0495628_0002142 | Ga0495628_0002142_9034_9978 | 310 |
| 429 | 3300046516 | Ga0495628_0021894 | Ga0495628_0021894_266_1210 | 310 |
| 430 | 3300046516 | Ga0495628_0090695 | Ga0495628_0090695_1314_2258 | 310 |
| 431 | 3300046516 | Ga0495628_0115180 | Ga0495628_0115180_934_1872 | 310 |
| 432 | 3300046517 | Ga0495630_0039106 | Ga0495630_0039106_880_1824 | 310 |
| 433 | 3300046517 | Ga0495630_0046284 | Ga0495630_0046284_1186_2130 | 310 |
| 434 | 3300046517 | Ga0495630_0190852 | Ga0495630_0190852_142_1086 | 310 |
| 435 | 3300046529 | Ga0495652_0008631 | Ga0495652_0008631_1127_2071 | 310 |
| 436 | 3300046529 | Ga0495652_0138416 | Ga0495652_0138416_886_1830 | 310 |
| 437 | 3300046531 | Ga0495665_0045001 | Ga0495665_0045001_1314_2258 | 310 |
| 438 | 3300046535 | Ga0495586_0030050 | Ga0495586_0030050_65_1003 | 310 |
| 439 | 3300046535 | Ga0495586_0196439 | Ga0495586_0196439_20_964 | 310 |
| 440 | 3300046536 | Ga0495587_0023206 | Ga0495587_0023206_1778_2722 | 310 |
| 441 | 3300046536 | Ga0495587_0148852 | Ga0495587_0148852_134_1078 | 310 |
| 442 | 3300046543 | Ga0495645_0079964 | Ga0495645_0079964_1368_2312 | 310 |
| 443 | 3300046543 | Ga0495645_0088352 | Ga0495645_0088352_41_985 | 310 |
| 444 | 3300046559 | Ga0495667_0001699 | Ga0495667_0001699_12398_13342 | 310 |
| 445 | 3300046559 | Ga0495667_0049766 | Ga0495667_0049766_1674_2618 | 310 |
| 446 | 3300046642 | Ga0495634_0025120 | Ga0495634_0025120_2176_3114 | 310 |
| 447 | 3300046663 | Ga0495635_0016425 | Ga0495635_0016425_104_1048 | 310 |
| 448 | 3300046675 | Ga0495657_0005455 | Ga0495657_0005455_9046_9990 | 310 |
| 449 | 3300046675 | Ga0495657_0041352 | Ga0495657_0041352_509_1453 | 310 |
| 450 | 3300046675 | Ga0495657_0191163 | Ga0495657_0191163_273_1211 | 310 |
| 451 | 3300046678 | Ga0495599_0003824 | Ga0495599_0003824_4639_5583 | 310 |
| 452 | 3300046679 | Ga0495623_0018113 | Ga0495623_0018113_2335_3279 | 310 |
| 453 | 3300046679 | Ga0495623_0156108 | Ga0495623_0156108_318_1256 | 310 |
| 454 | 3300046680 | Ga0495646_0004263 | Ga0495646_0004263_7943_8887 | 310 |
| 455 | 3300046689 | Ga0495613_0120053 | Ga0495613_0120053_357_1295 | 310 |
| 456 | 3300046689 | Ga0495613_0185380 | Ga0495613_0185380_46_984 | 310 |
| 457 | 3300046690 | Ga0495624_0209542 | Ga0495624_0209542_165_1109 | 310 |
| 458 | 3300046809 | Ga0495600_0043815 | Ga0495600_0043815_1195_2139 | 310 |
| 459 | 3300047317 | Ga0495604_0002583 | Ga0495604_0002583_6049_6993 | 310 |
| 460 | 3300047317 | Ga0495604_0005994 | Ga0495604_0005994_8329_9273 | 310 |
| 461 | 3300047317 | Ga0495604_0172479 | Ga0495604_0172479_464_1402 | 310 |
| 462 | 3300047319 | Ga0495674_0009734 | Ga0495674_0009734_7627_8571 | 310 |
| 463 | 3300047319 | Ga0495674_0049256 | Ga0495674_0049256_2730_3674 | 310 |
| 464 | 3300047319 | Ga0495674_0087608 | Ga0495674_0087608_1079_2023 | 310 |
| 465 | 3300047319 | Ga0495674_0316798 | Ga0495674_0316798_196_1140 | 310 |
| 466 | 3300047319 | Ga0495674_0355722 | Ga0495674_0355722_127_1065 | 310 |
| 467 | 3300047322 | Ga0495680_0000034 | Ga0495680_0000034_80494_81438 | 310 |
| 468 | 3300047322 | Ga0495680_0039538 | Ga0495680_0039538_1080_2024 | 310 |
| 469 | 3300047444 | Ga0495675_0001342 | Ga0495675_0001342_5344_6288 | 310 |
| 470 | 3300047444 | Ga0495675_0045131 | Ga0495675_0045131_1247_2191 | 310 |
| 471 | 3300047444 | Ga0495675_0109537 | Ga0495675_0109537_740_1684 | 310 |
| 472 | 3300047444 | Ga0495675_0115711 | Ga0495675_0115711_235_1179 | 310 |
| 473 | 3300047444 | Ga0495675_0187021 | Ga0495675_0187021_235_1179 | 310 |
| 474 | 3300047471 | Ga0495684_0000646 | Ga0495684_0000646_15596_16540 | 310 |
| 475 | 3300047471 | Ga0495684_0004482 | Ga0495684_0004482_8279_9217 | 310 |
| 476 | 3300047471 | Ga0495684_0032650 | Ga0495684_0032650_973_1917 | 310 |
| 477 | 3300047471 | Ga0495684_0201423 | Ga0495684_0201423_408_1352 | 310 |
| 478 | 3300047673 | Ga0495593_0068308 | Ga0495593_0068308_105_1049 | 310 |
| 479 | 3300048088 | Ga0495602_0124710 | Ga0495602_0124710_713_1657 | 310 |
| 480 | 3300048905 | Ga0496102_0062017 | Ga0496102_0062017_295_1233 | 310 |
| 481 | 3300048907 | Ga0496104_0018077 | Ga0496104_0018077_5392_6330 | 310 |
| 482 | 3300048907 | Ga0496104_0041304 | Ga0496104_0041304_2418_3356 | 310 |
| 483 | 3300048908 | Ga0496105_0044598 | Ga0496105_0044598_2662_3600 | 310 |
| 484 | 3300048909 | Ga0496106_0083072 | Ga0496106_0083072_1028_1966 | 310 |
| 485 | 3300048911 | Ga0496108_0010855 | Ga0496108_0010855_4843_5781 | 310 |
| 486 | 3300048911 | Ga0496108_0154035 | Ga0496108_0154035_455_1393 | 310 |
| 487 | 3300048915 | Ga0496112_0009902 | Ga0496112_0009902_615_1553 | 310 |
| 488 | 3300048915 | Ga0496112_0047615 | Ga0496112_0047615_347_1285 | 310 |
| 489 | 3300048915 | Ga0496112_0144641 | Ga0496112_0144641_153_1097 | 310 |
| 490 | 3300048916 | Ga0496113_0233477 | Ga0496113_0233477_425_1363 | 310 |
| 491 | 3300050508 | nmdc:mga09592_35717_c1 | nmdc:mga09592_35717_c1_3113_4051 | 310 |
| 492 | 3300050509 | nmdc:mga0qj67_297747_c1 | nmdc:mga0qj67_297747_c1_350_1294 | 310 |
| 493 | 3300050510 | nmdc:mga06r32_20507_c1 | nmdc:mga06r32_20507_c1_3908_4846 | 310 |
| 494 | 3300050512 | nmdc:mga0n895_10802_c1 | nmdc:mga0n895_10802_c1_1725_2663 | 310 |
| 495 | 3300053078 | Ga0495612_0030282 | Ga0495612_0030282_118_1062 | 310 |
| 496 | 3300053085 | Ga0495619_0106758 | Ga0495619_0106758_754_1692 | 310 |
| 497 | 3300005329 | Ga0070683_100097786 | Ga0070683_1000977862 | 311 |
| 498 | 3300005340 | Ga0070689_100068427 | Ga0070689_1000684272 | 311 |
| 499 | 3300005343 | Ga0070687_100023150 | Ga0070687_1000231502 | 311 |
| 500 | 3300005353 | Ga0070669_100001748 | Ga0070669_1000017487 | 311 |
| 501 | 3300005354 | Ga0070675_100005979 | Ga0070675_1000059796 | 311 |
| 502 | 3300005354 | Ga0070675_100132673 | Ga0070675_1001326732 | 311 |
| 503 | 3300005355 | Ga0070671_100072473 | Ga0070671_1000724732 | 311 |
| 504 | 3300005364 | Ga0070673_100059007 | Ga0070673_1000590074 | 311 |
| 505 | 3300005364 | Ga0070673_100189298 | Ga0070673_1001892982 | 311 |
| 506 | 3300005366 | Ga0070659_100025518 | Ga0070659_1000255184 | 311 |
| 507 | 3300005457 | Ga0070662_100147286 | Ga0070662_1001472862 | 311 |
| 508 | 3300005466 | Ga0070685_10009147 | Ga0070685_100091474 | 311 |
| 509 | 3300005535 | Ga0070684_100016923 | Ga0070684_1000169236 | 311 |
| 510 | 3300005543 | Ga0070672_100073195 | Ga0070672_1000731952 | 311 |
| 511 | 3300005564 | Ga0070664_100376321 | Ga0070664_1003763212 | 311 |
| 512 | 3300005617 | Ga0068859_100077697 | Ga0068859_1000776972 | 311 |
| 513 | 3300005618 | Ga0068864_100431062 | Ga0068864_1004310622 | 311 |
| 514 | 3300005937 | Ga0081455_10030790 | Ga0081455_100307902 | 311 |
| 515 | 3300006847 | Ga0075431_100013860 | Ga0075431_1000138606 | 311 |
| 516 | 3300006931 | Ga0097620_100077697 | Ga0097620_1000776972 | 311 |
| 517 | 3300009147 | Ga0114129_10401377 | Ga0114129_104013771 | 311 |
| 518 | 3300009147 | Ga0114129_10647649 | Ga0114129_106476491 | 311 |
| 519 | 3300009177 | Ga0105248_10000002 | Ga0105248_10000002856 | 311 |
| 520 | 3300009177 | Ga0105248_10089389 | Ga0105248_100893893 | 311 |
| 521 | 3300010375 | Ga0105239_10383989 | Ga0105239_103839892 | 311 |
| 522 | 3300013296 | Ga0157374_10032820 | Ga0157374_100328202 | 311 |
| 523 | 3300013308 | Ga0157375_10012857 | Ga0157375_100128576 | 311 |
| 524 | 3300014326 | Ga0157380_10251812 | Ga0157380_102518122 | 311 |
| 525 | 3300025908 | Ga0207643_10001129 | Ga0207643_100011292 | 311 |
| 526 | 3300025912 | Ga0207707_10031722 | Ga0207707_100317223 | 311 |
| 527 | 3300025918 | Ga0207662_10013560 | Ga0207662_100135602 | 311 |
| 528 | 3300025920 | Ga0207649_10031377 | Ga0207649_100313773 | 311 |
| 529 | 3300025920 | Ga0207649_10163862 | Ga0207649_101638622 | 311 |
| 530 | 3300025923 | Ga0207681_10013396 | Ga0207681_100133964 | 311 |
| 531 | 3300025926 | Ga0207659_10011148 | Ga0207659_100111486 | 311 |
| 532 | 3300025932 | Ga0207690_10038767 | Ga0207690_100387672 | 311 |
| 533 | 3300025933 | Ga0207706_10016085 | Ga0207706_100160852 | 311 |
| 534 | 3300025940 | Ga0207691_10113308 | Ga0207691_101133083 | 311 |
| 535 | 3300025941 | Ga0207711_10000842 | Ga0207711_100008426 | 311 |
| 536 | 3300025944 | Ga0207661_10150472 | Ga0207661_101504722 | 311 |
| 537 | 3300025945 | Ga0207679_10013030 | Ga0207679_100130302 | 311 |
| 538 | 3300026067 | Ga0207678_10072069 | Ga0207678_100720692 | 311 |
| 539 | 3300026078 | Ga0207702_10028305 | Ga0207702_100283056 | 311 |
| 540 | 3300026116 | Ga0207674_10007051 | Ga0207674_100070517 | 311 |
| 541 | 3300028577 | Ga0265318_10011338 | Ga0265318_100113382 | 311 |
| 542 | 3300028800 | Ga0265338_10024486 | Ga0265338_100244866 | 311 |
| 543 | 3300028800 | Ga0265338_10039023 | Ga0265338_100390231 | 311 |
| 544 | 3300028800 | Ga0265338_10039150 | Ga0265338_100391504 | 311 |
| 545 | 3300028800 | Ga0265338_10056370 | Ga0265338_100563703 | 311 |
| 546 | 3300031235 | Ga0265330_10004148 | Ga0265330_100041488 | 311 |
| 547 | 3300031235 | Ga0265330_10009553 | Ga0265330_100095533 | 311 |
| 548 | 3300031235 | Ga0265330_10026239 | Ga0265330_100262392 | 311 |
| 549 | 3300031240 | Ga0265320_10022135 | Ga0265320_100221352 | 311 |
| 550 | 3300031241 | Ga0265325_10013390 | Ga0265325_100133903 | 311 |
| 551 | 3300031247 | Ga0265340_10026021 | Ga0265340_100260212 | 311 |
| 552 | 3300031249 | Ga0265339_10000474 | Ga0265339_1000047415 | 311 |
| 553 | 3300031249 | Ga0265339_10069814 | Ga0265339_100698142 | 311 |
| 554 | 3300031344 | Ga0265316_10001044 | Ga0265316_100010442 | 311 |
| 555 | 3300031344 | Ga0265316_10012825 | Ga0265316_100128256 | 311 |
| 556 | 3300031344 | Ga0265316_10017055 | Ga0265316_100170553 | 311 |
| 557 | 3300031344 | Ga0265316_10084425 | Ga0265316_100844252 | 311 |
| 558 | 3300031548 | Ga0307408_100028718 | Ga0307408_1000287183 | 311 |
| 559 | 3300031548 | Ga0307408_100514742 | Ga0307408_1005147422 | 311 |
| 560 | 3300031595 | Ga0265313_10009170 | Ga0265313_100091702 | 311 |
| 561 | 3300031595 | Ga0265313_10046341 | Ga0265313_100463412 | 311 |
| 562 | 3300031711 | Ga0265314_10000261 | Ga0265314_1000026134 | 311 |
| 563 | 3300031711 | Ga0265314_10016081 | Ga0265314_100160813 | 311 |
| 564 | 3300031711 | Ga0265314_10148423 | Ga0265314_101484232 | 311 |
| 565 | 3300031712 | Ga0265342_10001022 | Ga0265342_1000102213 | 311 |
| 566 | 3300031712 | Ga0265342_10051431 | Ga0265342_100514313 | 311 |
| 567 | 3300031731 | Ga0307405_10012382 | Ga0307405_100123823 | 311 |
| 568 | 3300031731 | Ga0307405_10028517 | Ga0307405_100285173 | 311 |
| 569 | 3300031852 | Ga0307410_10000285 | Ga0307410_1000028528 | 311 |
| 570 | 3300031901 | Ga0307406_10070480 | Ga0307406_100704802 | 311 |
| 571 | 3300031903 | Ga0307407_10006354 | Ga0307407_100063543 | 311 |
| 572 | 3300031911 | Ga0307412_10075856 | Ga0307412_100758563 | 311 |
| 573 | 3300031995 | Ga0307409_100026816 | Ga0307409_1000268163 | 311 |
| 574 | 3300031995 | Ga0307409_100040386 | Ga0307409_1000403862 | 311 |
| 575 | 3300032002 | Ga0307416_100005552 | Ga0307416_1000055524 | 311 |
| 576 | 3300032002 | Ga0307416_100035999 | Ga0307416_1000359993 | 311 |
| 577 | 3300032004 | Ga0307414_10117335 | Ga0307414_101173353 | 311 |
| 578 | 3300032005 | Ga0307411_10107604 | Ga0307411_101076043 | 311 |
| 579 | 3300032005 | Ga0307411_10189400 | Ga0307411_101894002 | 311 |
| 580 | 3300032126 | Ga0307415_100039686 | Ga0307415_1000396863 | 311 |
| 581 | 3300047319 | Ga0495674_0256193 | Ga0495674_0256193_128_1117 | 311 |
| 582 | 3300048905 | Ga0496102_0216865 | Ga0496102_0216865_740_1681 | 311 |
| 583 | 3300048905 | Ga0496102_0286372 | Ga0496102_0286372_82_1035 | 311 |
| 584 | 3300049568 | Ga0501031_0062022 | Ga0501031_0062022_1164_2102 | 311 |
| 585 | 3300049569 | Ga0501032_0000238 | Ga0501032_0000238_3090_4028 | 311 |
| 586 | 3300049571 | Ga0501034_0032395 | Ga0501034_0032395_1228_2166 | 311 |
| 587 | 3300049571 | Ga0501034_0050238 | Ga0501034_0050238_2512_3450 | 311 |
| 588 | 3300049571 | Ga0501034_0126680 | Ga0501034_0126680_877_1815 | 311 |
| 589 | 3300049571 | Ga0501034_0158075 | Ga0501034_0158075_448_1386 | 311 |
| 590 | 3300049572 | Ga0501036_0037224 | Ga0501036_0037224_161_1099 | 311 |
| 591 | 3300049572 | Ga0501036_0125412 | Ga0501036_0125412_526_1464 | 311 |
| 592 | 3300049573 | Ga0501037_0033834 | Ga0501037_0033834_2752_3690 | 311 |
| 593 | 3300049573 | Ga0501037_0054099 | Ga0501037_0054099_127_1065 | 311 |
| 594 | 3300049574 | Ga0501038_0016573 | Ga0501038_0016573_4114_5052 | 311 |
| 595 | 3300049574 | Ga0501038_0070585 | Ga0501038_0070585_1402_2340 | 311 |
| 596 | 3300049574 | Ga0501038_0176632 | Ga0501038_0176632_282_1220 | 311 |
| 597 | 3300049575 | Ga0501039_0005219 | Ga0501039_0005219_4718_5656 | 311 |
| 598 | 3300049575 | Ga0501039_0013177 | Ga0501039_0013177_4139_5077 | 311 |
| 599 | 3300049579 | Ga0501043_0023740 | Ga0501043_0023740_848_1786 | 311 |
| 600 | 3300049579 | Ga0501043_0059264 | Ga0501043_0059264_414_1352 | 311 |
| 601 | 3300049580 | Ga0501046_0016583 | Ga0501046_0016583_1421_2359 | 311 |
| 602 | 3300049580 | Ga0501046_0073691 | Ga0501046_0073691_245_1183 | 311 |
| 603 | 3300049581 | Ga0501047_0009783 | Ga0501047_0009783_5910_6848 | 311 |
| 604 | 3300049581 | Ga0501047_0020624 | Ga0501047_0020624_2990_3928 | 311 |
| 605 | 3300049581 | Ga0501047_0030744 | Ga0501047_0030744_2626_3564 | 311 |
| 606 | 3300049582 | Ga0501048_0021788 | Ga0501048_0021788_2341_3279 | 311 |
| 607 | 3300049584 | Ga0501068_0004498 | Ga0501068_0004498_1456_2394 | 311 |
| 608 | 3300049585 | Ga0501069_0020196 | Ga0501069_0020196_1224_2162 | 311 |
| 609 | 3300049588 | Ga0501072_0038938 | Ga0501072_0038938_525_1463 | 311 |
| 610 | 3300049589 | Ga0501073_0079872 | Ga0501073_0079872_1285_2223 | 311 |
| 611 | 3300049593 | Ga0501077_0031050 | Ga0501077_0031050_821_1759 | 311 |
| 612 | 3300049679 | Ga0501249_003203 | Ga0501249_003203_801_1742 | 311 |
| 613 | 3300049685 | Ga0501256_005441 | Ga0501256_005441_139_1080 | 311 |
| 614 | 3300049688 | Ga0501259_007145 | Ga0501259_007145_671_1612 | 311 |
| 615 | 3300049742 | Ga0501080_0001278 | Ga0501080_0001278_15579_16517 | 311 |
| 616 | 3300049742 | Ga0501080_0019896 | Ga0501080_0019896_1147_2085 | 311 |
| 617 | 3300049742 | Ga0501080_0064732 | Ga0501080_0064732_633_1571 | 311 |
| 618 | 3300049744 | Ga0501083_0035705 | Ga0501083_0035705_1378_2316 | 311 |
| 619 | 3300049744 | Ga0501083_0088428 | Ga0501083_0088428_342_1280 | 311 |
| 620 | 3300049822 | Ga0501035_0133107 | Ga0501035_0133107_707_1645 | 311 |
| 621 | 3300049822 | Ga0501035_0255713 | Ga0501035_0255713_517_1455 | 311 |
| 622 | 3300049823 | Ga0501044_0023762 | Ga0501044_0023762_3070_4008 | 311 |
| 623 | 3300049823 | Ga0501044_0044285 | Ga0501044_0044285_1601_2539 | 311 |
| 624 | 3300049823 | Ga0501044_0162508 | Ga0501044_0162508_983_1921 | 311 |
| 625 | 3300050509 | nmdc:mga0qj67_53394_c1 | nmdc:mga0qj67_53394_c1_275_1216 | 311 |
| 626 | 3300050510 | nmdc:mga06r32_19415_c1 | nmdc:mga06r32_19415_c1_649_1590 | 311 |
| 627 | 3300054114 | Ga0501084_0104401 | Ga0501084_0104401_421_1359 | 311 |
| 628 | 3300060353 | Ga0501082_0009288 | Ga0501082_0009288_1441_2379 | 311 |
| 629 | 3300060353 | Ga0501082_0023603 | Ga0501082_0023603_2897_3835 | 311 |
| 630 | 3300060353 | Ga0501082_0138667 | Ga0501082_0138667_107_1051 | 311 |
| 631 | 3300005329 | Ga0070683_100066308 | Ga0070683_1000663082 | 312 |
| 632 | 3300005439 | Ga0070711_100290706 | Ga0070711_1002907062 | 312 |
| 633 | 3300005539 | Ga0068853_100117196 | Ga0068853_1001171962 | 312 |
| 634 | 3300005545 | Ga0070695_100024875 | Ga0070695_1000248752 | 312 |
| 635 | 3300005614 | Ga0068856_100513782 | Ga0068856_1005137822 | 312 |
| 636 | 3300005617 | Ga0068859_100146789 | Ga0068859_1001467892 | 312 |
| 637 | 3300006931 | Ga0097620_100146784 | Ga0097620_1001467842 | 312 |
| 638 | 3300009093 | Ga0105240_10006165 | Ga0105240_1000616512 | 312 |
| 639 | 3300009098 | Ga0105245_10004774 | Ga0105245_100047748 | 312 |
| 640 | 3300009098 | Ga0105245_10027240 | Ga0105245_100272403 | 312 |
| 641 | 3300009545 | Ga0105237_10043134 | Ga0105237_100431343 | 312 |
| 642 | 3300010375 | Ga0105239_10024652 | Ga0105239_100246524 | 312 |
| 643 | 3300013104 | Ga0157370_10001341 | Ga0157370_1000134117 | 312 |
| 644 | 3300013105 | Ga0157369_10006133 | Ga0157369_100061338 | 312 |
| 645 | 3300014326 | Ga0157380_10212218 | Ga0157380_102122182 | 312 |
| 646 | 3300025906 | Ga0207699_10127230 | Ga0207699_101272302 | 312 |
| 647 | 3300025913 | Ga0207695_10003666 | Ga0207695_100036667 | 312 |
| 648 | 3300025914 | Ga0207671_10019844 | Ga0207671_100198442 | 312 |
| 649 | 3300025916 | Ga0207663_10139217 | Ga0207663_101392172 | 312 |
| 650 | 3300025927 | Ga0207687_10009224 | Ga0207687_100092244 | 312 |
| 651 | 3300025944 | Ga0207661_10011015 | Ga0207661_100110154 | 312 |
| 652 | 3300025949 | Ga0207667_10003900 | Ga0207667_1000390011 | 312 |
| 653 | 3300031548 | Ga0307408_100163729 | Ga0307408_1001637291 | 312 |
| 654 | 3300048929 | Ga0496126_0001121 | Ga0496126_0001121_19350_20306 | 312 |
| 655 | 3300013296 | Ga0157374_10011723 | Ga0157374_100117232 | 313 |
| 656 | 3300013297 | Ga0157378_10000659 | Ga0157378_1000065923 | 313 |
| 657 | 3300028800 | Ga0265338_10147153 | Ga0265338_101471532 | 313 |
| 658 | 3300048907 | Ga0496104_0145616 | Ga0496104_0145616_618_1628 | 313 |
| 659 | 3300049574 | Ga0501038_0198596 | Ga0501038_0198596_553_1539 | 313 |
| 660 | 3300049576 | Ga0501040_0157314 | Ga0501040_0157314_58_1044 | 313 |
| 661 | 3300049581 | Ga0501047_0301168 | Ga0501047_0301168_194_1210 | 313 |
| 662 | 3300049591 | Ga0501075_0136923 | Ga0501075_0136923_50_1036 | 313 |
| 663 | 3300049743 | Ga0501081_0122166 | Ga0501081_0122166_724_1710 | 313 |
| 664 | 3300005459 | Ga0068867_100012468 | Ga0068867_1000124686 | 314 |
| 665 | 3300005564 | Ga0070664_100038330 | Ga0070664_1000383302 | 314 |
| 666 | 3300005577 | Ga0068857_100033001 | Ga0068857_1000330013 | 314 |
| 667 | 3300006881 | Ga0068865_100089115 | Ga0068865_1000891152 | 314 |
| 668 | 3300009148 | Ga0105243_10191376 | Ga0105243_101913762 | 314 |
| 669 | 3300009176 | Ga0105242_10004104 | Ga0105242_100041048 | 314 |
| 670 | 3300009177 | Ga0105248_10102209 | Ga0105248_101022092 | 314 |
| 671 | 3300011119 | Ga0105246_10193546 | Ga0105246_101935462 | 314 |
| 672 | 3300013307 | Ga0157372_10507486 | Ga0157372_105074862 | 314 |
| 673 | 3300017792 | Ga0163161_10214112 | Ga0163161_102141122 | 314 |
| 674 | 3300025907 | Ga0207645_10150171 | Ga0207645_101501712 | 314 |
| 675 | 3300025919 | Ga0207657_10197003 | Ga0207657_101970032 | 314 |
| 676 | 3300025920 | Ga0207649_10112669 | Ga0207649_101126692 | 314 |
| 677 | 3300025932 | Ga0207690_10043386 | Ga0207690_100433862 | 314 |
| 678 | 3300025935 | Ga0207709_10078736 | Ga0207709_100787362 | 314 |
| 679 | 3300025939 | Ga0207665_10104944 | Ga0207665_101049442 | 314 |
| 680 | 3300025941 | Ga0207711_10120233 | Ga0207711_101202332 | 314 |
| 681 | 3300025944 | Ga0207661_10151116 | Ga0207661_101511162 | 314 |
| 682 | 3300025986 | Ga0207658_10174052 | Ga0207658_101740522 | 314 |
| 683 | 3300026035 | Ga0207703_10467254 | Ga0207703_104672541 | 314 |
| 684 | 3300026041 | Ga0207639_10400693 | Ga0207639_104006932 | 314 |
| 685 | 3300026089 | Ga0207648_10024869 | Ga0207648_100248692 | 314 |
| 686 | 3300026095 | Ga0207676_10521429 | Ga0207676_105214291 | 314 |
| 687 | 3300026116 | Ga0207674_10003778 | Ga0207674_1000377813 | 314 |
| 688 | 3300026118 | Ga0207675_100458635 | Ga0207675_1004586352 | 314 |
| 689 | 3300028800 | Ga0265338_10063395 | Ga0265338_100633952 | 314 |
| 690 | 3300031250 | Ga0265331_10056265 | Ga0265331_100562652 | 314 |
| 691 | 3300035172 | Ga0373955_0259037 | Ga0373955_0259037_45_1022 | 314 |
| 692 | 3300047317 | Ga0495604_0038772 | Ga0495604_0038772_971_1948 | 314 |
| 693 | 3300048903 | Ga0496100_0061882 | Ga0496100_0061882_1478_2455 | 314 |
| 694 | 3300048904 | Ga0496101_0063871 | Ga0496101_0063871_1655_2632 | 314 |
| 695 | 3300048911 | Ga0496108_0059514 | Ga0496108_0059514_585_1562 | 314 |
| 696 | 3300048915 | Ga0496112_0143435 | Ga0496112_0143435_984_1961 | 314 |
| 697 | 3300048916 | Ga0496113_0018528 | Ga0496113_0018528_3498_4475 | 314 |
| 698 | 3300005327 | Ga0070658_10039775 | Ga0070658_100397754 | 315 |
| 699 | 3300013307 | Ga0157372_10119655 | Ga0157372_101196552 | 315 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vpl-assembly1.cif.gz_A-2 | crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution | 0.9336 | 12 | 228 |
| 4yms-assembly1.cif.gz_A | crystal structure of an amino acid abc transporter | 0.9259 | 13 | 228 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.9252 | 13 | 225 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9242 | 10 | 315 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9242 | 12 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQL9_1_244_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9623 | 6 | 230 | 3.40.50.300 |
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9576 | 13 | 230 | 3.40.50.300 |
| af_O53149_2_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9548 | 4 | 228 | 3.40.50.300 |
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9547 | 7 | 230 | 3.40.50.300 |
| af_A4HV32_726_961_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9544 | 9 | 230 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3E2C6T3-F1-model_v4 | deleted | 0.966 | 120 | 221 |
|
| AF-A0A0D1P4L1-F1-model_v4 | deleted | 0.956 | 11 | 228 |
|
| AF-M0USI3-F1-model_v4 | deleted | 0.953 | 9 | 197 |
|
| AF-A0A2D4CKI9-F1-model_v4 | deleted | 0.9509 | 7 | 230 |
|
| AF-A0A7L4N782-F1-model_v4 | ABCAC protein | 0.9502 | 57 | 230 |
GO:0005319
GO:0005524 GO:0016020 GO:0016887 GO:0043231 GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar