F476035

General Info

Members Datasets Scaffolds Average Seq Length
699 303 699 313

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10147153|Ga0265338_101471532
Length 343
Sequence LEPQIRLSLGPEVNPLAQSQIASQVALKDESWTSSLVLRGVRKTFVDVVAVERLDLEVARGECFGLLGPNGAGKTTTIEICEGLTPPDAGSVELLGLNWHSGANELRQRIGIQLQETQFPDKLTVEETIRLFRSFYRQGISVEESIQTAQLEEKRRSRVGGLSGGQKQRLAMACALVGNPELLFLDEPTTGLDPQARRHLWDLVDRLKQTGRTIILTTHYMEEAERLCDRVGIMDHGKIIAIGTPQQLISSLGGEHVAEFAVTEAKSGESTVNMVALMSIPGVKSHRVDAGLHQLSVTELHSVVPRIFAALAEQELHLSEFRTHSATLEDVFVGLTGRNLRDE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
284 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
285 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.57
Metatranscriptomes 0.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 5.87
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10039775 3300005327 Bacteria 3794
2 Ga0070658_10076902 3300005327 Bacteria 2737
3 Ga0070676_10009702 3300005328 Bacteria 5206
4 Ga0070683_100000497 3300005329 Bacteria 27743
5 Ga0070683_100044867 3300005329 Bacteria 4078
6 Ga0070683_100066308 3300005329 Bacteria 3363
7 Ga0070683_100097786 3300005329 Bacteria 2761
8 Ga0068869_100023516 3300005334 Bacteria 4257
9 Ga0068869_100214756 3300005334 Bacteria 1522
10 Ga0070680_100064868 3300005336 Bacteria 2993
11 Ga0070680_100115577 3300005336 Bacteria 2236
12 Ga0070680_100458440 3300005336 Bacteria 1089
13 Ga0070660_100012266 3300005339 Bacteria 6116
14 Ga0070660_100034793 3300005339 Bacteria 3809
15 Ga0070660_100074586 3300005339 Bacteria 2655
16 Ga0070689_100068427 3300005340 Bacteria 2769
17 Ga0070691_10004603 3300005341 Bacteria 6267
18 Ga0070691_10036564 3300005341 Bacteria 2315
19 Ga0070687_100023150 3300005343 Bacteria 2949
20 Ga0070668_100071010 3300005347 Bacteria 2712
21 Ga0070669_100001748 3300005353 Bacteria 15648
22 Ga0070675_100005979 3300005354 Bacteria 9328
23 Ga0070675_100132673 3300005354 Bacteria 2123
24 Ga0070671_100001564 3300005355 Bacteria 17217
25 Ga0070671_100072473 3300005355 Bacteria 2876
26 Ga0070674_100003280 3300005356 Bacteria 9051
27 Ga0070673_100059007 3300005364 Bacteria 3036
28 Ga0070673_100189298 3300005364 Bacteria 1766
29 Ga0070659_100025518 3300005366 Bacteria 4540
30 Ga0070667_100144405 3300005367 Bacteria 2086
31 Ga0070714_100012757 3300005435 Bacteria 6714
32 Ga0070714_100166348 3300005435 Bacteria 1999
33 Ga0070713_100015995 3300005436 Bacteria 5630
34 Ga0070713_100069771 3300005436 Bacteria 2965
35 Ga0070713_100111793 3300005436 Bacteria 2383
36 Ga0070713_100490536 3300005436 Bacteria 1158
37 Ga0070711_100038821 3300005439 Bacteria 3204
38 Ga0070711_100115374 3300005439 Bacteria 1978
39 Ga0070711_100290706 3300005439 Bacteria 1296
40 Ga0070705_100003221 3300005440 Bacteria 8015
41 Ga0070705_100036336 3300005440 Bacteria 2769
42 Ga0070694_100054221 3300005444 Bacteria 2716
43 Ga0070694_100085911 3300005444 Bacteria 2198
44 Ga0070663_100334758 3300005455 Bacteria 1221
45 Ga0070678_100003224 3300005456 Bacteria 9059
46 Ga0070662_100003892 3300005457 Bacteria 9358
47 Ga0070662_100147286 3300005457 Bacteria 1830
48 Ga0070662_100254748 3300005457 Bacteria 1412
49 Ga0070681_10000441 3300005458 Bacteria 33817
50 Ga0070681_10001537 3300005458 Bacteria 20425
51 Ga0070681_10004802 3300005458 Bacteria 12956
52 Ga0070681_10074738 3300005458 Bacteria 3349
53 Ga0070681_10205038 3300005458 Bacteria 1889
54 Ga0068867_100000309 3300005459 Bacteria 32165
55 Ga0068867_100012468 3300005459 Bacteria 6016
56 Ga0068867_100103844 3300005459 Bacteria 2174
57 Ga0070685_10009147 3300005466 Bacteria 5111
58 Ga0070699_100009238 3300005518 Bacteria 8544
59 Ga0070679_100001789 3300005530 Bacteria 19379
60 Ga0070679_100002960 3300005530 Bacteria 15486
61 Ga0070679_100003023 3300005530 Bacteria 15360
62 Ga0070679_100049650 3300005530 Bacteria 4179
63 Ga0070679_100112648 3300005530 Bacteria 2706
64 Ga0070684_100002594 3300005535 Bacteria 13351
65 Ga0070684_100016923 3300005535 Bacteria 5972
66 Ga0070684_100093560 3300005535 Bacteria 2676
67 Ga0070684_100340789 3300005535 Bacteria 1378
68 Ga0070697_100012402 3300005536 Bacteria 6678
69 Ga0068853_100043338 3300005539 Bacteria 3849
70 Ga0068853_100117196 3300005539 Bacteria 2372
71 Ga0068853_100262910 3300005539 Bacteria 1587
72 Ga0068853_100370414 3300005539 Bacteria 1336
73 Ga0070672_100073195 3300005543 Bacteria 2730
74 Ga0070695_100003895 3300005545 Bacteria 8710
75 Ga0070695_100024875 3300005545 Bacteria 3693
76 Ga0070695_100064259 3300005545 Bacteria 2387
77 Ga0070696_100010195 3300005546 Bacteria 6288
78 Ga0070696_100012252 3300005546 Bacteria 5747
79 Ga0070696_100064549 3300005546 Bacteria 2566
80 Ga0070693_100001942 3300005547 Bacteria 9464
81 Ga0070693_100096630 3300005547 Bacteria 1791
82 Ga0070665_100133396 3300005548 Bacteria 2485
83 Ga0070704_100016010 3300005549 Bacteria 4727
84 Ga0070704_100031426 3300005549 Bacteria 3572
85 Ga0070704_100204006 3300005549 Bacteria 1598
86 Ga0068855_100009276 3300005563 Bacteria 11886
87 Ga0068855_100040881 3300005563 Bacteria 5499
88 Ga0068855_100200751 3300005563 Bacteria 2245
89 Ga0070664_100038330 3300005564 Bacteria 4033
90 Ga0070664_100272772 3300005564 Bacteria 1524
91 Ga0070664_100376321 3300005564 Bacteria 1295
92 Ga0068857_100001612 3300005577 Bacteria 18104
93 Ga0068857_100033001 3300005577 Bacteria 4578
94 Ga0068857_100049444 3300005577 Bacteria 3730
95 Ga0068854_100000233 3300005578 Bacteria 37869
96 Ga0068856_100004846 3300005614 Bacteria 13330
97 Ga0068856_100041063 3300005614 Bacteria 4545
98 Ga0068856_100066505 3300005614 Bacteria 3561
99 Ga0068856_100372998 3300005614 Bacteria 1446
100 Ga0068856_100506229 3300005614 Bacteria 1229
101 Ga0068856_100513782 3300005614 Bacteria 1219
102 Ga0070702_100005809 3300005615 Bacteria 5787
103 Ga0068859_100077697 3300005617 Bacteria 3360
104 Ga0068859_100146789 3300005617 Bacteria 2434
105 Ga0068859_100298922 3300005617 Bacteria 1703
106 Ga0068864_100042025 3300005618 Bacteria 3911
107 Ga0068864_100431062 3300005618 Bacteria 1258
108 Ga0068866_10007873 3300005718 Bacteria 4472
109 Ga0068861_100032981 3300005719 Bacteria 3817
110 Ga0068861_100232516 3300005719 Bacteria 1564
111 Ga0068858_100005708 3300005842 Bacteria 12162
112 Ga0068858_100076781 3300005842 Bacteria 3103
113 Ga0068860_100001540 3300005843 Bacteria 24832
114 Ga0081455_10030790 3300005937 Bacteria 4869
115 Ga0070717_10002009 3300006028 Bacteria 14214
116 Ga0097621_100117304 3300006237 Bacteria 2255
117 Ga0068871_100098532 3300006358 Bacteria 2446
118 Ga0068871_100099279 3300006358 Bacteria 2437
119 Ga0075428_100060430 3300006844 Bacteria 4150
120 Ga0075428_100405643 3300006844 Bacteria 1460
121 Ga0075431_100013860 3300006847 Bacteria 8142
122 Ga0075431_100017316 3300006847 Bacteria 7323
123 Ga0075431_100039998 3300006847 Bacteria 4831
124 Ga0075433_10070382 3300006852 Bacteria 3074
125 Ga0075434_100015810 3300006871 Bacteria 7245
126 Ga0075434_100023568 3300006871 Bacteria 6001
127 Ga0075429_100026199 3300006880 Bacteria 5060
128 Ga0075429_100033910 3300006880 Bacteria 4436
129 Ga0068865_100000964 3300006881 Bacteria 16411
130 Ga0068865_100071845 3300006881 Bacteria 2456
131 Ga0068865_100089115 3300006881 Bacteria 2234
132 Ga0075436_100003059 3300006914 Bacteria 11458
133 Ga0075436_100017485 3300006914 Bacteria 4910
134 Ga0097620_100077697 3300006931 Bacteria 3360
135 Ga0097620_100146784 3300006931 Bacteria 2434
136 Ga0097620_100298939 3300006931 Bacteria 1703
137 Ga0075435_100316686 3300007076 Bacteria 1335
138 Ga0099794_10056931 3300007265 Bacteria 1893
139 Ga0099795_10002880 3300007788 Bacteria 4163
140 Ga0105240_10001183 3300009093 Bacteria 45676
141 Ga0105240_10001383 3300009093 Bacteria 41701
142 Ga0105240_10004420 3300009093 Bacteria 21434
143 Ga0105240_10006165 3300009093 Bacteria 17671
144 Ga0105240_10010543 3300009093 Bacteria 12979
145 Ga0105240_10149863 3300009093 Bacteria 2779
146 Ga0105240_10218330 3300009093 Bacteria 2223
147 Ga0105240_10358815 3300009093 Bacteria 1651
148 Ga0111539_10185779 3300009094 Bacteria 2427
149 Ga0111539_10572655 3300009094 Bacteria 1315
150 Ga0105245_10004774 3300009098 Bacteria 11957
151 Ga0105245_10027240 3300009098 Bacteria 5036
152 Ga0105245_10064625 3300009098 Bacteria 3307
153 Ga0105245_10237463 3300009098 Bacteria 1765
154 Ga0105247_10173112 3300009101 Bacteria 1436
155 Ga0114129_10008584 3300009147 Bacteria 14567
156 Ga0114129_10008737 3300009147 Bacteria 14446
157 Ga0114129_10401377 3300009147 Bacteria 1806
158 Ga0114129_10439525 3300009147 Bacteria 1713
159 Ga0114129_10580631 3300009147 Bacteria 1454
160 Ga0114129_10647649 3300009147 Bacteria 1364
161 Ga0105243_10000865 3300009148 Bacteria 28639
162 Ga0105243_10013671 3300009148 Bacteria 6141
163 Ga0105243_10191376 3300009148 Bacteria 1787
164 Ga0105243_10370596 3300009148 Bacteria 1321
165 Ga0105241_10007408 3300009174 Bacteria 8075
166 Ga0105241_10178866 3300009174 Bacteria 1758
167 Ga0105241_10298267 3300009174 Bacteria 1382
168 Ga0105242_10002781 3300009176 Bacteria 13699
169 Ga0105242_10004104 3300009176 Bacteria 11327
170 Ga0105248_10000002 3300009177 Bacteria 1054120
171 Ga0105248_10020812 3300009177 Bacteria 7267
172 Ga0105248_10089389 3300009177 Bacteria 3467
173 Ga0105248_10102209 3300009177 Bacteria 3231
174 Ga0105248_10143817 3300009177 Bacteria 2691
175 Ga0105237_10004190 3300009545 Bacteria 16791
176 Ga0105237_10025780 3300009545 Bacteria 6012
177 Ga0105237_10043134 3300009545 Bacteria 4546
178 Ga0105238_10002578 3300009551 Bacteria 18075
179 Ga0105238_10005105 3300009551 Bacteria 12979
180 Ga0105238_10024186 3300009551 Bacteria 6193
181 Ga0105238_10255264 3300009551 Bacteria 1732
182 Ga0105249_10007387 3300009553 Bacteria 9587
183 Ga0105249_10028228 3300009553 Bacteria 5066
184 Ga0099796_10000303 3300010159 Bacteria 7806
185 Ga0105239_10006055 3300010375 Bacteria 14080
186 Ga0105239_10011224 3300010375 Bacteria 9998
187 Ga0105239_10024652 3300010375 Bacteria 6627
188 Ga0105239_10048978 3300010375 Bacteria 4633
189 Ga0105239_10383989 3300010375 Bacteria 1588
190 Ga0105246_10013968 3300011119 Bacteria 5042
191 Ga0105246_10062783 3300011119 Bacteria 2589
192 Ga0105246_10193546 3300011119 Bacteria 1576
193 Ga0157371_10013679 3300013102 Bacteria 6157
194 Ga0157370_10001341 3300013104 Bacteria 30545
195 Ga0157370_10016832 3300013104 Bacteria 7389
196 Ga0157370_10021792 3300013104 Bacteria 6383
197 Ga0157370_10034818 3300013104 Bacteria 4900
198 Ga0157370_10137098 3300013104 Bacteria 2280
199 Ga0157370_10252085 3300013104 Bacteria 1633
200 Ga0157369_10004665 3300013105 Bacteria 16113
201 Ga0157369_10006133 3300013105 Bacteria 13948
202 Ga0157369_10015840 3300013105 Bacteria 8492
203 Ga0157369_10046333 3300013105 Bacteria 4725
204 Ga0157369_10046615 3300013105 Bacteria 4710
205 Ga0157374_10011723 3300013296 Bacteria 7604
206 Ga0157374_10032820 3300013296 Bacteria 4731
207 Ga0157378_10000659 3300013297 Bacteria 32533
208 Ga0157378_10001261 3300013297 Bacteria 22795
209 Ga0157378_10324634 3300013297 Bacteria 1496
210 Ga0163162_10035542 3300013306 Bacteria 4963
211 Ga0157372_10002875 3300013307 Bacteria 18614
212 Ga0157372_10005961 3300013307 Bacteria 12955
213 Ga0157372_10008909 3300013307 Bacteria 10661
214 Ga0157372_10011183 3300013307 Bacteria 9544
215 Ga0157372_10106849 3300013307 Bacteria 3202
216 Ga0157372_10119655 3300013307 Bacteria 3023
217 Ga0157372_10308828 3300013307 Bacteria 1841
218 Ga0157372_10412047 3300013307 Bacteria 1575
219 Ga0157372_10507486 3300013307 Bacteria 1406
220 Ga0157375_10012857 3300013308 Bacteria 7435
221 Ga0157375_10016710 3300013308 Bacteria 6602
222 Ga0157375_10097572 3300013308 Bacteria 3014
223 Ga0157380_10212218 3300014326 Bacteria 1726
224 Ga0157380_10251812 3300014326 Bacteria 1599
225 Ga0157380_10288372 3300014326 Bacteria 1506
226 Ga0157376_10252739 3300014969 Bacteria 1647
227 Ga0163161_10015790 3300017792 Bacteria 5266
228 Ga0163161_10214112 3300017792 Bacteria 1489
229 Ga0206356_11887767 3300020070 Bacteria 2325
230 Ga0207699_10056091 3300025906 Bacteria 2347
231 Ga0207699_10127230 3300025906 Bacteria 1656
232 Ga0207645_10005052 3300025907 Bacteria 9665
233 Ga0207645_10150171 3300025907 Bacteria 1521
234 Ga0207643_10001129 3300025908 Bacteria 15875
235 Ga0207684_10251547 3300025910 Bacteria 1525
236 Ga0207654_10015545 3300025911 Bacteria 3951
237 Ga0207654_10161682 3300025911 Bacteria 1447
238 Ga0207654_10172260 3300025911 Bacteria 1406
239 Ga0207707_10000987 3300025912 Bacteria 27338
240 Ga0207707_10002717 3300025912 Bacteria 15796
241 Ga0207707_10002760 3300025912 Bacteria 15659
242 Ga0207707_10011352 3300025912 Bacteria 7755
243 Ga0207707_10031722 3300025912 Bacteria 4625
244 Ga0207707_10094990 3300025912 Bacteria 2606
245 Ga0207695_10003003 3300025913 Bacteria 24250
246 Ga0207695_10003666 3300025913 Bacteria 21419
247 Ga0207695_10012862 3300025913 Bacteria 10018
248 Ga0207695_10015372 3300025913 Bacteria 9010
249 Ga0207695_10038902 3300025913 Bacteria 5115
250 Ga0207695_10156207 3300025913 Bacteria 2216
251 Ga0207671_10019844 3300025914 Bacteria 5130
252 Ga0207671_10265384 3300025914 Bacteria 1352
253 Ga0207693_10039760 3300025915 Bacteria 3704
254 Ga0207663_10024305 3300025916 Bacteria 3489
255 Ga0207663_10048605 3300025916 Bacteria 2627
256 Ga0207663_10139217 3300025916 Bacteria 1688
257 Ga0207660_10006741 3300025917 Bacteria 7436
258 Ga0207660_10010991 3300025917 Bacteria 5886
259 Ga0207660_10029149 3300025917 Bacteria 3782
260 Ga0207662_10013560 3300025918 Bacteria 4559
261 Ga0207657_10021277 3300025919 Bacteria 6109
262 Ga0207657_10057745 3300025919 Bacteria 3343
263 Ga0207657_10197003 3300025919 Bacteria 1622
264 Ga0207649_10031377 3300025920 Bacteria 3157
265 Ga0207649_10112669 3300025920 Bacteria 1820
266 Ga0207649_10163862 3300025920 Bacteria 1543
267 Ga0207652_10001801 3300025921 Bacteria 18612
268 Ga0207652_10008781 3300025921 Bacteria 8136
269 Ga0207652_10009001 3300025921 Bacteria 8045
270 Ga0207652_10065911 3300025921 Bacteria 3137
271 Ga0207652_10169534 3300025921 Bacteria 1958
272 Ga0207652_10471015 3300025921 Bacteria 1132
273 Ga0207646_10123495 3300025922 Bacteria 2327
274 Ga0207681_10013396 3300025923 Bacteria 5075
275 Ga0207694_10003089 3300025924 Bacteria 13330
276 Ga0207694_10005174 3300025924 Bacteria 10073
277 Ga0207694_10006757 3300025924 Bacteria 8712
278 Ga0207694_10007780 3300025924 Bacteria 8115
279 Ga0207659_10011148 3300025926 Bacteria 5672
280 Ga0207687_10009224 3300025927 Bacteria 6456
281 Ga0207687_10032394 3300025927 Bacteria 3540
282 Ga0207687_10213504 3300025927 Bacteria 1515
283 Ga0207700_10041874 3300025928 Bacteria 3354
284 Ga0207700_10054190 3300025928 Bacteria 3009
285 Ga0207664_10062105 3300025929 Bacteria 2983
286 Ga0207664_10285312 3300025929 Bacteria 1449
287 Ga0207690_10038767 3300025932 Bacteria 3104
288 Ga0207690_10043386 3300025932 Bacteria 2960
289 Ga0207690_10050129 3300025932 Bacteria 2786
290 Ga0207706_10000005 3300025933 Bacteria 224460
291 Ga0207706_10016085 3300025933 Bacteria 6760
292 Ga0207706_10266169 3300025933 Bacteria 1496
293 Ga0207706_10409333 3300025933 Bacteria 1175
294 Ga0207706_10435923 3300025933 Bacteria 1135
295 Ga0207686_10000123 3300025934 Bacteria 62530
296 Ga0207709_10001959 3300025935 Bacteria 13455
297 Ga0207709_10078736 3300025935 Bacteria 2117
298 Ga0207709_10101568 3300025935 Bacteria 1902
299 Ga0207669_10002038 3300025937 Bacteria 8561
300 Ga0207704_10001280 3300025938 Bacteria 11246
301 Ga0207704_10214283 3300025938 Bacteria 1420
302 Ga0207665_10104944 3300025939 Bacteria 1978
303 Ga0207691_10113308 3300025940 Bacteria 2410
304 Ga0207711_10000842 3300025941 Bacteria 29652
305 Ga0207711_10001497 3300025941 Bacteria 21763
306 Ga0207711_10120233 3300025941 Bacteria 2344
307 Ga0207711_10380149 3300025941 Bacteria 1310
308 Ga0207689_10005606 3300025942 Bacteria 11186
309 Ga0207689_10065388 3300025942 Bacteria 2991
310 Ga0207661_10011015 3300025944 Bacteria 6535
311 Ga0207661_10032308 3300025944 Bacteria 4053
312 Ga0207661_10043381 3300025944 Bacteria 3549
313 Ga0207661_10069894 3300025944 Bacteria 2864
314 Ga0207661_10150472 3300025944 Bacteria 2011
315 Ga0207661_10151116 3300025944 Bacteria 2007
316 Ga0207661_10198862 3300025944 Bacteria 1761
317 Ga0207679_10013030 3300025945 Bacteria 5441
318 Ga0207667_10000332 3300025949 Bacteria 64962
319 Ga0207667_10003900 3300025949 Bacteria 18344
320 Ga0207667_10005708 3300025949 Bacteria 15179
321 Ga0207712_10005953 3300025961 Bacteria 7693
322 Ga0207668_10027060 3300025972 Bacteria 3733
323 Ga0207640_10000870 3300025981 Bacteria 17150
324 Ga0207640_10232366 3300025981 Bacteria 1419
325 Ga0207658_10054755 3300025986 Bacteria 2953
326 Ga0207658_10174052 3300025986 Bacteria 1776
327 Ga0207677_10131340 3300026023 Bacteria 1902
328 Ga0207703_10002747 3300026035 Bacteria 15075
329 Ga0207703_10145025 3300026035 Bacteria 2064
330 Ga0207703_10212200 3300026035 Bacteria 1727
331 Ga0207703_10467254 3300026035 Bacteria 1181
332 Ga0207639_10074665 3300026041 Bacteria 2663
333 Ga0207639_10400693 3300026041 Bacteria 1236
334 Ga0207639_10404686 3300026041 Bacteria 1230
335 Ga0207678_10072069 3300026067 Bacteria 2960
336 Ga0207678_10354848 3300026067 Bacteria 1265
337 Ga0207702_10004800 3300026078 Bacteria 11916
338 Ga0207702_10028305 3300026078 Bacteria 4657
339 Ga0207702_10109507 3300026078 Bacteria 2453
340 Ga0207702_10121746 3300026078 Bacteria 2336
341 Ga0207702_10201337 3300026078 Bacteria 1846
342 Ga0207648_10000008 3300026089 Bacteria 208822
343 Ga0207648_10024869 3300026089 Bacteria 5340
344 Ga0207676_10521429 3300026095 Bacteria 1131
345 Ga0207674_10000300 3300026116 Bacteria 62723
346 Ga0207674_10002379 3300026116 Bacteria 23783
347 Ga0207674_10003778 3300026116 Bacteria 18471
348 Ga0207674_10007051 3300026116 Bacteria 13138
349 Ga0207675_100049160 3300026118 Bacteria 3937
350 Ga0207675_100278659 3300026118 Bacteria 1624
351 Ga0207675_100458635 3300026118 Bacteria 1264
352 Ga0207683_10009983 3300026121 Bacteria 8101
353 Ga0207683_10292163 3300026121 Bacteria 1490
354 Ga0207698_10010253 3300026142 Bacteria 6009
355 Ga0209179_1003094 3300027512 Bacteria 2351
356 Ga0209588_1024375 3300027671 Bacteria 1910
357 Ga0209588_1028027 3300027671 Bacteria 1792
358 Ga0209971_1019249 3300027682 Bacteria 1621
359 Ga0209974_10015189 3300027876 Bacteria 2556
360 Ga0265354_1000189 3300028016 Bacteria 11333
361 Ga0268266_10096961 3300028379 Bacteria 2593
362 Ga0265318_10011338 3300028577 Bacteria 3840
363 Ga0265323_10000932 3300028653 Bacteria 15376
364 Ga0265336_10001161 3300028666 Bacteria 12590
365 Ga0265338_10024486 3300028800 Bacteria 6165
366 Ga0265338_10039023 3300028800 Bacteria 4488
367 Ga0265338_10039150 3300028800 Bacteria 4479
368 Ga0265338_10056370 3300028800 Bacteria 3486
369 Ga0265338_10063395 3300028800 Bacteria 3223
370 Ga0265338_10147153 3300028800 Bacteria 1836
371 Ga0265770_1003323 3300030878 Bacteria 2186
372 Ga0265760_10002519 3300031090 Bacteria 5344
373 Ga0265330_10004148 3300031235 Bacteria 7412
374 Ga0265330_10009553 3300031235 Bacteria 4603
375 Ga0265330_10026239 3300031235 Bacteria 2636
376 Ga0265320_10022135 3300031240 Bacteria 3406
377 Ga0265325_10013390 3300031241 Bacteria 4670
378 Ga0265340_10026021 3300031247 Bacteria 2961
379 Ga0265339_10000457 3300031249 Bacteria 31937
380 Ga0265339_10000474 3300031249 Bacteria 31375
381 Ga0265339_10069814 3300031249 Bacteria 1874
382 Ga0265331_10015412 3300031250 Bacteria 4035
383 Ga0265331_10056265 3300031250 Bacteria 1868
384 Ga0265316_10001044 3300031344 Bacteria 30001
385 Ga0265316_10012825 3300031344 Bacteria 7485
386 Ga0265316_10017055 3300031344 Bacteria 6286
387 Ga0265316_10033866 3300031344 Bacteria 4155
388 Ga0265316_10084425 3300031344 Bacteria 2432
389 Ga0307408_100028718 3300031548 Bacteria 3847
390 Ga0307408_100163729 3300031548 Bacteria 1769
391 Ga0307408_100359729 3300031548 Bacteria 1238
392 Ga0307408_100514742 3300031548 Bacteria 1050
393 Ga0265313_10007313 3300031595 Bacteria 7577
394 Ga0265313_10009170 3300031595 Bacteria 6455
395 Ga0265313_10046341 3300031595 Bacteria 2111
396 Ga0265314_10000261 3300031711 Bacteria 77506
397 Ga0265314_10001995 3300031711 Bacteria 21647
398 Ga0265314_10007657 3300031711 Bacteria 9339
399 Ga0265314_10013305 3300031711 Bacteria 6654
400 Ga0265314_10016081 3300031711 Bacteria 5923
401 Ga0265314_10148423 3300031711 Bacteria 1441
402 Ga0265342_10001022 3300031712 Bacteria 27535
403 Ga0265342_10006082 3300031712 Bacteria 9057
404 Ga0265342_10051431 3300031712 Bacteria 2458
405 Ga0307405_10012382 3300031731 Bacteria 4513
406 Ga0307405_10028517 3300031731 Bacteria 3253
407 Ga0307410_10000285 3300031852 Bacteria 19565
408 Ga0307410_10040015 3300031852 Bacteria 3082
409 Ga0307410_10276514 3300031852 Bacteria 1316
410 Ga0307406_10070480 3300031901 Bacteria 2289
411 Ga0307407_10006354 3300031903 Bacteria 5237
412 Ga0307407_10142808 3300031903 Bacteria 1546
413 Ga0307412_10075856 3300031911 Bacteria 2308
414 Ga0307412_10237809 3300031911 Bacteria 1407
415 Ga0307409_100026816 3300031995 Bacteria 4071
416 Ga0307409_100040386 3300031995 Bacteria 3473
417 Ga0307409_100053537 3300031995 Bacteria 3101
418 Ga0307409_100295479 3300031995 Bacteria 1504
419 Ga0307416_100005552 3300032002 Bacteria 7762
420 Ga0307416_100035999 3300032002 Bacteria 3789
421 Ga0307416_100089039 3300032002 Bacteria 2641
422 Ga0307414_10004400 3300032004 Bacteria 7652
423 Ga0307414_10117335 3300032004 Bacteria 2039
424 Ga0307411_10107604 3300032005 Bacteria 1987
425 Ga0307411_10189400 3300032005 Bacteria 1569
426 Ga0307415_100039686 3300032126 Bacteria 3114
427 Ga0307415_100204440 3300032126 Bacteria 1570
428 Ga0373926_0013943 3300035083 Bacteria 2729
429 Ga0373944_0002300 3300035089 Bacteria 4862
430 Ga0373923_0012458 3300035111 Bacteria 3144
431 Ga0373936_0028798 3300035113 Bacteria 2185
432 Ga0373941_0031698 3300035115 Bacteria 1577
433 Ga0373945_0010724 3300035116 Bacteria 3020
434 Ga0373953_0015245 3300035117 Bacteria 2781
435 Ga0373954_0022191 3300035118 Bacteria 2877
436 Ga0373954_0044644 3300035118 Bacteria 2069
437 Ga0373954_0092125 3300035118 Bacteria 1456
438 Ga0373957_0039068 3300035120 Bacteria 1779
439 Ga0373943_0005645 3300035170 Bacteria 5613
440 Ga0373943_0044694 3300035170 Bacteria 2156
441 Ga0373946_0005284 3300035171 Bacteria 4656
442 Ga0373955_0037364 3300035172 Bacteria 2581
443 Ga0373955_0109328 3300035172 Bacteria 1597
444 Ga0373955_0259037 3300035172 Bacteria 1044
445 Ga0373931_0044005 3300035691 Bacteria 2354
446 Ga0373927_0002599 3300035695 Bacteria 13156
447 Ga0373927_0003663 3300035695 Bacteria 10949
448 Ga0373927_0017817 3300035695 Bacteria 4671
449 Ga0373927_0022906 3300035695 Bacteria 4092
450 Ga0373933_0013032 3300035724 Bacteria 4602
451 Ga0373933_0031506 3300035724 Bacteria 3076
452 Ga0373947_0000975 3300035725 Bacteria 17477
453 Ga0373947_0086905 3300035725 Bacteria 1944
454 Ga0373947_0103620 3300035725 Bacteria 1791
455 Ga0373947_0195993 3300035725 Bacteria 1320
456 Ga0373937_0009964 3300036401 Bacteria 8286
457 Ga0373937_0036661 3300036401 Bacteria 4469
458 Ga0373937_0076033 3300036401 Bacteria 3101
459 Ga0373937_0108009 3300036401 Bacteria 2587
460 Ga0373925_0001709 3300037068 Bacteria 18501
461 Ga0373925_0017306 3300037068 Bacteria 5223
462 Ga0436364_1031302 3300037853 Bacteria 2654
463 Ga0400489_90906 3300039093 Bacteria 2368
464 Ga0436365_0549141 3300039437 Bacteria 7475
465 Ga0436365_1319592 3300039437 Bacteria 6280
466 Ga0436360_1020218 3300039438 Bacteria 3720
467 Ga0436361_0745744 3300039447 Bacteria 1195
468 Ga0439455_0004315 3300042012 Bacteria 2810
469 Ga0450910_011487 3300042147 Bacteria 1271
470 Ga0451577_0000932 3300042876 Bacteria 42989
471 Ga0451577_0003861 3300042876 Bacteria 16272
472 Ga0453684_0000577 3300044712 Bacteria 136326
473 Ga0495603_0002024 3300046455 Bacteria 11933
474 Ga0495629_0003783 3300046459 Bacteria 11396
475 Ga0495629_0265239 3300046459 Bacteria 1180
476 Ga0495641_0051079 3300046461 Bacteria 1889
477 Ga0495651_0000096 3300046462 Bacteria 64781
478 Ga0495651_0000672 3300046462 Bacteria 26582
479 Ga0495653_0046413 3300046463 Bacteria 3364
480 Ga0495653_0084832 3300046463 Bacteria 2332
481 Ga0495580_0115609 3300046472 Bacteria 1863
482 Ga0495582_0003153 3300046473 Bacteria 9254
483 Ga0495582_0003312 3300046473 Bacteria 9053
484 Ga0495582_0059121 3300046473 Bacteria 2115
485 Ga0495639_0000175 3300046475 Bacteria 33683
486 Ga0495639_0073206 3300046475 Bacteria 1585
487 Ga0495608_0006128 3300046511 Bacteria 8532
488 Ga0495608_0034153 3300046511 Bacteria 3435
489 Ga0495608_0081488 3300046511 Bacteria 2102
490 Ga0495618_0087101 3300046514 Bacteria 1997
491 Ga0495628_0002142 3300046516 Bacteria 17885
492 Ga0495628_0021894 3300046516 Bacteria 5252
493 Ga0495628_0090695 3300046516 Bacteria 2366
494 Ga0495628_0115180 3300046516 Bacteria 2065
495 Ga0495630_0005659 3300046517 Bacteria 8830
496 Ga0495630_0039106 3300046517 Bacteria 3548
497 Ga0495630_0046284 3300046517 Bacteria 3252
498 Ga0495630_0190852 3300046517 Bacteria 1563
499 Ga0495652_0008631 3300046529 Bacteria 9289
500 Ga0495652_0024887 3300046529 Bacteria 5297
501 Ga0495652_0138416 3300046529 Bacteria 1917
502 Ga0495665_0000126 3300046531 Bacteria 36841
503 Ga0495665_0045001 3300046531 Bacteria 2344
504 Ga0495586_0030050 3300046535 Bacteria 2908
505 Ga0495586_0196439 3300046535 Bacteria 1143
506 Ga0495587_0023206 3300046536 Bacteria 3813
507 Ga0495587_0073191 3300046536 Bacteria 1991
508 Ga0495587_0148852 3300046536 Bacteria 1334
509 Ga0495645_0079964 3300046543 Bacteria 2347
510 Ga0495645_0088352 3300046543 Bacteria 2217
511 Ga0495667_0001699 3300046559 Bacteria 14621
512 Ga0495667_0049766 3300046559 Bacteria 2766
513 Ga0495634_0025120 3300046642 Bacteria 4174
514 Ga0495635_0016425 3300046663 Bacteria 5170
515 Ga0495588_0000742 3300046674 Bacteria 14870
516 Ga0495657_0005455 3300046675 Bacteria 10072
517 Ga0495657_0041352 3300046675 Bacteria 3155
518 Ga0495657_0191163 3300046675 Bacteria 1251
519 Ga0495599_0002944 3300046678 Bacteria 9901
520 Ga0495599_0003824 3300046678 Bacteria 8842
521 Ga0495623_0018113 3300046679 Bacteria 4548
522 Ga0495623_0156108 3300046679 Bacteria 1345
523 Ga0495646_0004263 3300046680 Bacteria 9000
524 Ga0495658_0000622 3300046683 Bacteria 19288
525 Ga0495613_0120053 3300046689 Bacteria 1888
526 Ga0495613_0185380 3300046689 Bacteria 1472
527 Ga0495624_0209542 3300046690 Bacteria 1182
528 Ga0495624_0243096 3300046690 Bacteria 1089
529 Ga0495600_0043815 3300046809 Bacteria 2919
530 Ga0495581_0003733 3300047315 Bacteria 8776
531 Ga0495581_0117810 3300047315 Bacteria 1545
532 Ga0495604_0002583 3300047317 Bacteria 14505
533 Ga0495604_0005994 3300047317 Bacteria 9651
534 Ga0495604_0038772 3300047317 Bacteria 3749
535 Ga0495604_0172479 3300047317 Bacteria 1520
536 Ga0495604_0286786 3300047317 Bacteria 1110
537 Ga0495674_0009734 3300047319 Bacteria 9124
538 Ga0495674_0049256 3300047319 Unclassified 3724
539 Ga0495674_0087608 3300047319 Bacteria 2664
540 Ga0495674_0256193 3300047319 Bacteria 1439
541 Ga0495674_0316798 3300047319 Bacteria 1271
542 Ga0495674_0355722 3300047319 Bacteria 1188
543 Ga0495680_0000034 3300047322 Bacteria 107708
544 Ga0495680_0039538 3300047322 Bacteria 3762
545 Ga0495675_0001342 3300047444 Bacteria 14908
546 Ga0495675_0045131 3300047444 Bacteria 2806
547 Ga0495675_0109537 3300047444 Bacteria 1724
548 Ga0495675_0115711 3300047444 Bacteria 1672
549 Ga0495675_0187021 3300047444 Bacteria 1266
550 Ga0495675_0226708 3300047444 Bacteria 1129
551 Ga0495684_0000646 3300047471 Bacteria 28009
552 Ga0495684_0004482 3300047471 Bacteria 10910
553 Ga0495684_0032650 3300047471 Bacteria 3997
554 Ga0495684_0157293 3300047471 Bacteria 1697
555 Ga0495684_0201423 3300047471 Bacteria 1467
556 Ga0495593_0000199 3300047673 Bacteria 31561
557 Ga0495593_0068308 3300047673 Bacteria 1849
558 Ga0495602_0124710 3300048088 Bacteria 2065
559 Ga0495614_0007404 3300048089 Bacteria 4887
560 Ga0496100_0061882 3300048903 Bacteria 2468
561 Ga0496100_0071551 3300048903 Bacteria 2316
562 Ga0496101_0063871 3300048904 Bacteria 2681
563 Ga0496101_0311079 3300048904 Bacteria 1235
564 Ga0496101_0347576 3300048904 Bacteria 1165
565 Ga0496102_0062017 3300048905 Bacteria 3423
566 Ga0496102_0088833 3300048905 Bacteria 2858
567 Ga0496102_0198903 3300048905 Bacteria 1889
568 Ga0496102_0216865 3300048905 Bacteria 1804
569 Ga0496102_0286372 3300048905 Bacteria 1553
570 Ga0496102_0360239 3300048905 Bacteria 1369
571 Ga0496103_0270881 3300048906 Bacteria 1092
572 Ga0496104_0004692 3300048907 Bacteria 11902
573 Ga0496104_0018077 3300048907 Bacteria 6428
574 Ga0496104_0041304 3300048907 Bacteria 4325
575 Ga0496104_0145616 3300048907 Bacteria 2275
576 Ga0496105_0044598 3300048908 Bacteria 3658
577 Ga0496106_0042683 3300048909 Bacteria 3401
578 Ga0496106_0083072 3300048909 Bacteria 2463
579 Ga0496107_0142294 3300048910 Bacteria 1773
580 Ga0496108_0010855 3300048911 Bacteria 7394
581 Ga0496108_0059514 3300048911 Bacteria 3212
582 Ga0496108_0154035 3300048911 Bacteria 1984
583 Ga0496108_0185433 3300048911 Bacteria 1802
584 Ga0496109_0011387 3300048912 Bacteria 7643
585 Ga0496109_0416476 3300048912 Bacteria 1269
586 Ga0496110_0033866 3300048913 Bacteria 4421
587 Ga0496111_0210217 3300048914 Bacteria 1445
588 Ga0496112_0000744 3300048915 Bacteria 22725
589 Ga0496112_0007979 3300048915 Bacteria 9440
590 Ga0496112_0009902 3300048915 Bacteria 8619
591 Ga0496112_0047615 3300048915 Bacteria 4207
592 Ga0496112_0143435 3300048915 Bacteria 2357
593 Ga0496112_0144641 3300048915 Bacteria 2346
594 Ga0496113_0000426 3300048916 Bacteria 20476
595 Ga0496113_0002320 3300048916 Bacteria 10995
596 Ga0496113_0018528 3300048916 Bacteria 4851
597 Ga0496113_0233477 3300048916 Bacteria 1467
598 Ga0496114_0249901 3300048917 Bacteria 1560
599 Ga0496115_0049677 3300048918 Bacteria 3358
600 Ga0496115_0081763 3300048918 Bacteria 2631
601 Ga0496126_0001121 3300048929 Bacteria 44841
602 Ga0501031_0062022 3300049568 Bacteria 2436
603 Ga0501031_0108905 3300049568 Bacteria 1809
604 Ga0501032_0000238 3300049569 Bacteria 45642
605 Ga0501033_0250363 3300049570 Bacteria 1256
606 Ga0501034_0032395 3300049571 Bacteria 5307
607 Ga0501034_0050238 3300049571 Bacteria 4206
608 Ga0501034_0126680 3300049571 Bacteria 2538
609 Ga0501034_0158075 3300049571 Bacteria 2239
610 Ga0501036_0020992 3300049572 Bacteria 5484
611 Ga0501036_0037224 3300049572 Bacteria 4116
612 Ga0501036_0125412 3300049572 Bacteria 2168
613 Ga0501037_0033834 3300049573 Bacteria 3774
614 Ga0501037_0054099 3300049573 Bacteria 2936
615 Ga0501038_0016573 3300049574 Bacteria 6680
616 Ga0501038_0070585 3300049574 Bacteria 2965
617 Ga0501038_0176632 3300049574 Bacteria 1725
618 Ga0501038_0198596 3300049574 Bacteria 1611
619 Ga0501039_0005219 3300049575 Bacteria 9836
620 Ga0501039_0013177 3300049575 Bacteria 6319
621 Ga0501040_0112675 3300049576 Bacteria 1903
622 Ga0501040_0141970 3300049576 Bacteria 1692
623 Ga0501040_0157314 3300049576 Bacteria 1605
624 Ga0501041_0023604 3300049577 Bacteria 3689
625 Ga0501041_0151286 3300049577 Bacteria 1449
626 Ga0501042_0326152 3300049578 Bacteria 1109
627 Ga0501043_0023740 3300049579 Bacteria 4810
628 Ga0501043_0059264 3300049579 Bacteria 3004
629 Ga0501046_0016583 3300049580 Bacteria 6164
630 Ga0501046_0073691 3300049580 Bacteria 2649
631 Ga0501047_0009783 3300049581 Bacteria 9061
632 Ga0501047_0020624 3300049581 Bacteria 6328
633 Ga0501047_0030744 3300049581 Bacteria 5175
634 Ga0501047_0075517 3300049581 Bacteria 3243
635 Ga0501047_0301168 3300049581 Bacteria 1446
636 Ga0501048_0021788 3300049582 Bacteria 4690
637 Ga0501067_0208265 3300049583 Bacteria 1089
638 Ga0501068_0004498 3300049584 Bacteria 7589
639 Ga0501069_0007160 3300049585 Bacteria 5847
640 Ga0501069_0020196 3300049585 Bacteria 3607
641 Ga0501072_0038938 3300049588 Bacteria 3732
642 Ga0501072_0083846 3300049588 Bacteria 2527
643 Ga0501072_0146731 3300049588 Bacteria 1881
644 Ga0501073_0079872 3300049589 Bacteria 2276
645 Ga0501074_0035048 3300049590 Bacteria 3637
646 Ga0501075_0048078 3300049591 Bacteria 3206
647 Ga0501075_0136923 3300049591 Bacteria 1865
648 Ga0501075_0144331 3300049591 Bacteria 1814
649 Ga0501076_0019020 3300049592 Bacteria 5241
650 Ga0501076_0106700 3300049592 Bacteria 2261
651 Ga0501076_0202838 3300049592 Bacteria 1620
652 Ga0501077_0031050 3300049593 Bacteria 3399
653 Ga0501249_003203 3300049679 Unclassified 3295
654 Ga0501256_005441 3300049685 Bacteria 1122
655 Ga0501259_007145 3300049688 Bacteria 1785
656 Ga0501079_0035661 3300049741 Bacteria 3830
657 Ga0501079_0059519 3300049741 Bacteria 2946
658 Ga0501080_0001278 3300049742 Bacteria 20899
659 Ga0501080_0019896 3300049742 Bacteria 6216
660 Ga0501080_0064732 3300049742 Bacteria 3400
661 Ga0501080_0189296 3300049742 Bacteria 1891
662 Ga0501080_0246801 3300049742 Bacteria 1628
663 Ga0501081_0052128 3300049743 Bacteria 2822
664 Ga0501081_0122166 3300049743 Bacteria 1856
665 Ga0501081_0250693 3300049743 Bacteria 1292
666 Ga0501083_0035705 3300049744 Bacteria 3394
667 Ga0501083_0047336 3300049744 Bacteria 2905
668 Ga0501083_0088428 3300049744 Bacteria 2048
669 Ga0501035_0133107 3300049822 Bacteria 2166
670 Ga0501035_0207918 3300049822 Bacteria 1676
671 Ga0501035_0255713 3300049822 Bacteria 1486
672 Ga0501044_0023762 3300049823 Bacteria 6518
673 Ga0501044_0044285 3300049823 Bacteria 4618
674 Ga0501044_0162508 3300049823 Bacteria 2209
675 nmdc:mga05p37_580_c1 3300050507 Bacteria 40207
676 nmdc:mga09592_143903_c1 3300050508 Bacteria 2055
677 nmdc:mga09592_35717_c1 3300050508 Bacteria 4161
678 nmdc:mga09592_77562_c1 3300050508 Bacteria 2826
679 nmdc:mga0qj67_297747_c1 3300050509 Bacteria 1307
680 nmdc:mga0qj67_53394_c1 3300050509 Bacteria 3199
681 nmdc:mga06r32_19415_c1 3300050510 Bacteria 6238
682 nmdc:mga06r32_20507_c1 3300050510 Bacteria 6087
683 nmdc:mga06r32_277571_c1 3300050510 Bacteria 1663
684 nmdc:mga08y16_356467_c1 3300050511 Bacteria 1502
685 nmdc:mga0n895_10802_c1 3300050512 Bacteria 8102
686 nmdc:mga0n895_369018_c1 3300050512 Bacteria 1453
687 nmdc:mga0n895_95961_c1 3300050512 Bacteria 2970
688 nmdc:mga08x19_11195_c1 3300050514 Bacteria 5399
689 nmdc:mga08x19_33927_c1 3300050514 Bacteria 3223
690 Ga0495612_0030282 3300053078 Bacteria 2179
691 Ga0495619_0106758 3300053085 Bacteria 1910
692 Ga0500641_0006748 3300053096 Bacteria 4082
693 Ga0501084_0104401 3300054114 Bacteria 2380
694 Ga0501082_0009288 3300060353 Bacteria 8476
695 Ga0501082_0023603 3300060353 Bacteria 5305
696 Ga0501082_0062636 3300060353 Bacteria 3202
697 Ga0501082_0138667 3300060353 Bacteria 2111
698 Ga0501082_0317555 3300060353 Bacteria 1357
699 Ga0501082_0434138 3300060353 Bacteria 1147

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0286786 Ga0495604_0286786_19_855 272
2 3300006028 Ga0070717_10002009 Ga0070717_100020098 281
3 3300025933 Ga0207706_10409333 Ga0207706_104093332 281
4 3300006844 Ga0075428_100405643 Ga0075428_1004056432 282
5 3300009147 Ga0114129_10580631 Ga0114129_105806312 282
6 3300050508 nmdc:mga09592_143903_c1 nmdc:mga09592_143903_c1_876_1814 282
7 3300046690 Ga0495624_0243096 Ga0495624_0243096_38_904 286
8 3300007076 Ga0075435_100316686 Ga0075435_1003166861 287
9 3300026121 Ga0207683_10292163 Ga0207683_102921631 287
10 3300031995 Ga0307409_100295479 Ga0307409_1002954793 289
11 3300032004 Ga0307414_10004400 Ga0307414_100044005 289
12 3300049578 Ga0501042_0326152 Ga0501042_0326152_13_894 289
13 3300049568 Ga0501031_0108905 Ga0501031_0108905_181_1059 290
14 3300049576 Ga0501040_0141970 Ga0501040_0141970_406_1284 290
15 3300049577 Ga0501041_0151286 Ga0501041_0151286_417_1295 290
16 3300049588 Ga0501072_0083846 Ga0501072_0083846_369_1247 290
17 3300049590 Ga0501074_0035048 Ga0501074_0035048_2309_3187 290
18 3300049592 Ga0501076_0106700 Ga0501076_0106700_1034_1912 290
19 3300049741 Ga0501079_0035661 Ga0501079_0035661_1062_1940 290
20 3300049743 Ga0501081_0052128 Ga0501081_0052128_1341_2219 290
21 3300049743 Ga0501081_0250693 Ga0501081_0250693_359_1276 290
22 3300060353 Ga0501082_0062636 Ga0501082_0062636_965_1843 290
23 3300048918 Ga0496115_0049677 Ga0496115_0049677_189_1148 292
24 3300007265 Ga0099794_10056931 Ga0099794_100569312 293
25 3300027671 Ga0209588_1024375 Ga0209588_10243752 293
26 3300005327 Ga0070658_10076902 Ga0070658_100769022 295
27 3300005339 Ga0070660_100012266 Ga0070660_1000122662 295
28 3300005458 Ga0070681_10000441 Ga0070681_1000044114 295
29 3300005530 Ga0070679_100003023 Ga0070679_1000030236 295
30 3300005563 Ga0068855_100009276 Ga0068855_1000092761 295
31 3300005614 Ga0068856_100041063 Ga0068856_1000410632 295
32 3300009093 Ga0105240_10004420 Ga0105240_100044206 295
33 3300013102 Ga0157371_10013679 Ga0157371_100136793 295
34 3300013104 Ga0157370_10021792 Ga0157370_100217926 295
35 3300013105 Ga0157369_10046615 Ga0157369_100466152 295
36 3300013307 Ga0157372_10002875 Ga0157372_1000287513 295
37 3300025912 Ga0207707_10011352 Ga0207707_100113522 295
38 3300025917 Ga0207660_10010991 Ga0207660_100109916 295
39 3300025919 Ga0207657_10021277 Ga0207657_100212775 295
40 3300025921 Ga0207652_10009001 Ga0207652_100090016 295
41 3300025924 Ga0207694_10006757 Ga0207694_100067572 295
42 3300025949 Ga0207667_10000332 Ga0207667_1000033240 295
43 3300026078 Ga0207702_10109507 Ga0207702_101095071 295
44 3300026142 Ga0207698_10010253 Ga0207698_100102531 295
45 3300006237 Ga0097621_100117304 Ga0097621_1001173042 297
46 3300007788 Ga0099795_10002880 Ga0099795_100028803 297
47 3300010159 Ga0099796_10000303 Ga0099796_100003036 297
48 3300027512 Ga0209179_1003094 Ga0209179_10030942 297
49 3300036401 Ga0373937_0076033 Ga0373937_0076033_424_1335 297
50 3300049576 Ga0501040_0112675 Ga0501040_0112675_646_1587 297
51 3300049591 Ga0501075_0144331 Ga0501075_0144331_495_1436 297
52 3300049741 Ga0501079_0059519 Ga0501079_0059519_1550_2491 297
53 3300060353 Ga0501082_0434138 Ga0501082_0434138_76_1017 297
54 3300009094 Ga0111539_10185779 Ga0111539_101857792 298
55 3300009094 Ga0111539_10572655 Ga0111539_105726552 298
56 3300025932 Ga0207690_10050129 Ga0207690_100501293 298
57 3300027876 Ga0209974_10015189 Ga0209974_100151892 298
58 3300050511 nmdc:mga08y16_356467_c1 nmdc:mga08y16_356467_c1_159_1100 298
59 3300006847 Ga0075431_100039998 Ga0075431_1000399983 299
60 3300006880 Ga0075429_100026199 Ga0075429_1000261993 299
61 3300050508 nmdc:mga09592_77562_c1 nmdc:mga09592_77562_c1_799_1734 299
62 3300050510 nmdc:mga06r32_277571_c1 nmdc:mga06r32_277571_c1_175_1110 299
63 3300005336 Ga0070680_100115577 Ga0070680_1001155773 300
64 3300039438 Ga0436360_1020218 Ga0436360_1020218_1376_2284 300
65 3300005618 Ga0068864_100042025 Ga0068864_1000420252 301
66 3300035115 Ga0373941_0031698 Ga0373941_0031698_631_1566 301
67 3300035691 Ga0373931_0044005 Ga0373931_0044005_394_1329 301
68 3300048907 Ga0496104_0004692 Ga0496104_0004692_2732_3667 301
69 3300048911 Ga0496108_0185433 Ga0496108_0185433_202_1137 301
70 3300048912 Ga0496109_0011387 Ga0496109_0011387_4786_5721 301
71 3300048912 Ga0496109_0416476 Ga0496109_0416476_41_976 301
72 3300048913 Ga0496110_0033866 Ga0496110_0033866_193_1128 301
73 3300048914 Ga0496111_0210217 Ga0496111_0210217_98_1033 301
74 3300048915 Ga0496112_0000744 Ga0496112_0000744_14738_15673 301
75 3300048915 Ga0496112_0007979 Ga0496112_0007979_8384_9319 301
76 3300048916 Ga0496113_0000426 Ga0496113_0000426_15721_16656 301
77 3300048916 Ga0496113_0002320 Ga0496113_0002320_21_956 301
78 3300050512 nmdc:mga0n895_369018_c1 nmdc:mga0n895_369018_c1_340_1251 301
79 3300050514 nmdc:mga08x19_33927_c1 nmdc:mga08x19_33927_c1_1753_2664 301
80 3300005439 Ga0070711_100115374 Ga0070711_1001153742 302
81 3300048904 Ga0496101_0347576 Ga0496101_0347576_151_1086 302
82 3300048905 Ga0496102_0088833 Ga0496102_0088833_796_1731 302
83 3300048910 Ga0496107_0142294 Ga0496107_0142294_33_968 302
84 3300049744 Ga0501083_0047336 Ga0501083_0047336_526_1437 302
85 3300005435 Ga0070714_100166348 Ga0070714_1001663482 303
86 3300005458 Ga0070681_10001537 Ga0070681_1000153717 303
87 3300005458 Ga0070681_10074738 Ga0070681_100747382 303
88 3300005530 Ga0070679_100002960 Ga0070679_10000296011 303
89 3300005530 Ga0070679_100112648 Ga0070679_1001126482 303
90 3300005563 Ga0068855_100200751 Ga0068855_1002007512 303
91 3300005614 Ga0068856_100066505 Ga0068856_1000665053 303
92 3300006914 Ga0075436_100003059 Ga0075436_1000030598 303
93 3300009093 Ga0105240_10001183 Ga0105240_1000118331 303
94 3300009093 Ga0105240_10149863 Ga0105240_101498632 303
95 3300009174 Ga0105241_10298267 Ga0105241_102982672 303
96 3300009551 Ga0105238_10255264 Ga0105238_102552642 303
97 3300013104 Ga0157370_10016832 Ga0157370_100168325 303
98 3300013104 Ga0157370_10137098 Ga0157370_101370982 303
99 3300013105 Ga0157369_10015840 Ga0157369_100158402 303
100 3300013105 Ga0157369_10046333 Ga0157369_100463332 303
101 3300013307 Ga0157372_10005961 Ga0157372_100059614 303
102 3300013307 Ga0157372_10106849 Ga0157372_101068493 303
103 3300013307 Ga0157372_10308828 Ga0157372_103088282 303
104 3300025911 Ga0207654_10161682 Ga0207654_101616822 303
105 3300025912 Ga0207707_10000987 Ga0207707_1000098711 303
106 3300025912 Ga0207707_10094990 Ga0207707_100949902 303
107 3300025913 Ga0207695_10012862 Ga0207695_100128626 303
108 3300025913 Ga0207695_10038902 Ga0207695_100389022 303
109 3300025917 Ga0207660_10029149 Ga0207660_100291492 303
110 3300025921 Ga0207652_10008781 Ga0207652_100087815 303
111 3300025921 Ga0207652_10065911 Ga0207652_100659112 303
112 3300025921 Ga0207652_10169534 Ga0207652_101695342 303
113 3300025929 Ga0207664_10285312 Ga0207664_102853122 303
114 3300025981 Ga0207640_10232366 Ga0207640_102323662 303
115 3300026041 Ga0207639_10404686 Ga0207639_104046862 303
116 3300026078 Ga0207702_10201337 Ga0207702_102013372 303
117 3300050514 nmdc:mga08x19_11195_c1 nmdc:mga08x19_11195_c1_3450_4370 303
118 3300009545 Ga0105237_10025780 Ga0105237_100257801 304
119 3300025915 Ga0207693_10039760 Ga0207693_100397603 304
120 3300031711 Ga0265314_10001995 Ga0265314_1000199520 304
121 3300042876 Ga0451577_0000932 Ga0451577_0000932_3699_4622 304
122 3300044712 Ga0453684_0000577 Ga0453684_0000577_3628_4551 304
123 3300048905 Ga0496102_0360239 Ga0496102_0360239_73_1008 304
124 3300049581 Ga0501047_0075517 Ga0501047_0075517_720_1643 304
125 3300049742 Ga0501080_0189296 Ga0501080_0189296_643_1566 304
126 3300060353 Ga0501082_0317555 Ga0501082_0317555_287_1210 304
127 3300039093 Ga0400489_90906 Ga0400489_90906_175_1191 305
128 3300042876 Ga0451577_0003861 Ga0451577_0003861_3924_4853 305
129 3300049591 Ga0501075_0048078 Ga0501075_0048078_1857_2786 305
130 3300005436 Ga0070713_100490536 Ga0070713_1004905361 306
131 3300014326 Ga0157380_10288372 Ga0157380_102883721 306
132 3300035695 Ga0373927_0022906 Ga0373927_0022906_303_1250 306
133 3300039437 Ga0436365_0549141 Ga0436365_0549141_3159_4094 306
134 3300049583 Ga0501067_0208265 Ga0501067_0208265_16_942 306
135 3300049585 Ga0501069_0007160 Ga0501069_0007160_4909_5835 306
136 3300053096 Ga0500641_0006748 Ga0500641_0006748_319_1251 306
137 3300005329 Ga0070683_100044867 Ga0070683_1000448673 307
138 3300005436 Ga0070713_100111793 Ga0070713_1001117932 307
139 3300005439 Ga0070711_100038821 Ga0070711_1000388214 307
140 3300005458 Ga0070681_10205038 Ga0070681_102050382 307
141 3300005614 Ga0068856_100506229 Ga0068856_1005062292 307
142 3300005617 Ga0068859_100298922 Ga0068859_1002989222 307
143 3300005842 Ga0068858_100076781 Ga0068858_1000767813 307
144 3300006358 Ga0068871_100098532 Ga0068871_1000985321 307
145 3300006931 Ga0097620_100298939 Ga0097620_1002989392 307
146 3300009093 Ga0105240_10218330 Ga0105240_102183302 307
147 3300009177 Ga0105248_10143817 Ga0105248_101438173 307
148 3300020070 Ga0206356_11887767 Ga0206356_118877673 307
149 3300025906 Ga0207699_10056091 Ga0207699_100560912 307
150 3300025913 Ga0207695_10156207 Ga0207695_101562072 307
151 3300025916 Ga0207663_10048605 Ga0207663_100486052 307
152 3300025933 Ga0207706_10435923 Ga0207706_104359231 307
153 3300025941 Ga0207711_10380149 Ga0207711_103801492 307
154 3300025944 Ga0207661_10043381 Ga0207661_100433812 307
155 3300026035 Ga0207703_10212200 Ga0207703_102122002 307
156 3300026078 Ga0207702_10121746 Ga0207702_101217462 307
157 3300031595 Ga0265313_10007313 Ga0265313_100073134 307
158 3300035083 Ga0373926_0013943 Ga0373926_0013943_413_1363 307
159 3300035089 Ga0373944_0002300 Ga0373944_0002300_816_1766 307
160 3300035113 Ga0373936_0028798 Ga0373936_0028798_58_1008 307
161 3300035116 Ga0373945_0010724 Ga0373945_0010724_992_1942 307
162 3300035170 Ga0373943_0005645 Ga0373943_0005645_4143_5093 307
163 3300035171 Ga0373946_0005284 Ga0373946_0005284_3603_4553 307
164 3300035172 Ga0373955_0109328 Ga0373955_0109328_481_1410 307
165 3300035695 Ga0373927_0002599 Ga0373927_0002599_9203_10153 307
166 3300035725 Ga0373947_0000975 Ga0373947_0000975_16146_17096 307
167 3300037068 Ga0373925_0001709 Ga0373925_0001709_1219_2169 307
168 3300046455 Ga0495603_0002024 Ga0495603_0002024_5828_6778 307
169 3300046459 Ga0495629_0003783 Ga0495629_0003783_6703_7653 307
170 3300046461 Ga0495641_0051079 Ga0495641_0051079_33_983 307
171 3300046473 Ga0495582_0003153 Ga0495582_0003153_383_1333 307
172 3300046475 Ga0495639_0000175 Ga0495639_0000175_20619_21569 307
173 3300046517 Ga0495630_0005659 Ga0495630_0005659_6343_7293 307
174 3300046529 Ga0495652_0024887 Ga0495652_0024887_3452_4381 307
175 3300046531 Ga0495665_0000126 Ga0495665_0000126_34648_35598 307
176 3300046536 Ga0495587_0073191 Ga0495587_0073191_508_1437 307
177 3300046674 Ga0495588_0000742 Ga0495588_0000742_3129_4079 307
178 3300046678 Ga0495599_0002944 Ga0495599_0002944_7160_8089 307
179 3300046683 Ga0495658_0000622 Ga0495658_0000622_16146_17096 307
180 3300047315 Ga0495581_0003733 Ga0495581_0003733_4950_5900 307
181 3300047444 Ga0495675_0226708 Ga0495675_0226708_105_1034 307
182 3300047471 Ga0495684_0157293 Ga0495684_0157293_677_1612 307
183 3300047673 Ga0495593_0000199 Ga0495593_0000199_28090_29040 307
184 3300048089 Ga0495614_0007404 Ga0495614_0007404_937_1887 307
185 3300005328 Ga0070676_10009702 Ga0070676_100097024 308
186 3300005334 Ga0068869_100023516 Ga0068869_1000235162 308
187 3300005339 Ga0070660_100074586 Ga0070660_1000745862 308
188 3300005341 Ga0070691_10036564 Ga0070691_100365642 308
189 3300005347 Ga0070668_100071010 Ga0070668_1000710102 308
190 3300005356 Ga0070674_100003280 Ga0070674_1000032803 308
191 3300005367 Ga0070667_100144405 Ga0070667_1001444051 308
192 3300005435 Ga0070714_100012757 Ga0070714_1000127575 308
193 3300005436 Ga0070713_100015995 Ga0070713_1000159953 308
194 3300005440 Ga0070705_100003221 Ga0070705_1000032216 308
195 3300005444 Ga0070694_100054221 Ga0070694_1000542211 308
196 3300005444 Ga0070694_100085911 Ga0070694_1000859112 308
197 3300005455 Ga0070663_100334758 Ga0070663_1003347582 308
198 3300005456 Ga0070678_100003224 Ga0070678_1000032242 308
199 3300005457 Ga0070662_100003892 Ga0070662_10000389210 308
200 3300005458 Ga0070681_10004802 Ga0070681_100048022 308
201 3300005459 Ga0068867_100000309 Ga0068867_10000030918 308
202 3300005530 Ga0070679_100049650 Ga0070679_1000496503 308
203 3300005539 Ga0068853_100262910 Ga0068853_1002629103 308
204 3300005545 Ga0070695_100003895 Ga0070695_1000038953 308
205 3300005546 Ga0070696_100010195 Ga0070696_1000101955 308
206 3300005547 Ga0070693_100001942 Ga0070693_1000019427 308
207 3300005548 Ga0070665_100133396 Ga0070665_1001333962 308
208 3300005578 Ga0068854_100000233 Ga0068854_10000023310 308
209 3300005614 Ga0068856_100372998 Ga0068856_1003729981 308
210 3300005615 Ga0070702_100005809 Ga0070702_1000058095 308
211 3300005718 Ga0068866_10007873 Ga0068866_100078734 308
212 3300005719 Ga0068861_100032981 Ga0068861_1000329812 308
213 3300005843 Ga0068860_100001540 Ga0068860_10000154015 308
214 3300006358 Ga0068871_100099279 Ga0068871_1000992792 308
215 3300006881 Ga0068865_100000964 Ga0068865_1000009644 308
216 3300009147 Ga0114129_10008737 Ga0114129_1000873713 308
217 3300009148 Ga0105243_10000865 Ga0105243_100008652 308
218 3300009174 Ga0105241_10178866 Ga0105241_101788663 308
219 3300009176 Ga0105242_10002781 Ga0105242_1000278112 308
220 3300009553 Ga0105249_10028228 Ga0105249_100282284 308
221 3300010375 Ga0105239_10011224 Ga0105239_100112247 308
222 3300013297 Ga0157378_10001261 Ga0157378_1000126121 308
223 3300013306 Ga0163162_10035542 Ga0163162_100355422 308
224 3300013307 Ga0157372_10412047 Ga0157372_104120472 308
225 3300013308 Ga0157375_10097572 Ga0157375_100975724 308
226 3300017792 Ga0163161_10015790 Ga0163161_100157905 308
227 3300025907 Ga0207645_10005052 Ga0207645_1000505212 308
228 3300025911 Ga0207654_10172260 Ga0207654_101722602 308
229 3300025912 Ga0207707_10002760 Ga0207707_1000276010 308
230 3300025921 Ga0207652_10471015 Ga0207652_104710152 308
231 3300025928 Ga0207700_10054190 Ga0207700_100541902 308
232 3300025929 Ga0207664_10062105 Ga0207664_100621052 308
233 3300025933 Ga0207706_10000005 Ga0207706_10000005159 308
234 3300025934 Ga0207686_10000123 Ga0207686_1000012335 308
235 3300025935 Ga0207709_10001959 Ga0207709_100019597 308
236 3300025937 Ga0207669_10002038 Ga0207669_100020384 308
237 3300025938 Ga0207704_10001280 Ga0207704_1000128010 308
238 3300025942 Ga0207689_10005606 Ga0207689_100056064 308
239 3300025972 Ga0207668_10027060 Ga0207668_100270603 308
240 3300025981 Ga0207640_10000870 Ga0207640_100008702 308
241 3300025986 Ga0207658_10054755 Ga0207658_100547553 308
242 3300026035 Ga0207703_10145025 Ga0207703_101450252 308
243 3300026067 Ga0207678_10354848 Ga0207678_103548482 308
244 3300026089 Ga0207648_10000008 Ga0207648_10000008121 308
245 3300026118 Ga0207675_100049160 Ga0207675_1000491602 308
246 3300026121 Ga0207683_10009983 Ga0207683_100099838 308
247 3300027671 Ga0209588_1028027 Ga0209588_10280272 308
248 3300028379 Ga0268266_10096961 Ga0268266_100969612 308
249 3300031249 Ga0265339_10000457 Ga0265339_1000045717 308
250 3300031548 Ga0307408_100359729 Ga0307408_1003597292 308
251 3300031712 Ga0265342_10006082 Ga0265342_100060824 308
252 3300031852 Ga0307410_10276514 Ga0307410_102765141 308
253 3300031911 Ga0307412_10237809 Ga0307412_102378091 308
254 3300032002 Ga0307416_100089039 Ga0307416_1000890393 308
255 3300032126 Ga0307415_100204440 Ga0307415_1002044402 308
256 3300039447 Ga0436361_0745744 Ga0436361_0745744_200_1150 308
257 3300048903 Ga0496100_0071551 Ga0496100_0071551_927_1859 308
258 3300048904 Ga0496101_0311079 Ga0496101_0311079_274_1206 308
259 3300048909 Ga0496106_0042683 Ga0496106_0042683_1182_2114 308
260 3300048917 Ga0496114_0249901 Ga0496114_0249901_98_1030 308
261 3300048918 Ga0496115_0081763 Ga0496115_0081763_531_1481 308
262 3300049570 Ga0501033_0250363 Ga0501033_0250363_126_1061 308
263 3300049572 Ga0501036_0020992 Ga0501036_0020992_1479_2420 308
264 3300049577 Ga0501041_0023604 Ga0501041_0023604_1481_2422 308
265 3300049588 Ga0501072_0146731 Ga0501072_0146731_375_1316 308
266 3300049592 Ga0501076_0019020 Ga0501076_0019020_4095_5036 308
267 3300049592 Ga0501076_0202838 Ga0501076_0202838_32_967 308
268 3300049742 Ga0501080_0246801 Ga0501080_0246801_540_1481 308
269 3300049822 Ga0501035_0207918 Ga0501035_0207918_167_1102 308
270 3300050507 nmdc:mga05p37_580_c1 nmdc:mga05p37_580_c1_36727_37677 308
271 3300050512 nmdc:mga0n895_95961_c1 nmdc:mga0n895_95961_c1_173_1111 308
272 3300005334 Ga0068869_100214756 Ga0068869_1002147562 309
273 3300005355 Ga0070671_100001564 Ga0070671_1000015642 309
274 3300005459 Ga0068867_100103844 Ga0068867_1001038442 309
275 3300005518 Ga0070699_100009238 Ga0070699_1000092386 309
276 3300005536 Ga0070697_100012402 Ga0070697_1000124023 309
277 3300005546 Ga0070696_100012252 Ga0070696_1000122526 309
278 3300005549 Ga0070704_100031426 Ga0070704_1000314263 309
279 3300005549 Ga0070704_100204006 Ga0070704_1002040062 309
280 3300005719 Ga0068861_100232516 Ga0068861_1002325162 309
281 3300006852 Ga0075433_10070382 Ga0075433_100703822 309
282 3300006871 Ga0075434_100023568 Ga0075434_1000235685 309
283 3300006881 Ga0068865_100071845 Ga0068865_1000718452 309
284 3300006914 Ga0075436_100017485 Ga0075436_1000174852 309
285 3300009093 Ga0105240_10358815 Ga0105240_103588151 309
286 3300009148 Ga0105243_10013671 Ga0105243_100136714 309
287 3300025935 Ga0207709_10101568 Ga0207709_101015682 309
288 3300025938 Ga0207704_10214283 Ga0207704_102142832 309
289 3300026023 Ga0207677_10131340 Ga0207677_101313402 309
290 3300026118 Ga0207675_100278659 Ga0207675_1002786592 309
291 3300028653 Ga0265323_10000932 Ga0265323_1000093212 309
292 3300031852 Ga0307410_10040015 Ga0307410_100400153 309
293 3300031903 Ga0307407_10142808 Ga0307407_101428082 309
294 3300031995 Ga0307409_100053537 Ga0307409_1000535373 309
295 3300035170 Ga0373943_0044694 Ga0373943_0044694_1091_2032 309
296 3300035725 Ga0373947_0086905 Ga0373947_0086905_65_1006 309
297 3300042012 Ga0439455_0004315 Ga0439455_0004315_1802_2737 309
298 3300042147 Ga0450910_011487 Ga0450910_011487_102_1061 309
299 3300046473 Ga0495582_0059121 Ga0495582_0059121_640_1581 309
300 3300047315 Ga0495581_0117810 Ga0495581_0117810_581_1522 309
301 3300048905 Ga0496102_0198903 Ga0496102_0198903_650_1585 309
302 3300048906 Ga0496103_0270881 Ga0496103_0270881_47_982 309
303 3300005329 Ga0070683_100000497 Ga0070683_10000049715 310
304 3300005336 Ga0070680_100064868 Ga0070680_1000648682 310
305 3300005336 Ga0070680_100458440 Ga0070680_1004584401 310
306 3300005339 Ga0070660_100034793 Ga0070660_1000347932 310
307 3300005341 Ga0070691_10004603 Ga0070691_100046033 310
308 3300005436 Ga0070713_100069771 Ga0070713_1000697711 310
309 3300005440 Ga0070705_100036336 Ga0070705_1000363362 310
310 3300005457 Ga0070662_100254748 Ga0070662_1002547482 310
311 3300005530 Ga0070679_100001789 Ga0070679_1000017894 310
312 3300005535 Ga0070684_100002594 Ga0070684_1000025942 310
313 3300005535 Ga0070684_100093560 Ga0070684_1000935602 310
314 3300005535 Ga0070684_100340789 Ga0070684_1003407891 310
315 3300005539 Ga0068853_100043338 Ga0068853_1000433384 310
316 3300005539 Ga0068853_100370414 Ga0068853_1003704141 310
317 3300005545 Ga0070695_100064259 Ga0070695_1000642592 310
318 3300005546 Ga0070696_100064549 Ga0070696_1000645492 310
319 3300005547 Ga0070693_100096630 Ga0070693_1000966302 310
320 3300005549 Ga0070704_100016010 Ga0070704_1000160106 310
321 3300005563 Ga0068855_100040881 Ga0068855_1000408815 310
322 3300005564 Ga0070664_100272772 Ga0070664_1002727722 310
323 3300005577 Ga0068857_100001612 Ga0068857_10000161211 310
324 3300005577 Ga0068857_100049444 Ga0068857_1000494444 310
325 3300005614 Ga0068856_100004846 Ga0068856_10000484614 310
326 3300005842 Ga0068858_100005708 Ga0068858_1000057089 310
327 3300006844 Ga0075428_100060430 Ga0075428_1000604302 310
328 3300006847 Ga0075431_100017316 Ga0075431_1000173166 310
329 3300006871 Ga0075434_100015810 Ga0075434_1000158106 310
330 3300006880 Ga0075429_100033910 Ga0075429_1000339104 310
331 3300009093 Ga0105240_10001383 Ga0105240_1000138326 310
332 3300009093 Ga0105240_10010543 Ga0105240_1001054312 310
333 3300009098 Ga0105245_10064625 Ga0105245_100646253 310
334 3300009098 Ga0105245_10237463 Ga0105245_102374631 310
335 3300009101 Ga0105247_10173112 Ga0105247_101731122 310
336 3300009147 Ga0114129_10008584 Ga0114129_100085847 310
337 3300009147 Ga0114129_10439525 Ga0114129_104395252 310
338 3300009148 Ga0105243_10370596 Ga0105243_103705962 310
339 3300009174 Ga0105241_10007408 Ga0105241_100074088 310
340 3300009177 Ga0105248_10020812 Ga0105248_100208124 310
341 3300009545 Ga0105237_10004190 Ga0105237_100041905 310
342 3300009551 Ga0105238_10002578 Ga0105238_1000257814 310
343 3300009551 Ga0105238_10005105 Ga0105238_1000510512 310
344 3300009551 Ga0105238_10024186 Ga0105238_100241864 310
345 3300009553 Ga0105249_10007387 Ga0105249_100073879 310
346 3300010375 Ga0105239_10006055 Ga0105239_1000605511 310
347 3300010375 Ga0105239_10048978 Ga0105239_100489782 310
348 3300011119 Ga0105246_10013968 Ga0105246_100139684 310
349 3300011119 Ga0105246_10062783 Ga0105246_100627832 310
350 3300013104 Ga0157370_10034818 Ga0157370_100348182 310
351 3300013104 Ga0157370_10252085 Ga0157370_102520852 310
352 3300013105 Ga0157369_10004665 Ga0157369_100046654 310
353 3300013297 Ga0157378_10324634 Ga0157378_103246342 310
354 3300013307 Ga0157372_10008909 Ga0157372_100089098 310
355 3300013307 Ga0157372_10011183 Ga0157372_100111839 310
356 3300013308 Ga0157375_10016710 Ga0157375_100167102 310
357 3300014969 Ga0157376_10252739 Ga0157376_102527392 310
358 3300025910 Ga0207684_10251547 Ga0207684_102515472 310
359 3300025911 Ga0207654_10015545 Ga0207654_100155452 310
360 3300025912 Ga0207707_10002717 Ga0207707_100027172 310
361 3300025913 Ga0207695_10003003 Ga0207695_1000300313 310
362 3300025913 Ga0207695_10015372 Ga0207695_100153728 310
363 3300025914 Ga0207671_10265384 Ga0207671_102653842 310
364 3300025916 Ga0207663_10024305 Ga0207663_100243052 310
365 3300025917 Ga0207660_10006741 Ga0207660_100067412 310
366 3300025919 Ga0207657_10057745 Ga0207657_100577454 310
367 3300025921 Ga0207652_10001801 Ga0207652_100018015 310
368 3300025922 Ga0207646_10123495 Ga0207646_101234952 310
369 3300025924 Ga0207694_10003089 Ga0207694_100030892 310
370 3300025924 Ga0207694_10005174 Ga0207694_100051746 310
371 3300025924 Ga0207694_10007780 Ga0207694_100077805 310
372 3300025927 Ga0207687_10032394 Ga0207687_100323942 310
373 3300025927 Ga0207687_10213504 Ga0207687_102135041 310
374 3300025928 Ga0207700_10041874 Ga0207700_100418742 310
375 3300025933 Ga0207706_10266169 Ga0207706_102661692 310
376 3300025941 Ga0207711_10001497 Ga0207711_1000149710 310
377 3300025942 Ga0207689_10065388 Ga0207689_100653882 310
378 3300025944 Ga0207661_10032308 Ga0207661_100323082 310
379 3300025944 Ga0207661_10069894 Ga0207661_100698942 310
380 3300025944 Ga0207661_10198862 Ga0207661_101988622 310
381 3300025949 Ga0207667_10005708 Ga0207667_1000570814 310
382 3300025961 Ga0207712_10005953 Ga0207712_100059532 310
383 3300026035 Ga0207703_10002747 Ga0207703_100027476 310
384 3300026041 Ga0207639_10074665 Ga0207639_100746651 310
385 3300026078 Ga0207702_10004800 Ga0207702_100048004 310
386 3300026116 Ga0207674_10000300 Ga0207674_1000030034 310
387 3300026116 Ga0207674_10002379 Ga0207674_100023799 310
388 3300027682 Ga0209971_1019249 Ga0209971_10192492 310
389 3300028016 Ga0265354_1000189 Ga0265354_10001893 310
390 3300028666 Ga0265336_10001161 Ga0265336_100011618 310
391 3300030878 Ga0265770_1003323 Ga0265770_10033231 310
392 3300031090 Ga0265760_10002519 Ga0265760_100025192 310
393 3300031250 Ga0265331_10015412 Ga0265331_100154122 310
394 3300031344 Ga0265316_10033866 Ga0265316_100338662 310
395 3300031711 Ga0265314_10007657 Ga0265314_100076574 310
396 3300031711 Ga0265314_10013305 Ga0265314_100133052 310
397 3300035111 Ga0373923_0012458 Ga0373923_0012458_261_1199 310
398 3300035117 Ga0373953_0015245 Ga0373953_0015245_852_1790 310
399 3300035118 Ga0373954_0022191 Ga0373954_0022191_567_1505 310
400 3300035118 Ga0373954_0044644 Ga0373954_0044644_324_1262 310
401 3300035118 Ga0373954_0092125 Ga0373954_0092125_239_1183 310
402 3300035120 Ga0373957_0039068 Ga0373957_0039068_143_1081 310
403 3300035172 Ga0373955_0037364 Ga0373955_0037364_1470_2408 310
404 3300035695 Ga0373927_0003663 Ga0373927_0003663_8169_9110 310
405 3300035695 Ga0373927_0017817 Ga0373927_0017817_3550_4494 310
406 3300035724 Ga0373933_0013032 Ga0373933_0013032_855_1793 310
407 3300035724 Ga0373933_0031506 Ga0373933_0031506_580_1518 310
408 3300035725 Ga0373947_0103620 Ga0373947_0103620_761_1699 310
409 3300035725 Ga0373947_0195993 Ga0373947_0195993_293_1231 310
410 3300036401 Ga0373937_0009964 Ga0373937_0009964_683_1621 310
411 3300036401 Ga0373937_0036661 Ga0373937_0036661_2767_3705 310
412 3300036401 Ga0373937_0108009 Ga0373937_0108009_1102_2040 310
413 3300037068 Ga0373925_0017306 Ga0373925_0017306_1625_2563 310
414 3300037853 Ga0436364_1031302 Ga0436364_1031302_781_1725 310
415 3300039437 Ga0436365_1319592 Ga0436365_1319592_1360_2304 310
416 3300046459 Ga0495629_0265239 Ga0495629_0265239_209_1147 310
417 3300046462 Ga0495651_0000096 Ga0495651_0000096_50276_51220 310
418 3300046462 Ga0495651_0000672 Ga0495651_0000672_14590_15534 310
419 3300046463 Ga0495653_0046413 Ga0495653_0046413_1594_2538 310
420 3300046463 Ga0495653_0084832 Ga0495653_0084832_74_1018 310
421 3300046472 Ga0495580_0115609 Ga0495580_0115609_650_1588 310
422 3300046473 Ga0495582_0003312 Ga0495582_0003312_1131_2069 310
423 3300046475 Ga0495639_0073206 Ga0495639_0073206_229_1167 310
424 3300046511 Ga0495608_0006128 Ga0495608_0006128_5116_6060 310
425 3300046511 Ga0495608_0034153 Ga0495608_0034153_823_1767 310
426 3300046511 Ga0495608_0081488 Ga0495608_0081488_995_1939 310
427 3300046514 Ga0495618_0087101 Ga0495618_0087101_320_1264 310
428 3300046516 Ga0495628_0002142 Ga0495628_0002142_9034_9978 310
429 3300046516 Ga0495628_0021894 Ga0495628_0021894_266_1210 310
430 3300046516 Ga0495628_0090695 Ga0495628_0090695_1314_2258 310
431 3300046516 Ga0495628_0115180 Ga0495628_0115180_934_1872 310
432 3300046517 Ga0495630_0039106 Ga0495630_0039106_880_1824 310
433 3300046517 Ga0495630_0046284 Ga0495630_0046284_1186_2130 310
434 3300046517 Ga0495630_0190852 Ga0495630_0190852_142_1086 310
435 3300046529 Ga0495652_0008631 Ga0495652_0008631_1127_2071 310
436 3300046529 Ga0495652_0138416 Ga0495652_0138416_886_1830 310
437 3300046531 Ga0495665_0045001 Ga0495665_0045001_1314_2258 310
438 3300046535 Ga0495586_0030050 Ga0495586_0030050_65_1003 310
439 3300046535 Ga0495586_0196439 Ga0495586_0196439_20_964 310
440 3300046536 Ga0495587_0023206 Ga0495587_0023206_1778_2722 310
441 3300046536 Ga0495587_0148852 Ga0495587_0148852_134_1078 310
442 3300046543 Ga0495645_0079964 Ga0495645_0079964_1368_2312 310
443 3300046543 Ga0495645_0088352 Ga0495645_0088352_41_985 310
444 3300046559 Ga0495667_0001699 Ga0495667_0001699_12398_13342 310
445 3300046559 Ga0495667_0049766 Ga0495667_0049766_1674_2618 310
446 3300046642 Ga0495634_0025120 Ga0495634_0025120_2176_3114 310
447 3300046663 Ga0495635_0016425 Ga0495635_0016425_104_1048 310
448 3300046675 Ga0495657_0005455 Ga0495657_0005455_9046_9990 310
449 3300046675 Ga0495657_0041352 Ga0495657_0041352_509_1453 310
450 3300046675 Ga0495657_0191163 Ga0495657_0191163_273_1211 310
451 3300046678 Ga0495599_0003824 Ga0495599_0003824_4639_5583 310
452 3300046679 Ga0495623_0018113 Ga0495623_0018113_2335_3279 310
453 3300046679 Ga0495623_0156108 Ga0495623_0156108_318_1256 310
454 3300046680 Ga0495646_0004263 Ga0495646_0004263_7943_8887 310
455 3300046689 Ga0495613_0120053 Ga0495613_0120053_357_1295 310
456 3300046689 Ga0495613_0185380 Ga0495613_0185380_46_984 310
457 3300046690 Ga0495624_0209542 Ga0495624_0209542_165_1109 310
458 3300046809 Ga0495600_0043815 Ga0495600_0043815_1195_2139 310
459 3300047317 Ga0495604_0002583 Ga0495604_0002583_6049_6993 310
460 3300047317 Ga0495604_0005994 Ga0495604_0005994_8329_9273 310
461 3300047317 Ga0495604_0172479 Ga0495604_0172479_464_1402 310
462 3300047319 Ga0495674_0009734 Ga0495674_0009734_7627_8571 310
463 3300047319 Ga0495674_0049256 Ga0495674_0049256_2730_3674 310
464 3300047319 Ga0495674_0087608 Ga0495674_0087608_1079_2023 310
465 3300047319 Ga0495674_0316798 Ga0495674_0316798_196_1140 310
466 3300047319 Ga0495674_0355722 Ga0495674_0355722_127_1065 310
467 3300047322 Ga0495680_0000034 Ga0495680_0000034_80494_81438 310
468 3300047322 Ga0495680_0039538 Ga0495680_0039538_1080_2024 310
469 3300047444 Ga0495675_0001342 Ga0495675_0001342_5344_6288 310
470 3300047444 Ga0495675_0045131 Ga0495675_0045131_1247_2191 310
471 3300047444 Ga0495675_0109537 Ga0495675_0109537_740_1684 310
472 3300047444 Ga0495675_0115711 Ga0495675_0115711_235_1179 310
473 3300047444 Ga0495675_0187021 Ga0495675_0187021_235_1179 310
474 3300047471 Ga0495684_0000646 Ga0495684_0000646_15596_16540 310
475 3300047471 Ga0495684_0004482 Ga0495684_0004482_8279_9217 310
476 3300047471 Ga0495684_0032650 Ga0495684_0032650_973_1917 310
477 3300047471 Ga0495684_0201423 Ga0495684_0201423_408_1352 310
478 3300047673 Ga0495593_0068308 Ga0495593_0068308_105_1049 310
479 3300048088 Ga0495602_0124710 Ga0495602_0124710_713_1657 310
480 3300048905 Ga0496102_0062017 Ga0496102_0062017_295_1233 310
481 3300048907 Ga0496104_0018077 Ga0496104_0018077_5392_6330 310
482 3300048907 Ga0496104_0041304 Ga0496104_0041304_2418_3356 310
483 3300048908 Ga0496105_0044598 Ga0496105_0044598_2662_3600 310
484 3300048909 Ga0496106_0083072 Ga0496106_0083072_1028_1966 310
485 3300048911 Ga0496108_0010855 Ga0496108_0010855_4843_5781 310
486 3300048911 Ga0496108_0154035 Ga0496108_0154035_455_1393 310
487 3300048915 Ga0496112_0009902 Ga0496112_0009902_615_1553 310
488 3300048915 Ga0496112_0047615 Ga0496112_0047615_347_1285 310
489 3300048915 Ga0496112_0144641 Ga0496112_0144641_153_1097 310
490 3300048916 Ga0496113_0233477 Ga0496113_0233477_425_1363 310
491 3300050508 nmdc:mga09592_35717_c1 nmdc:mga09592_35717_c1_3113_4051 310
492 3300050509 nmdc:mga0qj67_297747_c1 nmdc:mga0qj67_297747_c1_350_1294 310
493 3300050510 nmdc:mga06r32_20507_c1 nmdc:mga06r32_20507_c1_3908_4846 310
494 3300050512 nmdc:mga0n895_10802_c1 nmdc:mga0n895_10802_c1_1725_2663 310
495 3300053078 Ga0495612_0030282 Ga0495612_0030282_118_1062 310
496 3300053085 Ga0495619_0106758 Ga0495619_0106758_754_1692 310
497 3300005329 Ga0070683_100097786 Ga0070683_1000977862 311
498 3300005340 Ga0070689_100068427 Ga0070689_1000684272 311
499 3300005343 Ga0070687_100023150 Ga0070687_1000231502 311
500 3300005353 Ga0070669_100001748 Ga0070669_1000017487 311
501 3300005354 Ga0070675_100005979 Ga0070675_1000059796 311
502 3300005354 Ga0070675_100132673 Ga0070675_1001326732 311
503 3300005355 Ga0070671_100072473 Ga0070671_1000724732 311
504 3300005364 Ga0070673_100059007 Ga0070673_1000590074 311
505 3300005364 Ga0070673_100189298 Ga0070673_1001892982 311
506 3300005366 Ga0070659_100025518 Ga0070659_1000255184 311
507 3300005457 Ga0070662_100147286 Ga0070662_1001472862 311
508 3300005466 Ga0070685_10009147 Ga0070685_100091474 311
509 3300005535 Ga0070684_100016923 Ga0070684_1000169236 311
510 3300005543 Ga0070672_100073195 Ga0070672_1000731952 311
511 3300005564 Ga0070664_100376321 Ga0070664_1003763212 311
512 3300005617 Ga0068859_100077697 Ga0068859_1000776972 311
513 3300005618 Ga0068864_100431062 Ga0068864_1004310622 311
514 3300005937 Ga0081455_10030790 Ga0081455_100307902 311
515 3300006847 Ga0075431_100013860 Ga0075431_1000138606 311
516 3300006931 Ga0097620_100077697 Ga0097620_1000776972 311
517 3300009147 Ga0114129_10401377 Ga0114129_104013771 311
518 3300009147 Ga0114129_10647649 Ga0114129_106476491 311
519 3300009177 Ga0105248_10000002 Ga0105248_10000002856 311
520 3300009177 Ga0105248_10089389 Ga0105248_100893893 311
521 3300010375 Ga0105239_10383989 Ga0105239_103839892 311
522 3300013296 Ga0157374_10032820 Ga0157374_100328202 311
523 3300013308 Ga0157375_10012857 Ga0157375_100128576 311
524 3300014326 Ga0157380_10251812 Ga0157380_102518122 311
525 3300025908 Ga0207643_10001129 Ga0207643_100011292 311
526 3300025912 Ga0207707_10031722 Ga0207707_100317223 311
527 3300025918 Ga0207662_10013560 Ga0207662_100135602 311
528 3300025920 Ga0207649_10031377 Ga0207649_100313773 311
529 3300025920 Ga0207649_10163862 Ga0207649_101638622 311
530 3300025923 Ga0207681_10013396 Ga0207681_100133964 311
531 3300025926 Ga0207659_10011148 Ga0207659_100111486 311
532 3300025932 Ga0207690_10038767 Ga0207690_100387672 311
533 3300025933 Ga0207706_10016085 Ga0207706_100160852 311
534 3300025940 Ga0207691_10113308 Ga0207691_101133083 311
535 3300025941 Ga0207711_10000842 Ga0207711_100008426 311
536 3300025944 Ga0207661_10150472 Ga0207661_101504722 311
537 3300025945 Ga0207679_10013030 Ga0207679_100130302 311
538 3300026067 Ga0207678_10072069 Ga0207678_100720692 311
539 3300026078 Ga0207702_10028305 Ga0207702_100283056 311
540 3300026116 Ga0207674_10007051 Ga0207674_100070517 311
541 3300028577 Ga0265318_10011338 Ga0265318_100113382 311
542 3300028800 Ga0265338_10024486 Ga0265338_100244866 311
543 3300028800 Ga0265338_10039023 Ga0265338_100390231 311
544 3300028800 Ga0265338_10039150 Ga0265338_100391504 311
545 3300028800 Ga0265338_10056370 Ga0265338_100563703 311
546 3300031235 Ga0265330_10004148 Ga0265330_100041488 311
547 3300031235 Ga0265330_10009553 Ga0265330_100095533 311
548 3300031235 Ga0265330_10026239 Ga0265330_100262392 311
549 3300031240 Ga0265320_10022135 Ga0265320_100221352 311
550 3300031241 Ga0265325_10013390 Ga0265325_100133903 311
551 3300031247 Ga0265340_10026021 Ga0265340_100260212 311
552 3300031249 Ga0265339_10000474 Ga0265339_1000047415 311
553 3300031249 Ga0265339_10069814 Ga0265339_100698142 311
554 3300031344 Ga0265316_10001044 Ga0265316_100010442 311
555 3300031344 Ga0265316_10012825 Ga0265316_100128256 311
556 3300031344 Ga0265316_10017055 Ga0265316_100170553 311
557 3300031344 Ga0265316_10084425 Ga0265316_100844252 311
558 3300031548 Ga0307408_100028718 Ga0307408_1000287183 311
559 3300031548 Ga0307408_100514742 Ga0307408_1005147422 311
560 3300031595 Ga0265313_10009170 Ga0265313_100091702 311
561 3300031595 Ga0265313_10046341 Ga0265313_100463412 311
562 3300031711 Ga0265314_10000261 Ga0265314_1000026134 311
563 3300031711 Ga0265314_10016081 Ga0265314_100160813 311
564 3300031711 Ga0265314_10148423 Ga0265314_101484232 311
565 3300031712 Ga0265342_10001022 Ga0265342_1000102213 311
566 3300031712 Ga0265342_10051431 Ga0265342_100514313 311
567 3300031731 Ga0307405_10012382 Ga0307405_100123823 311
568 3300031731 Ga0307405_10028517 Ga0307405_100285173 311
569 3300031852 Ga0307410_10000285 Ga0307410_1000028528 311
570 3300031901 Ga0307406_10070480 Ga0307406_100704802 311
571 3300031903 Ga0307407_10006354 Ga0307407_100063543 311
572 3300031911 Ga0307412_10075856 Ga0307412_100758563 311
573 3300031995 Ga0307409_100026816 Ga0307409_1000268163 311
574 3300031995 Ga0307409_100040386 Ga0307409_1000403862 311
575 3300032002 Ga0307416_100005552 Ga0307416_1000055524 311
576 3300032002 Ga0307416_100035999 Ga0307416_1000359993 311
577 3300032004 Ga0307414_10117335 Ga0307414_101173353 311
578 3300032005 Ga0307411_10107604 Ga0307411_101076043 311
579 3300032005 Ga0307411_10189400 Ga0307411_101894002 311
580 3300032126 Ga0307415_100039686 Ga0307415_1000396863 311
581 3300047319 Ga0495674_0256193 Ga0495674_0256193_128_1117 311
582 3300048905 Ga0496102_0216865 Ga0496102_0216865_740_1681 311
583 3300048905 Ga0496102_0286372 Ga0496102_0286372_82_1035 311
584 3300049568 Ga0501031_0062022 Ga0501031_0062022_1164_2102 311
585 3300049569 Ga0501032_0000238 Ga0501032_0000238_3090_4028 311
586 3300049571 Ga0501034_0032395 Ga0501034_0032395_1228_2166 311
587 3300049571 Ga0501034_0050238 Ga0501034_0050238_2512_3450 311
588 3300049571 Ga0501034_0126680 Ga0501034_0126680_877_1815 311
589 3300049571 Ga0501034_0158075 Ga0501034_0158075_448_1386 311
590 3300049572 Ga0501036_0037224 Ga0501036_0037224_161_1099 311
591 3300049572 Ga0501036_0125412 Ga0501036_0125412_526_1464 311
592 3300049573 Ga0501037_0033834 Ga0501037_0033834_2752_3690 311
593 3300049573 Ga0501037_0054099 Ga0501037_0054099_127_1065 311
594 3300049574 Ga0501038_0016573 Ga0501038_0016573_4114_5052 311
595 3300049574 Ga0501038_0070585 Ga0501038_0070585_1402_2340 311
596 3300049574 Ga0501038_0176632 Ga0501038_0176632_282_1220 311
597 3300049575 Ga0501039_0005219 Ga0501039_0005219_4718_5656 311
598 3300049575 Ga0501039_0013177 Ga0501039_0013177_4139_5077 311
599 3300049579 Ga0501043_0023740 Ga0501043_0023740_848_1786 311
600 3300049579 Ga0501043_0059264 Ga0501043_0059264_414_1352 311
601 3300049580 Ga0501046_0016583 Ga0501046_0016583_1421_2359 311
602 3300049580 Ga0501046_0073691 Ga0501046_0073691_245_1183 311
603 3300049581 Ga0501047_0009783 Ga0501047_0009783_5910_6848 311
604 3300049581 Ga0501047_0020624 Ga0501047_0020624_2990_3928 311
605 3300049581 Ga0501047_0030744 Ga0501047_0030744_2626_3564 311
606 3300049582 Ga0501048_0021788 Ga0501048_0021788_2341_3279 311
607 3300049584 Ga0501068_0004498 Ga0501068_0004498_1456_2394 311
608 3300049585 Ga0501069_0020196 Ga0501069_0020196_1224_2162 311
609 3300049588 Ga0501072_0038938 Ga0501072_0038938_525_1463 311
610 3300049589 Ga0501073_0079872 Ga0501073_0079872_1285_2223 311
611 3300049593 Ga0501077_0031050 Ga0501077_0031050_821_1759 311
612 3300049679 Ga0501249_003203 Ga0501249_003203_801_1742 311
613 3300049685 Ga0501256_005441 Ga0501256_005441_139_1080 311
614 3300049688 Ga0501259_007145 Ga0501259_007145_671_1612 311
615 3300049742 Ga0501080_0001278 Ga0501080_0001278_15579_16517 311
616 3300049742 Ga0501080_0019896 Ga0501080_0019896_1147_2085 311
617 3300049742 Ga0501080_0064732 Ga0501080_0064732_633_1571 311
618 3300049744 Ga0501083_0035705 Ga0501083_0035705_1378_2316 311
619 3300049744 Ga0501083_0088428 Ga0501083_0088428_342_1280 311
620 3300049822 Ga0501035_0133107 Ga0501035_0133107_707_1645 311
621 3300049822 Ga0501035_0255713 Ga0501035_0255713_517_1455 311
622 3300049823 Ga0501044_0023762 Ga0501044_0023762_3070_4008 311
623 3300049823 Ga0501044_0044285 Ga0501044_0044285_1601_2539 311
624 3300049823 Ga0501044_0162508 Ga0501044_0162508_983_1921 311
625 3300050509 nmdc:mga0qj67_53394_c1 nmdc:mga0qj67_53394_c1_275_1216 311
626 3300050510 nmdc:mga06r32_19415_c1 nmdc:mga06r32_19415_c1_649_1590 311
627 3300054114 Ga0501084_0104401 Ga0501084_0104401_421_1359 311
628 3300060353 Ga0501082_0009288 Ga0501082_0009288_1441_2379 311
629 3300060353 Ga0501082_0023603 Ga0501082_0023603_2897_3835 311
630 3300060353 Ga0501082_0138667 Ga0501082_0138667_107_1051 311
631 3300005329 Ga0070683_100066308 Ga0070683_1000663082 312
632 3300005439 Ga0070711_100290706 Ga0070711_1002907062 312
633 3300005539 Ga0068853_100117196 Ga0068853_1001171962 312
634 3300005545 Ga0070695_100024875 Ga0070695_1000248752 312
635 3300005614 Ga0068856_100513782 Ga0068856_1005137822 312
636 3300005617 Ga0068859_100146789 Ga0068859_1001467892 312
637 3300006931 Ga0097620_100146784 Ga0097620_1001467842 312
638 3300009093 Ga0105240_10006165 Ga0105240_1000616512 312
639 3300009098 Ga0105245_10004774 Ga0105245_100047748 312
640 3300009098 Ga0105245_10027240 Ga0105245_100272403 312
641 3300009545 Ga0105237_10043134 Ga0105237_100431343 312
642 3300010375 Ga0105239_10024652 Ga0105239_100246524 312
643 3300013104 Ga0157370_10001341 Ga0157370_1000134117 312
644 3300013105 Ga0157369_10006133 Ga0157369_100061338 312
645 3300014326 Ga0157380_10212218 Ga0157380_102122182 312
646 3300025906 Ga0207699_10127230 Ga0207699_101272302 312
647 3300025913 Ga0207695_10003666 Ga0207695_100036667 312
648 3300025914 Ga0207671_10019844 Ga0207671_100198442 312
649 3300025916 Ga0207663_10139217 Ga0207663_101392172 312
650 3300025927 Ga0207687_10009224 Ga0207687_100092244 312
651 3300025944 Ga0207661_10011015 Ga0207661_100110154 312
652 3300025949 Ga0207667_10003900 Ga0207667_1000390011 312
653 3300031548 Ga0307408_100163729 Ga0307408_1001637291 312
654 3300048929 Ga0496126_0001121 Ga0496126_0001121_19350_20306 312
655 3300013296 Ga0157374_10011723 Ga0157374_100117232 313
656 3300013297 Ga0157378_10000659 Ga0157378_1000065923 313
657 3300028800 Ga0265338_10147153 Ga0265338_101471532 313
658 3300048907 Ga0496104_0145616 Ga0496104_0145616_618_1628 313
659 3300049574 Ga0501038_0198596 Ga0501038_0198596_553_1539 313
660 3300049576 Ga0501040_0157314 Ga0501040_0157314_58_1044 313
661 3300049581 Ga0501047_0301168 Ga0501047_0301168_194_1210 313
662 3300049591 Ga0501075_0136923 Ga0501075_0136923_50_1036 313
663 3300049743 Ga0501081_0122166 Ga0501081_0122166_724_1710 313
664 3300005459 Ga0068867_100012468 Ga0068867_1000124686 314
665 3300005564 Ga0070664_100038330 Ga0070664_1000383302 314
666 3300005577 Ga0068857_100033001 Ga0068857_1000330013 314
667 3300006881 Ga0068865_100089115 Ga0068865_1000891152 314
668 3300009148 Ga0105243_10191376 Ga0105243_101913762 314
669 3300009176 Ga0105242_10004104 Ga0105242_100041048 314
670 3300009177 Ga0105248_10102209 Ga0105248_101022092 314
671 3300011119 Ga0105246_10193546 Ga0105246_101935462 314
672 3300013307 Ga0157372_10507486 Ga0157372_105074862 314
673 3300017792 Ga0163161_10214112 Ga0163161_102141122 314
674 3300025907 Ga0207645_10150171 Ga0207645_101501712 314
675 3300025919 Ga0207657_10197003 Ga0207657_101970032 314
676 3300025920 Ga0207649_10112669 Ga0207649_101126692 314
677 3300025932 Ga0207690_10043386 Ga0207690_100433862 314
678 3300025935 Ga0207709_10078736 Ga0207709_100787362 314
679 3300025939 Ga0207665_10104944 Ga0207665_101049442 314
680 3300025941 Ga0207711_10120233 Ga0207711_101202332 314
681 3300025944 Ga0207661_10151116 Ga0207661_101511162 314
682 3300025986 Ga0207658_10174052 Ga0207658_101740522 314
683 3300026035 Ga0207703_10467254 Ga0207703_104672541 314
684 3300026041 Ga0207639_10400693 Ga0207639_104006932 314
685 3300026089 Ga0207648_10024869 Ga0207648_100248692 314
686 3300026095 Ga0207676_10521429 Ga0207676_105214291 314
687 3300026116 Ga0207674_10003778 Ga0207674_1000377813 314
688 3300026118 Ga0207675_100458635 Ga0207675_1004586352 314
689 3300028800 Ga0265338_10063395 Ga0265338_100633952 314
690 3300031250 Ga0265331_10056265 Ga0265331_100562652 314
691 3300035172 Ga0373955_0259037 Ga0373955_0259037_45_1022 314
692 3300047317 Ga0495604_0038772 Ga0495604_0038772_971_1948 314
693 3300048903 Ga0496100_0061882 Ga0496100_0061882_1478_2455 314
694 3300048904 Ga0496101_0063871 Ga0496101_0063871_1655_2632 314
695 3300048911 Ga0496108_0059514 Ga0496108_0059514_585_1562 314
696 3300048915 Ga0496112_0143435 Ga0496112_0143435_984_1961 314
697 3300048916 Ga0496113_0018528 Ga0496113_0018528_3498_4475 314
698 3300005327 Ga0070658_10039775 Ga0070658_100397754 315
699 3300013307 Ga0157372_10119655 Ga0157372_101196552 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

190

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

158

223

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9336 12 228
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9259 13 228
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9252 13 225
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9242 10 315
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9242 12 226
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9623 6 230 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9576 13 230 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9548 4 228 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9547 7 230 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9544 9 230 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3E2C6T3-F1-model_v4 deleted 0.966 120 221
AF-A0A0D1P4L1-F1-model_v4 deleted 0.956 11 228
AF-M0USI3-F1-model_v4 deleted 0.953 9 197
AF-A0A2D4CKI9-F1-model_v4 deleted 0.9509 7 230
AF-A0A7L4N782-F1-model_v4 ABCAC protein 0.9502 57 230 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359

Feature Viewer

pLDDT pTM Quality
90.79 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map