F475982

General Info

Members Datasets Scaffolds Average Seq Length
698 346 644 231

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0000006|Ga0496126_0000006_359259_360059
Length 266
Sequence VAGSATTLNLVVPIVADRPDRRSIEWSWAAVNEHHSALIDTTEMYLRTVYELEEEGVTPLRARIAERLGQSGPTVSQTVARMERDGLLHVAADRHLELSTEGRRQATAVMRKHRLAERLLLDVIGLEWDQVHIEACRWEHVMSDTVERRIIALLEKPLVCPHGNPIPGLRELGLPLTTVDAKLSTTTLLDAAVDDSDAAALVERISEQLQPDDDLMRELIGAGVLPGRNITLRGCPDGVEVDGPSGTAVIDHFTAEHIFVVLPDLA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
8 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
9 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
10 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
11 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
12 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
13 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
14 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
15 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
16 2855683550 Micromonospora sp. RP3T Isolate Unclassified
17 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
18 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
19 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
20 2858868258 Micromonospora sp. MH33 Isolate Unclassified
21 2858882152 Micromonospora noduli MED15 Isolate Nodule
22 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
23 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
24 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
25 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
26 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
27 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
28 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
29 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
30 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
31 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
32 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
33 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
34 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
35 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
36 2902582711 Micromonospora sp. AP08 Isolate Unclassified
37 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
38 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
39 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
40 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
41 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
42 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
43 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
44 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
45 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
46 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
72 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
73 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
74 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
75 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
76 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
77 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
78 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
105 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
106 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
107 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
158 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
161 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
243 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
244 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
245 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
246 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
325 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
326 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
327 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
328 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
329 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
330 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
331 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 649633069 Micromonospora sp. L5 Isolate Unclassified
335 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
336 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
337 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
338 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
339 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
340 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
341 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
342 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
343 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
344 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
345 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
346 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.11
Metatranscriptomes 4.15
Isolates 7.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0.86
Rhizoplane 6.16
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 9.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1016548 3300001915 Bacteria 1202
2 JGI24739J22299_10019813 3300001989 Bacteria 2406
3 JGI24739J22299_10075160 3300001989 Bacteria 1045
4 JGI24737J22298_10001587 3300001990 Bacteria 8081
5 JGI24735J21928_10065430 3300002067 Bacteria 1043
6 JGI24751J29686_10000695 3300002459 Bacteria 8334
7 JGI25406J46586_10047396 3300003203 Bacteria 1465
8 Ga0058859_11291813 3300004798 Bacteria 890
9 Ga0070658_10273353 3300005327 Bacteria 1437
10 Ga0070683_100148969 3300005329 Bacteria 2218
11 Ga0070683_100740823 3300005329 Bacteria 941
12 Ga0070683_101071610 3300005329 Bacteria 774
13 Ga0070690_100048870 3300005330 Bacteria 2696
14 Ga0070690_100122506 3300005330 Bacteria 1747
15 Ga0070670_100148793 3300005331 Bacteria 2026
16 Ga0070670_100284830 3300005331 Bacteria 1443
17 Ga0070670_100637768 3300005331 Bacteria 955
18 Ga0068869_100013871 3300005334 Bacteria 5373
19 Ga0068869_100026523 3300005334 Bacteria 4034
20 Ga0068869_100032565 3300005334 Bacteria 3674
21 Ga0070680_100006905 3300005336 Bacteria 8651
22 Ga0070682_100004812 3300005337 Bacteria 7497
23 Ga0070682_100479948 3300005337 Bacteria 959
24 Ga0068868_100012229 3300005338 Bacteria 6272
25 Ga0068868_100019278 3300005338 Bacteria 5110
26 Ga0068868_100019898 3300005338 Bacteria 5034
27 Ga0070660_100051151 3300005339 Bacteria 3181
28 Ga0070689_100044431 3300005340 Bacteria 3418
29 Ga0070691_10000766 3300005341 Bacteria 12728
30 Ga0070691_10009203 3300005341 Bacteria 4516
31 Ga0070687_100072879 3300005343 Bacteria 1849
32 Ga0070661_100013492 3300005344 Bacteria 5736
33 Ga0070692_10004966 3300005345 Bacteria 5615
34 Ga0070692_10012197 3300005345 Bacteria 3968
35 Ga0070692_10036315 3300005345 Bacteria 2500
36 Ga0070668_100026144 3300005347 Bacteria 4428
37 Ga0070668_100070913 3300005347 Bacteria 2713
38 Ga0070668_100316855 3300005347 Bacteria 1312
39 Ga0070669_100078905 3300005353 Bacteria 2448
40 Ga0070675_100001606 3300005354 Bacteria 16667
41 Ga0070675_100039210 3300005354 Bacteria 3864
42 Ga0070671_100008515 3300005355 Bacteria 8222
43 Ga0070671_100455775 3300005355 Bacteria 1097
44 Ga0070674_100326649 3300005356 Bacteria 1232
45 Ga0070673_100022819 3300005364 Bacteria 4563
46 Ga0070673_100150800 3300005364 Bacteria 1969
47 Ga0070688_100036075 3300005365 Bacteria 3006
48 Ga0070659_100009680 3300005366 Bacteria 7082
49 Ga0070659_100026353 3300005366 Bacteria 4473
50 Ga0070667_100042662 3300005367 Bacteria 3806
51 Ga0070709_10012909 3300005434 Bacteria 4682
52 Ga0070714_100000006 3300005435 Bacteria 293311
53 Ga0070714_100041666 3300005435 Bacteria 3876
54 Ga0070714_100141872 3300005435 Bacteria 2157
55 Ga0070714_100260253 3300005435 Bacteria 1606
56 Ga0070713_100001654 3300005436 Bacteria 14319
57 Ga0070713_100340173 3300005436 Bacteria 1390
58 Ga0070713_100698712 3300005436 Bacteria 968
59 Ga0070710_10041589 3300005437 Bacteria 2538
60 Ga0070710_10047479 3300005437 Bacteria 2395
61 Ga0070701_10062991 3300005438 Bacteria 1961
62 Ga0070705_100123441 3300005440 Bacteria 1676
63 Ga0070700_100000011 3300005441 Bacteria 173076
64 Ga0070700_100038003 3300005441 Bacteria 2931
65 Ga0070700_100172755 3300005441 Bacteria 1498
66 Ga0070694_100007551 3300005444 Bacteria 6636
67 Ga0070663_100007178 3300005455 Bacteria 6768
68 Ga0070663_100008414 3300005455 Bacteria 6345
69 Ga0070663_100445085 3300005455 Bacteria 1067
70 Ga0070678_100008274 3300005456 Bacteria 6223
71 Ga0070678_100015145 3300005456 Bacteria 4891
72 Ga0070678_100077711 3300005456 Bacteria 2505
73 Ga0070662_100010109 3300005457 Bacteria 6183
74 Ga0070662_100049004 3300005457 Bacteria 3045
75 Ga0070681_10207867 3300005458 Bacteria 1874
76 Ga0068867_100218413 3300005459 Bacteria 1535
77 Ga0070685_10045194 3300005466 Bacteria 2524
78 Ga0070698_100421595 3300005471 Bacteria 1269
79 Ga0070679_100020026 3300005530 Bacteria 6519
80 Ga0070679_100100074 3300005530 Bacteria 2886
81 Ga0070679_100667540 3300005530 Bacteria 982
82 Ga0070684_100010223 3300005535 Bacteria 7427
83 Ga0070684_100680595 3300005535 Bacteria 958
84 Ga0068853_100025489 3300005539 Bacteria 4963
85 Ga0068853_100280574 3300005539 Bacteria 1536
86 Ga0070686_100027534 3300005544 Bacteria 3440
87 Ga0070693_100047311 3300005547 Bacteria 2447
88 Ga0070693_100056308 3300005547 Bacteria 2268
89 Ga0070693_100078620 3300005547 Bacteria 1961
90 Ga0070665_100000583 3300005548 Bacteria 50878
91 Ga0070665_100029459 3300005548 Bacteria 5525
92 Ga0070665_100110403 3300005548 Bacteria 2753
93 Ga0070665_100153571 3300005548 Bacteria 2304
94 Ga0070704_100014714 3300005549 Bacteria 4892
95 Ga0068855_100018263 3300005563 Bacteria 8424
96 Ga0068855_100028337 3300005563 Bacteria 6699
97 Ga0068855_100208469 3300005563 Bacteria 2197
98 Ga0070664_100000984 3300005564 Bacteria 22323
99 Ga0070664_100093138 3300005564 Bacteria 2610
100 Ga0070664_100104341 3300005564 Bacteria 2468
101 Ga0068857_100031821 3300005577 Bacteria 4661
102 Ga0068857_100356545 3300005577 Bacteria 1355
103 Ga0068857_100656316 3300005577 Bacteria 994
104 Ga0068854_100070746 3300005578 Bacteria 2550
105 Ga0068854_100503823 3300005578 Bacteria 1020
106 Ga0068856_100002291 3300005614 Bacteria 19725
107 Ga0068856_100257194 3300005614 Bacteria 1761
108 Ga0068856_100683443 3300005614 Bacteria 1047
109 Ga0070702_100000733 3300005615 Bacteria 12417
110 Ga0068852_100017532 3300005616 Bacteria 5621
111 Ga0068852_100093885 3300005616 Bacteria 2690
112 Ga0068859_100007500 3300005617 Bacteria 11068
113 Ga0068859_100037500 3300005617 Bacteria 4864
114 Ga0068859_100139800 3300005617 Bacteria 2495
115 Ga0068859_100438591 3300005617 Bacteria 1402
116 Ga0068864_100007753 3300005618 Bacteria 8844
117 Ga0068864_100118838 3300005618 Bacteria 2361
118 Ga0068866_10137612 3300005718 Bacteria 1398
119 Ga0068861_100016781 3300005719 Bacteria 5188
120 Ga0068861_100072988 3300005719 Bacteria 2664
121 Ga0068861_100276391 3300005719 Bacteria 1444
122 Ga0068851_10011468 3300005834 Bacteria 4159
123 Ga0068851_10115071 3300005834 Bacteria 1440
124 Ga0068870_10001504 3300005840 Bacteria 9453
125 Ga0068863_100001923 3300005841 Bacteria 20617
126 Ga0068863_100015654 3300005841 Bacteria 7282
127 Ga0068863_100035481 3300005841 Bacteria 4750
128 Ga0068858_100020875 3300005842 Bacteria 6122
129 Ga0068858_100027183 3300005842 Bacteria 5315
130 Ga0068858_100078839 3300005842 Bacteria 3060
131 Ga0068860_100000043 3300005843 Bacteria 225862
132 Ga0068860_100023775 3300005843 Bacteria 5924
133 Ga0068860_101010140 3300005843 Bacteria 850
134 Ga0081455_10061462 3300005937 Bacteria 3161
135 Ga0081540_1006605 3300005983 Bacteria 8414
136 Ga0081540_1009262 3300005983 Bacteria 6792
137 Ga0081540_1010669 3300005983 Bacteria 6197
138 Ga0081540_1051198 3300005983 Bacteria 2044
139 Ga0081540_1065856 3300005983 Bacteria 1701
140 Ga0081539_10000536 3300005985 Bacteria 78807
141 Ga0081539_10000709 3300005985 Bacteria 66741
142 Ga0081539_10003417 3300005985 Bacteria 19544
143 Ga0081539_10019247 3300005985 Bacteria 4683
144 Ga0081539_10089590 3300005985 Bacteria 1593
145 Ga0070717_10289165 3300006028 Bacteria 1455
146 Ga0070716_100019555 3300006173 Bacteria 3540
147 Ga0070716_100518198 3300006173 Bacteria 883
148 Ga0070712_100012110 3300006175 Bacteria 5480
149 Ga0097621_100007324 3300006237 Bacteria 7887
150 Ga0097621_100083652 3300006237 Bacteria 2659
151 Ga0068871_100007410 3300006358 Bacteria 7836
152 Ga0068871_100159110 3300006358 Bacteria 1931
153 Ga0075428_100022273 3300006844 Bacteria 7015
154 Ga0075428_100381115 3300006844 Bacteria 1512
155 Ga0075428_100655131 3300006844 Bacteria 1120
156 Ga0075430_100009448 3300006846 Bacteria 8239
157 Ga0075430_100022154 3300006846 Bacteria 5401
158 Ga0075431_100015245 3300006847 Bacteria 7790
159 Ga0075431_100025021 3300006847 Bacteria 6120
160 Ga0075431_100053468 3300006847 Bacteria 4164
161 Ga0075433_10006704 3300006852 Bacteria 9118
162 Ga0075433_10016078 3300006852 Bacteria 6157
163 Ga0075434_100016850 3300006871 Bacteria 7030
164 Ga0075434_100024777 3300006871 Bacteria 5866
165 Ga0075429_100158853 3300006880 Bacteria 1979
166 Ga0075429_100360414 3300006880 Bacteria 1273
167 Ga0075436_100004139 3300006914 Bacteria 9954
168 Ga0075436_100037954 3300006914 Bacteria 3325
169 Ga0097620_100007500 3300006931 Bacteria 11068
170 Ga0097620_100037501 3300006931 Bacteria 4864
171 Ga0097620_100139806 3300006931 Bacteria 2495
172 Ga0097620_100438643 3300006931 Bacteria 1402
173 Ga0075435_100005125 3300007076 Bacteria 9108
174 Ga0075435_100011796 3300007076 Bacteria 6449
175 Ga0105251_10027028 3300009011 Bacteria 2914
176 Ga0105251_10027850 3300009011 Bacteria 2859
177 Ga0105240_10076218 3300009093 Bacteria 4135
178 Ga0105240_10107868 3300009093 Bacteria 3375
179 Ga0105240_10140469 3300009093 Bacteria 2888
180 Ga0111539_10017696 3300009094 Bacteria 8822
181 Ga0111539_10051696 3300009094 Bacteria 4893
182 Ga0111539_10550896 3300009094 Bacteria 1343
183 Ga0105245_10016117 3300009098 Bacteria 6512
184 Ga0105245_10044524 3300009098 Bacteria 3962
185 Ga0105245_10430511 3300009098 Bacteria 1324
186 Ga0105247_10103499 3300009101 Bacteria 1823
187 Ga0114129_10009483 3300009147 Bacteria 13876
188 Ga0114129_10013774 3300009147 Bacteria 11525
189 Ga0114129_10041652 3300009147 Bacteria 6469
190 Ga0114129_10061250 3300009147 Bacteria 5259
191 Ga0114129_10381498 3300009147 Bacteria 1861
192 Ga0105243_10026434 3300009148 Bacteria 4442
193 Ga0105241_10360934 3300009174 Bacteria 1264
194 Ga0105248_10038236 3300009177 Bacteria 5370
195 Ga0105248_10044819 3300009177 Bacteria 4961
196 Ga0105237_10024351 3300009545 Bacteria 6194
197 Ga0105237_10024906 3300009545 Bacteria 6122
198 Ga0105237_10175889 3300009545 Bacteria 2140
199 Ga0105237_10351057 3300009545 Bacteria 1479
200 Ga0105238_10068670 3300009551 Bacteria 3545
201 Ga0105238_10692597 3300009551 Bacteria 1031
202 Ga0105249_10012741 3300009553 Bacteria 7412
203 Ga0105249_10106899 3300009553 Bacteria 2640
204 Ga0105249_10343568 3300009553 Bacteria 1510
205 Ga0105249_10551047 3300009553 Bacteria 1204
206 Ga0105249_10559088 3300009553 Bacteria 1195
207 Ga0105239_10050341 3300010375 Bacteria 4569
208 Ga0105239_10068314 3300010375 Bacteria 3905
209 Ga0105239_10092612 3300010375 Bacteria 3336
210 Ga0105239_11004481 3300010375 Bacteria 959
211 Ga0105246_10005937 3300011119 Bacteria 7453
212 Ga0105246_10027733 3300011119 Bacteria 3715
213 Ga0157373_10233368 3300013100 Bacteria 1300
214 Ga0157371_10029273 3300013102 Bacteria 3985
215 Ga0157370_10030742 3300013104 Bacteria 5260
216 Ga0157370_10031251 3300013104 Bacteria 5211
217 Ga0157369_10130456 3300013105 Bacteria 2664
218 Ga0157374_10026072 3300013296 Bacteria 5256
219 Ga0157374_10133909 3300013296 Bacteria 2401
220 Ga0157378_10028408 3300013297 Bacteria 4935
221 Ga0163162_10024324 3300013306 Bacteria 5977
222 Ga0163162_10183866 3300013306 Bacteria 2217
223 Ga0157372_10000572 3300013307 Bacteria 40323
224 Ga0157372_10038556 3300013307 Bacteria 5274
225 Ga0157375_10032954 3300013308 Bacteria 4918
226 Ga0163163_10066080 3300014325 Bacteria 3591
227 Ga0163163_10225507 3300014325 Bacteria 1923
228 Ga0157380_11063618 3300014326 Bacteria 846
229 Ga0157377_10001463 3300014745 Bacteria 10217
230 Ga0157377_10003575 3300014745 Bacteria 7035
231 Ga0157377_10408894 3300014745 Bacteria 926
232 Ga0157379_10046413 3300014968 Bacteria 3875
233 Ga0163161_10008970 3300017792 Bacteria 6917
234 Ga0197907_10054147 3300020069 Bacteria 2636
235 Ga0197907_10472253 3300020069 Bacteria 1919
236 Ga0197907_11509860 3300020069 Bacteria 2219
237 Ga0206356_10697636 3300020070 Bacteria 1415
238 Ga0206356_10832449 3300020070 Bacteria 1983
239 Ga0206356_10895185 3300020070 Bacteria 1427
240 Ga0206349_1492927 3300020075 Bacteria 2272
241 Ga0206355_1149142 3300020076 Bacteria 1142
242 Ga0206355_1559621 3300020076 Bacteria 2303
243 Ga0206351_10099769 3300020077 Bacteria 1901
244 Ga0206352_10998045 3300020078 Bacteria 1121
245 Ga0206350_10343000 3300020080 Bacteria 1903
246 Ga0206350_10484499 3300020080 Bacteria 963
247 Ga0206350_10560694 3300020080 Bacteria 1953
248 Ga0206350_11508004 3300020080 Bacteria 1022
249 Ga0206350_11523504 3300020080 Bacteria 2043
250 Ga0206354_10024162 3300020081 Bacteria 2100
251 Ga0206354_10899815 3300020081 Bacteria 2771
252 Ga0206354_11484205 3300020081 Bacteria 2842
253 Ga0206353_10066264 3300020082 Bacteria 904
254 Ga0206353_10745633 3300020082 Bacteria 1756
255 Ga0206353_11129427 3300020082 Bacteria 3475
256 Ga0206353_11329945 3300020082 Bacteria 1636
257 Ga0206353_11529310 3300020082 Bacteria 2411
258 Ga0224712_10011470 3300022467 Bacteria 2752
259 Ga0224712_10016089 3300022467 Bacteria 2449
260 Ga0224712_10074384 3300022467 Bacteria 1388
261 Ga0224712_10113989 3300022467 Bacteria 1163
262 Ga0207656_10003024 3300025321 Bacteria 5754
263 Ga0207713_1033848 3300025735 Bacteria 2226
264 Ga0207692_10021505 3300025898 Bacteria 2952
265 Ga0207692_10383621 3300025898 Bacteria 873
266 Ga0207642_10027317 3300025899 Bacteria 2334
267 Ga0207710_10038767 3300025900 Bacteria 2108
268 Ga0207710_10088771 3300025900 Bacteria 1444
269 Ga0207688_10010631 3300025901 Bacteria 5006
270 Ga0207688_10032413 3300025901 Bacteria 2888
271 Ga0207680_10123215 3300025903 Bacteria 1698
272 Ga0207680_10243352 3300025903 Bacteria 1240
273 Ga0207647_10022378 3300025904 Bacteria 4198
274 Ga0207647_10030415 3300025904 Bacteria 3484
275 Ga0207647_10063959 3300025904 Bacteria 2236
276 Ga0207647_10077381 3300025904 Bacteria 1999
277 Ga0207685_10042083 3300025905 Bacteria 1713
278 Ga0207699_10015308 3300025906 Bacteria 3981
279 Ga0207699_10063981 3300025906 Bacteria 2224
280 Ga0207645_10010317 3300025907 Bacteria 6414
281 Ga0207643_10000767 3300025908 Bacteria 19624
282 Ga0207705_10003281 3300025909 Bacteria 12322
283 Ga0207654_10014312 3300025911 Bacteria 4098
284 Ga0207707_10011969 3300025912 Bacteria 7545
285 Ga0207707_10178109 3300025912 Bacteria 1857
286 Ga0207695_10074055 3300025913 Bacteria 3467
287 Ga0207695_10117098 3300025913 Bacteria 2638
288 Ga0207695_10527083 3300025913 Bacteria 1063
289 Ga0207671_10046923 3300025914 Bacteria 3196
290 Ga0207671_10076476 3300025914 Bacteria 2505
291 Ga0207671_10127960 3300025914 Bacteria 1947
292 Ga0207693_10002556 3300025915 Bacteria 15818
293 Ga0207693_10126653 3300025915 Bacteria 2007
294 Ga0207663_10050352 3300025916 Bacteria 2588
295 Ga0207660_10561794 3300025917 Bacteria 928
296 Ga0207657_10025974 3300025919 Bacteria 5391
297 Ga0207657_10056954 3300025919 Bacteria 3371
298 Ga0207652_10073567 3300025921 Bacteria 2973
299 Ga0207652_10108915 3300025921 Bacteria 2455
300 Ga0207652_10601460 3300025921 Bacteria 986
301 Ga0207694_10127414 3300025924 Bacteria 2038
302 Ga0207694_10136786 3300025924 Bacteria 1968
303 Ga0207694_10261139 3300025924 Bacteria 1419
304 Ga0207694_10382995 3300025924 Bacteria 1168
305 Ga0207650_10002367 3300025925 Bacteria 13116
306 Ga0207659_10020914 3300025926 Bacteria 4334
307 Ga0207659_10121319 3300025926 Bacteria 2003
308 Ga0207687_10004320 3300025927 Bacteria 9488
309 Ga0207687_10026136 3300025927 Bacteria 3909
310 Ga0207687_10030883 3300025927 Bacteria 3616
311 Ga0207687_10055765 3300025927 Bacteria 2770
312 Ga0207700_10084217 3300025928 Bacteria 2492
313 Ga0207700_10270933 3300025928 Bacteria 1457
314 Ga0207664_10000062 3300025929 Bacteria 114238
315 Ga0207664_10192941 3300025929 Bacteria 1754
316 Ga0207644_10006695 3300025931 Bacteria 7507
317 Ga0207644_10007960 3300025931 Bacteria 6931
318 Ga0207690_10011066 3300025932 Bacteria 5381
319 Ga0207690_10024644 3300025932 Bacteria 3770
320 Ga0207690_10059282 3300025932 Bacteria 2593
321 Ga0207706_10015986 3300025933 Bacteria 6780
322 Ga0207706_10026723 3300025933 Bacteria 5167
323 Ga0207686_10062672 3300025934 Bacteria 2362
324 Ga0207686_10395769 3300025934 Bacteria 1051
325 Ga0207670_10068986 3300025936 Bacteria 2438
326 Ga0207669_10293701 3300025937 Bacteria 1232
327 Ga0207665_10000377 3300025939 Bacteria 30785
328 Ga0207665_10279579 3300025939 Bacteria 1242
329 Ga0207691_10574914 3300025940 Bacteria 955
330 Ga0207711_10030837 3300025941 Bacteria 4523
331 Ga0207711_10051681 3300025941 Bacteria 3520
332 Ga0207711_10092547 3300025941 Bacteria 2661
333 Ga0207689_10008040 3300025942 Bacteria 9205
334 Ga0207689_10022357 3300025942 Bacteria 5318
335 Ga0207689_10058523 3300025942 Bacteria 3170
336 Ga0207661_10005626 3300025944 Bacteria 8838
337 Ga0207661_10096274 3300025944 Bacteria 2476
338 Ga0207661_10104294 3300025944 Bacteria 2387
339 Ga0207661_10121391 3300025944 Bacteria 2225
340 Ga0207661_10894267 3300025944 Bacteria 818
341 Ga0207679_10010901 3300025945 Bacteria 5861
342 Ga0207679_10022015 3300025945 Bacteria 4333
343 Ga0207679_10975054 3300025945 Bacteria 777
344 Ga0207667_10136705 3300025949 Bacteria 2524
345 Ga0207667_10372205 3300025949 Bacteria 1456
346 Ga0207667_10412829 3300025949 Bacteria 1374
347 Ga0207651_10093262 3300025960 Bacteria 2210
348 Ga0207712_10018188 3300025961 Bacteria 4574
349 Ga0207712_10246645 3300025961 Bacteria 1441
350 Ga0207712_10302330 3300025961 Bacteria 1313
351 Ga0207712_10353269 3300025961 Bacteria 1223
352 Ga0207668_10046090 3300025972 Bacteria 2977
353 Ga0207668_10056157 3300025972 Bacteria 2741
354 Ga0207668_10132036 3300025972 Bacteria 1908
355 Ga0207640_10291440 3300025981 Bacteria 1287
356 Ga0207677_10004763 3300026023 Bacteria 7318
357 Ga0207677_10041489 3300026023 Bacteria 3043
358 Ga0207677_10084891 3300026023 Bacteria 2284
359 Ga0207703_10061420 3300026035 Bacteria 3076
360 Ga0207703_10228213 3300026035 Bacteria 1668
361 Ga0207639_10031394 3300026041 Bacteria 3904
362 Ga0207678_10010962 3300026067 Bacteria 7966
363 Ga0207678_10027937 3300026067 Bacteria 4925
364 Ga0207678_10367799 3300026067 Bacteria 1242
365 Ga0207708_10000009 3300026075 Bacteria 235909
366 Ga0207708_10071639 3300026075 Bacteria 2655
367 Ga0207702_10001433 3300026078 Bacteria 23769
368 Ga0207702_10033754 3300026078 Bacteria 4275
369 Ga0207702_10142928 3300026078 Bacteria 2168
370 Ga0207702_10793955 3300026078 Bacteria 936
371 Ga0207641_10003044 3300026088 Bacteria 15106
372 Ga0207641_10020478 3300026088 Bacteria 5432
373 Ga0207676_10001005 3300026095 Bacteria 21710
374 Ga0207676_10091114 3300026095 Bacteria 2504
375 Ga0207676_10193444 3300026095 Bacteria 1792
376 Ga0207674_10069209 3300026116 Bacteria 3550
377 Ga0207674_10122745 3300026116 Bacteria 2564
378 Ga0207674_10285589 3300026116 Bacteria 1598
379 Ga0207675_100044806 3300026118 Bacteria 4133
380 Ga0207675_100095087 3300026118 Bacteria 2803
381 Ga0207683_10000462 3300026121 Bacteria 37793
382 Ga0207683_10011522 3300026121 Bacteria 7548
383 Ga0207683_10146778 3300026121 Bacteria 2127
384 Ga0207698_10003632 3300026142 Bacteria 9311
385 Ga0207698_10006669 3300026142 Bacteria 7216
386 Ga0207698_10131092 3300026142 Bacteria 2142
387 Ga0207698_10566250 3300026142 Bacteria 1116
388 Ga0207428_10001819 3300027907 Bacteria 21829
389 Ga0207428_10009693 3300027907 Bacteria 8629
390 Ga0268266_10010053 3300028379 Bacteria 8295
391 Ga0268266_10028258 3300028379 Bacteria 4768
392 Ga0268266_10049778 3300028379 Bacteria 3594
393 Ga0268266_10097607 3300028379 Bacteria 2584
394 Ga0268265_11160322 3300028380 Bacteria 769
395 Ga0268264_10000027 3300028381 Bacteria 440852
396 Ga0268264_10476508 3300028381 Bacteria 1213
397 Ga0307517_10098149 3300028786 Bacteria 2333
398 Ga0307517_10126827 3300028786 Bacteria 1858
399 Ga0307515_10000241 3300028794 Bacteria 135591
400 Ga0307515_10002981 3300028794 Bacteria 35943
401 Ga0307515_10040140 3300028794 Bacteria 7411
402 Ga0307515_10043558 3300028794 Bacteria 6970
403 Ga0307515_10218685 3300028794 Bacteria 1729
404 Ga0307512_10003152 3300030522 Bacteria 19595
405 Ga0307512_10006215 3300030522 Bacteria 12171
406 Ga0307513_10000007 3300031456 Bacteria 451043
407 Ga0307513_10020898 3300031456 Bacteria 7745
408 Ga0307513_10294356 3300031456 Bacteria 1393
409 Ga0307513_10345968 3300031456 Bacteria 1236
410 Ga0307513_10606857 3300031456 Bacteria 803
411 Ga0307509_10370337 3300031507 Bacteria 1149
412 Ga0307408_100284047 3300031548 Bacteria 1379
413 Ga0307508_10001698 3300031616 Bacteria 24436
414 Ga0307508_10014255 3300031616 Bacteria 7250
415 Ga0307508_10026635 3300031616 Bacteria 5239
416 Ga0307516_10013193 3300031730 Bacteria 8824
417 Ga0307516_10017972 3300031730 Bacteria 7357
418 Ga0307516_10034862 3300031730 Bacteria 5053
419 Ga0307516_10077699 3300031730 Bacteria 3167
420 Ga0307405_10064589 3300031731 Bacteria 2327
421 Ga0307405_10068504 3300031731 Bacteria 2271
422 Ga0307413_10030269 3300031824 Bacteria 3040
423 Ga0307413_10697241 3300031824 Bacteria 843
424 Ga0307410_10182556 3300031852 Bacteria 1589
425 Ga0307410_10445392 3300031852 Bacteria 1055
426 Ga0326468_10000349 3300031889 Bacteria 4900
427 Ga0307406_10156531 3300031901 Bacteria 1632
428 Ga0307406_10547102 3300031901 Bacteria 946
429 Ga0307407_10076120 3300031903 Bacteria 2014
430 Ga0307409_100014850 3300031995 Bacteria 5085
431 Ga0307409_100043830 3300031995 Bacteria 3364
432 Ga0307409_100075412 3300031995 Bacteria 2700
433 Ga0307409_100118775 3300031995 Bacteria 2234
434 Ga0307409_100146938 3300031995 Bacteria 2040
435 Ga0307416_100046933 3300032002 Bacteria 3414
436 Ga0307411_10202071 3300032005 Bacteria 1527
437 Ga0307411_10457623 3300032005 Bacteria 1069
438 Ga0307415_100821504 3300032126 Bacteria 850
439 Ga0373929_0036903 3300035085 Bacteria 1069
440 Ga0373940_0004094 3300035088 Bacteria 3052
441 Ga0373940_0032710 3300035088 Bacteria 1395
442 Ga0373951_0000082 3300035091 Bacteria 37430
443 Ga0373951_0005625 3300035091 Bacteria 2902
444 Ga0373939_0005397 3300035114 Bacteria 3045
445 Ga0373941_0038233 3300035115 Bacteria 1468
446 Ga0373946_0278835 3300035171 Bacteria 822
447 Ga0373942_0000346 3300035207 Bacteria 12686
448 Ga0373942_0057807 3300035207 Bacteria 1104
449 Ga0373962_0000467 3300035242 Bacteria 8938
450 Ga0373962_0034407 3300035242 Bacteria 1403
451 Ga0373931_0007216 3300035691 Bacteria 5230
452 Ga0373935_0007985 3300035692 Bacteria 6345
453 Ga0373927_0013483 3300035695 Bacteria 5432
454 Ga0373937_0242444 3300036401 Bacteria 1698
455 Ga0395899_0039002 3300037312 Bacteria 3557
456 Ga0395900_0044475 3300037418 Bacteria 4575
457 Ga0395900_0049190 3300037418 Bacteria 4343
458 Ga0395898_0017719 3300037466 Bacteria 7268
459 Ga0395898_0034373 3300037466 Bacteria 5053
460 Ga0395905_0013660 3300037471 Bacteria 7777
461 Ga0395905_0043022 3300037471 Bacteria 4238
462 Ga0395901_0018354 3300038443 Bacteria 7141
463 Ga0395901_0030528 3300038443 Bacteria 5553
464 Ga0395901_0238153 3300038443 Bacteria 1899
465 Ga0436365_1019911 3300039437 Bacteria 5166
466 Ga0436365_1132394 3300039437 Bacteria 3218
467 Ga0436363_1342941 3300039450 Bacteria 1956
468 Ga0451791_1235265 3300041451 Bacteria 2518
469 Ga0451793_0196981 3300041452 Bacteria 957
470 Ga0439448_0006700 3300042005 Bacteria 3320
471 Ga0466969_0051965 3300044656 Bacteria 2015
472 Ga0466969_0083026 3300044656 Bacteria 1526
473 Ga0466972_0032673 3300044658 Bacteria 2555
474 Ga0466972_0057291 3300044658 Bacteria 1872
475 Ga0466972_0139281 3300044658 Bacteria 1142
476 Ga0466972_0166989 3300044658 Bacteria 1033
477 Ga0466972_0253398 3300044658 Bacteria 823
478 Ga0466965_0024385 3300044683 Bacteria 2926
479 Ga0466965_0123030 3300044683 Bacteria 1341
480 Ga0466965_0210086 3300044683 Bacteria 1035
481 Ga0466966_0026650 3300044684 Bacteria 3773
482 Ga0466966_0038382 3300044684 Bacteria 3087
483 Ga0466966_0045094 3300044684 Bacteria 2820
484 Ga0466966_0055571 3300044684 Bacteria 2505
485 Ga0466966_0062172 3300044684 Bacteria 2355
486 Ga0466966_0143083 3300044684 Bacteria 1460
487 Ga0466966_0232504 3300044684 Bacteria 1112
488 Ga0466966_0481787 3300044684 Bacteria 746
489 Ga0466961_0005646 3300044693 Bacteria 7909
490 Ga0466961_0009564 3300044693 Bacteria 6170
491 Ga0466961_0010645 3300044693 Bacteria 5871
492 Ga0466961_0017691 3300044693 Bacteria 4579
493 Ga0466961_0030202 3300044693 Bacteria 3483
494 Ga0466961_0033365 3300044693 Bacteria 3308
495 Ga0466961_0038407 3300044693 Bacteria 3071
496 Ga0466961_0047692 3300044693 Bacteria 2739
497 Ga0466961_0187100 3300044693 Bacteria 1284
498 Ga0466961_0203696 3300044693 Bacteria 1223
499 Ga0466963_0012845 3300044694 Bacteria 5131
500 Ga0466963_0044114 3300044694 Bacteria 2934
501 Ga0466963_0140395 3300044694 Bacteria 1673
502 Ga0466963_0152174 3300044694 Bacteria 1607
503 Ga0466964_0067599 3300044706 Bacteria 1503
504 Ga0466971_0010997 3300044719 Bacteria 3959
505 Ga0466971_0014064 3300044719 Bacteria 3519
506 Ga0466971_0039711 3300044719 Bacteria 2112
507 Ga0466971_0067476 3300044719 Bacteria 1622
508 Ga0466971_0093222 3300044719 Bacteria 1380
509 Ga0466971_0135614 3300044719 Bacteria 1145
510 Ga0466970_0047481 3300044765 Bacteria 2288
511 Ga0466970_0049835 3300044765 Bacteria 2233
512 Ga0466957_0045859 3300044842 Bacteria 2652
513 Ga0466957_0046335 3300044842 Bacteria 2640
514 Ga0466957_0047152 3300044842 Bacteria 2617
515 Ga0466957_0099837 3300044842 Bacteria 1828
516 Ga0466960_0000785 3300044901 Bacteria 11142
517 Ga0466960_0001736 3300044901 Bacteria 8009
518 Ga0466960_0168571 3300044901 Bacteria 1180
519 Ga0466959_0022747 3300045049 Bacteria 4634
520 Ga0466959_0058435 3300045049 Bacteria 2809
521 Ga0466959_0066185 3300045049 Bacteria 2621
522 Ga0466959_0101800 3300045049 Bacteria 2056
523 Ga0466959_0172371 3300045049 Bacteria 1517
524 Ga0466959_0198452 3300045049 Bacteria 1398
525 Ga0466959_0296373 3300045049 Bacteria 1108
526 Ga0466958_0014946 3300045836 Bacteria 4439
527 Ga0466958_0041370 3300045836 Bacteria 2772
528 Ga0466958_0057179 3300045836 Bacteria 2370
529 Ga0466958_0101020 3300045836 Bacteria 1793
530 Ga0466958_0163483 3300045836 Bacteria 1407
531 Ga0466958_0489278 3300045836 Bacteria 798
532 Ga0466958_0581206 3300045836 Bacteria 728
533 Ga0466967_0005617 3300045976 Bacteria 8722
534 Ga0466967_0023907 3300045976 Bacteria 5016
535 Ga0466967_0033697 3300045976 Bacteria 4339
536 Ga0466967_0061671 3300045976 Bacteria 3327
537 Ga0466967_0068974 3300045976 Bacteria 3159
538 Ga0466967_0131052 3300045976 Bacteria 2327
539 Ga0466967_0156980 3300045976 Bacteria 2132
540 Ga0466967_0189135 3300045976 Bacteria 1945
541 Ga0466967_0201328 3300045976 Bacteria 1886
542 Ga0466967_0243877 3300045976 Bacteria 1715
543 Ga0466967_0270094 3300045976 Bacteria 1629
544 Ga0466967_0365934 3300045976 Bacteria 1398
545 Ga0466967_1166930 3300045976 Bacteria 767
546 Ga0495608_0439189 3300046511 Bacteria 795
547 Ga0495625_0281093 3300046660 Bacteria 1071
548 Ga0495672_0071789 3300047320 Bacteria 1958
549 Ga0496100_0027221 3300048903 Bacteria 3514
550 Ga0496100_0534894 3300048903 Bacteria 905
551 Ga0496101_0016324 3300048904 Bacteria 5013
552 Ga0496101_0035254 3300048904 Bacteria 3538
553 Ga0496101_0142018 3300048904 Bacteria 1831
554 Ga0496102_0000095 3300048905 Bacteria 124981
555 Ga0496102_0000682 3300048905 Bacteria 33965
556 Ga0496102_0002597 3300048905 Bacteria 15420
557 Ga0496102_0531241 3300048905 Bacteria 1099
558 Ga0496103_0000042 3300048906 Bacteria 168701
559 Ga0496103_0026196 3300048906 Bacteria 3530
560 Ga0496104_0009220 3300048907 Bacteria 8771
561 Ga0496104_0013659 3300048907 Bacteria 7321
562 Ga0496105_0003598 3300048908 Bacteria 11508
563 Ga0496105_0036566 3300048908 Bacteria 4045
564 Ga0496106_0029251 3300048909 Bacteria 4105
565 Ga0496106_0051809 3300048909 Bacteria 3095
566 Ga0496107_0028576 3300048910 Bacteria 3963
567 Ga0496107_0176721 3300048910 Bacteria 1585
568 Ga0496108_0000028 3300048911 Bacteria 168580
569 Ga0496108_0009746 3300048911 Bacteria 7780
570 Ga0496108_0023814 3300048911 Bacteria 5038
571 Ga0496108_0869299 3300048911 Bacteria 775
572 Ga0496109_0009965 3300048912 Bacteria 8115
573 Ga0496109_0085550 3300048912 Bacteria 2910
574 Ga0496109_0506445 3300048912 Bacteria 1140
575 Ga0496110_0009051 3300048913 Bacteria 8034
576 Ga0496110_0013512 3300048913 Bacteria 6754
577 Ga0496110_0226670 3300048913 Bacteria 1699
578 Ga0496111_0007099 3300048914 Bacteria 7319
579 Ga0496111_0026637 3300048914 Bacteria 4084
580 Ga0496111_0038854 3300048914 Bacteria 3411
581 Ga0496112_0123457 3300048915 Bacteria 2560
582 Ga0496113_0003403 3300048916 Bacteria 9519
583 Ga0496113_0015498 3300048916 Bacteria 5241
584 Ga0496113_0031947 3300048916 Bacteria 3824
585 Ga0496113_0149026 3300048916 Bacteria 1845
586 Ga0496114_0012135 3300048917 Bacteria 6894
587 Ga0496114_0120519 3300048917 Bacteria 2256
588 Ga0496114_0293832 3300048917 Bacteria 1434
589 Ga0496115_0017668 3300048918 Bacteria 5460
590 Ga0496119_0000276 3300048922 Bacteria 72490
591 Ga0496119_0161770 3300048922 Bacteria 1189
592 Ga0496120_0017628 3300048923 Bacteria 4620
593 Ga0496121_0023550 3300048924 Bacteria 5924
594 Ga0496121_0028645 3300048924 Bacteria 5179
595 Ga0496126_0000006 3300048929 Bacteria 798804
596 Ga0496126_0091257 3300048929 Bacteria 2679
597 Ga0496126_0153004 3300048929 Bacteria 1976
598 Ga0501031_0007867 3300049568 Bacteria 6938
599 Ga0501034_0023051 3300049571 Bacteria 6345
600 Ga0501037_0216433 3300049573 Bacteria 1349
601 Ga0501038_0007911 3300049574 Bacteria 9801
602 Ga0501043_0029182 3300049579 Bacteria 4332
603 Ga0501047_0019307 3300049581 Bacteria 6539
604 Ga0501047_0048014 3300049581 Bacteria 4123
605 Ga0501048_0007150 3300049582 Bacteria 8481
606 Ga0501070_0044885 3300049586 Bacteria 3676
607 Ga0501074_0246950 3300049590 Bacteria 1269
608 Ga0501075_0567794 3300049591 Bacteria 866
609 Ga0501035_0372983 3300049822 Bacteria 1191
610 Ga0501035_0544760 3300049822 Bacteria 951
611 Ga0501044_0100023 3300049823 Bacteria 2918
612 Ga0501044_0247063 3300049823 Bacteria 1727
613 nmdc:mga00v17_188879_c1 3300050491 Bacteria 1330
614 nmdc:mga05p37_1207905_c1 3300050507 Bacteria 780
615 nmdc:mga05p37_262167_c1 3300050507 Bacteria 1678
616 nmdc:mga05p37_374669_c1 3300050507 Bacteria 1670
617 nmdc:mga09592_18944_c1 3300050508 Bacteria 5647
618 nmdc:mga09592_383619_c1 3300050508 Bacteria 1215
619 nmdc:mga09592_416687_c1 3300050508 Bacteria 1160
620 nmdc:mga09592_98107_c1 3300050508 Bacteria 2508
621 nmdc:mga0qj67_2612_c1 3300050509 Bacteria 12907
622 nmdc:mga0qj67_89332_c1 3300050509 Bacteria 2475
623 nmdc:mga06r32_199217_c1 3300050510 Bacteria 1990
624 nmdc:mga06r32_57751_c1 3300050510 Bacteria 3728
625 nmdc:mga06r32_6136_c1 3300050510 Bacteria 10787
626 nmdc:mga08y16_1868_c1 3300050511 Bacteria 21414
627 nmdc:mga08y16_4845_c1 3300050511 Bacteria 14045
628 nmdc:mga0n895_121798_c1 3300050512 Bacteria 2630
629 nmdc:mga0n895_15670_c1 3300050512 Bacteria 6924
630 nmdc:mga0rr50_103138_c1 3300050513 Bacteria 2245
631 nmdc:mga0rr50_8639_c1 3300050513 Bacteria 6349
632 nmdc:mga08x19_16502_c1 3300050514 Bacteria 4505
633 nmdc:mga08x19_25929_c1 3300050514 Bacteria 3655
634 nmdc:mga0a205_742_c1 3300050515 Bacteria 26290
635 Ga0500641_0050359 3300053096 Bacteria 1711
636 Ga0500650_0056561 3300053098 Bacteria 1828
637 Ga0500654_133501 3300053099 Bacteria 931
638 Ga0500556_0044346 3300053104 Bacteria 1582
639 Ga0500569_009425 3300053109 Bacteria 2269
640 Ga0500652_004567 3300053131 Bacteria 4291
641 Ga0500658_0211455 3300053134 Bacteria 888
642 Ga0500579_133682 3300053143 Bacteria 1149
643 Ga0501082_0220375 3300060353 Bacteria 1651
644 Ga0466962_0025228 3300061719 Bacteria 2854

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10089590 Ga0081539_100895902 165
2 3300014326 Ga0157380_11063618 Ga0157380_110636182 167
3 3300036401 Ga0373937_0242444 Ga0373937_0242444_259_942 177
4 3300025934 Ga0207686_10395769 Ga0207686_103957691 179
5 iso_pu_bacteria 2855683550 2855686043 193
6 iso_pu_bacteria 2867312974 2867315488 193
7 iso_pu_bacteria 2867319477 2867324548 193
8 iso_pu_bacteria 8003856774 8003858829 193
9 3300053143 Ga0500579_133682 Ga0500579_133682_189_818 194
10 3300050507 nmdc:mga05p37_374669_c1 nmdc:mga05p37_374669_c1_483_1172 195
11 3300050508 nmdc:mga09592_18944_c1 nmdc:mga09592_18944_c1_3533_4222 195
12 3300035692 Ga0373935_0007985 Ga0373935_0007985_2838_3500 198
13 3300041452 Ga0451793_0196981 Ga0451793_0196981_131_856 198
14 3300048911 Ga0496108_0000028 Ga0496108_0000028_32596_33252 198
15 3300050510 nmdc:mga06r32_6136_c1 nmdc:mga06r32_6136_c1_7205_7867 198
16 iso_pu_bacteria 2902582711 2902587837 198
17 3300031730 Ga0307516_10034862 Ga0307516_100348623 199
18 iso_pu_bacteria 2858902515 2858903939 201
19 3300045976 Ga0466967_0365934 Ga0466967_0365934_13_687 202
20 iso_pu_bacteria 8001781756 8001781760 202
21 iso_pu_bacteria 8001781756 8001788883 202
22 3300005435 Ga0070714_100260253 Ga0070714_1002602532 203
23 3300005548 Ga0070665_100153571 Ga0070665_1001535712 203
24 3300005577 Ga0068857_100356545 Ga0068857_1003565451 203
25 3300005985 Ga0081539_10003417 Ga0081539_100034174 203
26 3300005985 Ga0081539_10019247 Ga0081539_100192473 203
27 3300006173 Ga0070716_100518198 Ga0070716_1005181981 203
28 3300006844 Ga0075428_100381115 Ga0075428_1003811152 203
29 3300006846 Ga0075430_100022154 Ga0075430_1000221544 203
30 3300006847 Ga0075431_100025021 Ga0075431_1000250215 203
31 3300006880 Ga0075429_100360414 Ga0075429_1003604142 203
32 3300009147 Ga0114129_10009483 Ga0114129_100094834 203
33 3300009147 Ga0114129_10013774 Ga0114129_1001377413 203
34 3300009147 Ga0114129_10381498 Ga0114129_103814982 203
35 3300025939 Ga0207665_10279579 Ga0207665_102795792 203
36 3300028379 Ga0268266_10028258 Ga0268266_100282584 203
37 3300028786 Ga0307517_10098149 Ga0307517_100981492 203
38 3300028794 Ga0307515_10002981 Ga0307515_1000298128 203
39 3300028794 Ga0307515_10043558 Ga0307515_100435585 203
40 3300030522 Ga0307512_10003152 Ga0307512_1000315214 203
41 3300030522 Ga0307512_10006215 Ga0307512_100062154 203
42 3300031456 Ga0307513_10000007 Ga0307513_10000007189 203
43 3300031456 Ga0307513_10020898 Ga0307513_100208988 203
44 3300031616 Ga0307508_10014255 Ga0307508_100142554 203
45 3300031616 Ga0307508_10026635 Ga0307508_100266353 203
46 3300031730 Ga0307516_10013193 Ga0307516_100131937 203
47 3300049591 Ga0501075_0567794 Ga0501075_0567794_38_727 203
48 3300050507 nmdc:mga05p37_1207905_c1 nmdc:mga05p37_1207905_c1_17_697 203
49 3300050508 nmdc:mga09592_98107_c1 nmdc:mga09592_98107_c1_890_1570 203
50 3300050510 nmdc:mga06r32_199217_c1 nmdc:mga06r32_199217_c1_220_945 203
51 3300053096 Ga0500641_0050359 Ga0500641_0050359_855_1532 203
52 3300053098 Ga0500650_0056561 Ga0500650_0056561_974_1651 203
53 3300053104 Ga0500556_0044346 Ga0500556_0044346_253_930 203
54 3300053109 Ga0500569_009425 Ga0500569_009425_1077_1754 203
55 3300053131 Ga0500652_004567 Ga0500652_004567_807_1484 203
56 3300053134 Ga0500658_0211455 Ga0500658_0211455_201_878 203
57 iso_pu_bacteria 2501939600 2501940780 203
58 iso_pu_bacteria 2622736626 2623587369 203
59 iso_pu_bacteria 2842888712 2842891380 203
60 iso_pu_bacteria 2856858025 2856861233 203
61 iso_pu_bacteria 2858868258 2858869288 203
62 iso_pu_bacteria 2861520306 2861523004 203
63 iso_pu_bacteria 2867302475 2867308105 203
64 iso_pu_bacteria 2996221748 2996226756 203
65 iso_pu_bacteria 649633069 649811988 203
66 iso_pu_bacteria 8057568493 8057573352 203
67 3300005331 Ga0070670_100637768 Ga0070670_1006377681 204
68 3300005334 Ga0068869_100013871 Ga0068869_1000138713 204
69 3300005338 Ga0068868_100019898 Ga0068868_1000198984 204
70 3300005343 Ga0070687_100072879 Ga0070687_1000728792 204
71 3300005345 Ga0070692_10036315 Ga0070692_100363152 204
72 3300005354 Ga0070675_100001606 Ga0070675_1000016064 204
73 3300005366 Ga0070659_100026353 Ga0070659_1000263534 204
74 3300005441 Ga0070700_100038003 Ga0070700_1000380033 204
75 3300005455 Ga0070663_100007178 Ga0070663_1000071785 204
76 3300005456 Ga0070678_100077711 Ga0070678_1000777113 204
77 3300005457 Ga0070662_100010109 Ga0070662_1000101093 204
78 3300005530 Ga0070679_100667540 Ga0070679_1006675402 204
79 3300005535 Ga0070684_100010223 Ga0070684_1000102233 204
80 3300005547 Ga0070693_100047311 Ga0070693_1000473112 204
81 3300005564 Ga0070664_100000984 Ga0070664_1000009844 204
82 3300005577 Ga0068857_100031821 Ga0068857_1000318213 204
83 3300005616 Ga0068852_100093885 Ga0068852_1000938853 204
84 3300005617 Ga0068859_100438591 Ga0068859_1004385912 204
85 3300005618 Ga0068864_100118838 Ga0068864_1001188383 204
86 3300005719 Ga0068861_100016781 Ga0068861_1000167814 204
87 3300006931 Ga0097620_100438643 Ga0097620_1004386432 204
88 3300009094 Ga0111539_10017696 Ga0111539_100176963 204
89 3300009098 Ga0105245_10044524 Ga0105245_100445243 204
90 3300009553 Ga0105249_10106899 Ga0105249_101068993 204
91 3300010375 Ga0105239_10068314 Ga0105239_100683143 204
92 3300014745 Ga0157377_10003575 Ga0157377_100035755 204
93 3300025901 Ga0207688_10032413 Ga0207688_100324133 204
94 3300025921 Ga0207652_10601460 Ga0207652_106014601 204
95 3300025926 Ga0207659_10020914 Ga0207659_100209144 204
96 3300025927 Ga0207687_10026136 Ga0207687_100261363 204
97 3300025932 Ga0207690_10011066 Ga0207690_100110664 204
98 3300025933 Ga0207706_10026723 Ga0207706_100267234 204
99 3300025936 Ga0207670_10068986 Ga0207670_100689862 204
100 3300025941 Ga0207711_10092547 Ga0207711_100925473 204
101 3300025942 Ga0207689_10008040 Ga0207689_100080403 204
102 3300025944 Ga0207661_10104294 Ga0207661_101042942 204
103 3300025945 Ga0207679_10010901 Ga0207679_100109013 204
104 3300026023 Ga0207677_10041489 Ga0207677_100414892 204
105 3300026067 Ga0207678_10010962 Ga0207678_100109623 204
106 3300026075 Ga0207708_10071639 Ga0207708_100716393 204
107 3300026095 Ga0207676_10091114 Ga0207676_100911143 204
108 3300026116 Ga0207674_10069209 Ga0207674_100692093 204
109 3300026118 Ga0207675_100044806 Ga0207675_1000448063 204
110 3300026121 Ga0207683_10146778 Ga0207683_101467782 204
111 3300026142 Ga0207698_10566250 Ga0207698_105662502 204
112 3300027907 Ga0207428_10009693 Ga0207428_100096935 204
113 3300031995 Ga0307409_100146938 Ga0307409_1001469383 204
114 3300045836 Ga0466958_0489278 Ga0466958_0489278_46_762 204
115 3300045976 Ga0466967_0243877 Ga0466967_0243877_887_1603 204
116 3300047320 Ga0495672_0071789 Ga0495672_0071789_14_685 204
117 3300049581 Ga0501047_0019307 Ga0501047_0019307_1238_1921 204
118 3300049823 Ga0501044_0247063 Ga0501044_0247063_529_1212 204
119 3300050508 nmdc:mga09592_416687_c1 nmdc:mga09592_416687_c1_420_1097 204
120 3300050511 nmdc:mga08y16_4845_c1 nmdc:mga08y16_4845_c1_8028_8705 204
121 iso_pu_bacteria 2772190715 2772644657 204
122 iso_pu_bacteria 2855670206 2855676766 204
123 iso_pu_bacteria 2855676851 2855682929 204
124 iso_pu_bacteria 2857288857 2857295598 204
125 iso_pu_bacteria 2858848962 2858853468 204
126 iso_pu_bacteria 2858882152 2858885337 204
127 iso_pu_bacteria 2858888857 2858893416 204
128 iso_pu_bacteria 2858895516 2858896510 204
129 iso_pu_bacteria 2869048445 2869052954 204
130 iso_pu_bacteria 2869061728 2869063619 204
131 iso_pu_bacteria 2869068681 2869072315 204
132 iso_pu_bacteria 2880489317 2880492872 204
133 iso_pu_bacteria 2880495981 2880499439 204
134 iso_pu_bacteria 2929219909 2929221411 204
135 iso_pu_bacteria 2929226422 2929228042 204
136 iso_pu_bacteria 8003830390 8003831535 204
137 iso_pu_bacteria 8003870546 8003875171 204
138 iso_pu_bacteria 8054704163 8054709145 204
139 iso_pu_bacteria 8054727385 8054732088 204
140 iso_pu_bacteria 8054734606 8054741042 204
141 iso_pu_bacteria 8055412473 8055418940 204
142 3300005983 Ga0081540_1010669 Ga0081540_10106692 205
143 3300031731 Ga0307405_10068504 Ga0307405_100685042 205
144 3300031824 Ga0307413_10697241 Ga0307413_106972411 205
145 3300031852 Ga0307410_10445392 Ga0307410_104453921 205
146 3300031901 Ga0307406_10547102 Ga0307406_105471022 205
147 3300031995 Ga0307409_100075412 Ga0307409_1000754124 205
148 3300031995 Ga0307409_100118775 Ga0307409_1001187753 205
149 3300032002 Ga0307416_100046933 Ga0307416_1000469332 205
150 3300032005 Ga0307411_10202071 Ga0307411_102020712 205
151 3300035088 Ga0373940_0032710 Ga0373940_0032710_19_699 205
152 3300035115 Ga0373941_0038233 Ga0373941_0038233_352_1032 205
153 3300035207 Ga0373942_0000346 Ga0373942_0000346_255_935 205
154 3300035242 Ga0373962_0000467 Ga0373962_0000467_4535_5215 205
155 3300037312 Ga0395899_0039002 Ga0395899_0039002_1275_1967 205
156 3300037418 Ga0395900_0044475 Ga0395900_0044475_1566_2258 205
157 3300037418 Ga0395900_0049190 Ga0395900_0049190_2464_3162 205
158 3300037466 Ga0395898_0017719 Ga0395898_0017719_2805_3497 205
159 3300037466 Ga0395898_0034373 Ga0395898_0034373_3337_4035 205
160 3300037471 Ga0395905_0013660 Ga0395905_0013660_4793_5485 205
161 3300037471 Ga0395905_0043022 Ga0395905_0043022_1729_2427 205
162 3300038443 Ga0395901_0018354 Ga0395901_0018354_5220_5912 205
163 3300038443 Ga0395901_0030528 Ga0395901_0030528_2662_3360 205
164 3300050491 nmdc:mga00v17_188879_c1 nmdc:mga00v17_188879_c1_254_940 205
165 iso_pu_bacteria 2515154088 2515494173 205
166 iso_pu_bacteria 2515154129 2515721970 205
167 iso_pu_bacteria 2515154137 2515758581 205
168 iso_pu_bacteria 2515154202 2516086090 205
169 iso_pu_bacteria 2515154203 2516090580 205
170 3300003203 JGI25406J46586_10047396 JGI25406J46586_100473963 206
171 3300005530 Ga0070679_100100074 Ga0070679_1001000743 206
172 3300005983 Ga0081540_1009262 Ga0081540_10092625 206
173 3300005985 Ga0081539_10000536 Ga0081539_1000053630 206
174 3300006847 Ga0075431_100015245 Ga0075431_1000152457 206
175 3300028786 Ga0307517_10126827 Ga0307517_101268272 206
176 3300028794 Ga0307515_10000241 Ga0307515_1000024185 206
177 3300028794 Ga0307515_10040140 Ga0307515_100401408 206
178 3300031507 Ga0307509_10370337 Ga0307509_103703372 206
179 3300031548 Ga0307408_100284047 Ga0307408_1002840472 206
180 3300031616 Ga0307508_10001698 Ga0307508_1000169812 206
181 3300031730 Ga0307516_10017972 Ga0307516_100179725 206
182 3300031824 Ga0307413_10030269 Ga0307413_100302693 206
183 3300031852 Ga0307410_10182556 Ga0307410_101825562 206
184 3300031889 Ga0326468_10000349 Ga0326468_100003495 206
185 3300031901 Ga0307406_10156531 Ga0307406_101565312 206
186 3300031903 Ga0307407_10076120 Ga0307407_100761202 206
187 3300031995 Ga0307409_100043830 Ga0307409_1000438302 206
188 3300032005 Ga0307411_10457623 Ga0307411_104576232 206
189 3300032126 Ga0307415_100821504 Ga0307415_1008215041 206
190 3300041451 Ga0451791_1235265 Ga0451791_1235265_641_1339 206
191 3300048929 Ga0496126_0153004 Ga0496126_0153004_1134_1820 206
192 3300050509 nmdc:mga0qj67_2612_c1 nmdc:mga0qj67_2612_c1_3061_3762 206
193 3300031730 Ga0307516_10077699 Ga0307516_100776992 207
194 3300035091 Ga0373951_0000082 Ga0373951_0000082_13910_14611 207
195 3300045976 Ga0466967_0068974 Ga0466967_0068974_1050_1793 207
196 iso_pu_bacteria 2558860112 2558908212 207
197 iso_pu_bacteria 2862705112 2862710149 207
198 iso_pu_bacteria 2870782633 2870789494 207
199 iso_pu_bacteria 8008485437 8008485513 207
200 iso_pu_bacteria 8025524527 8025529987 207
201 3300025927 Ga0207687_10030883 Ga0207687_100308831 208
202 3300031731 Ga0307405_10064589 Ga0307405_100645893 208
203 3300031995 Ga0307409_100014850 Ga0307409_1000148502 208
204 iso_pu_bacteria 2721755702 2723641345 208
205 iso_pu_bacteria 2935409751 2935410758 208
206 3300005985 Ga0081539_10000709 Ga0081539_1000070941 209
207 3300026095 Ga0207676_10193444 Ga0207676_101934441 209
208 3300035085 Ga0373929_0036903 Ga0373929_0036903_17_703 209
209 3300044694 Ga0466963_0012845 Ga0466963_0012845_3138_3794 209
210 3300044719 Ga0466971_0039711 Ga0466971_0039711_1181_1837 209
211 3300044842 Ga0466957_0099837 Ga0466957_0099837_706_1362 209
212 3300045976 Ga0466967_1166930 Ga0466967_1166930_75_752 209
213 3300061719 Ga0466962_0025228 Ga0466962_0025228_1084_1740 209
214 3300005614 Ga0068856_100002291 Ga0068856_1000022912 210
215 3300020069 Ga0197907_11509860 Ga0197907_115098602 210
216 3300025940 Ga0207691_10574914 Ga0207691_105749142 210
217 3300025961 Ga0207712_10302330 Ga0207712_103023302 210
218 3300044683 Ga0466965_0123030 Ga0466965_0123030_81_782 210
219 3300044684 Ga0466966_0232504 Ga0466966_0232504_319_1020 210
220 3300044694 Ga0466963_0140395 Ga0466963_0140395_125_784 210
221 3300044765 Ga0466970_0047481 Ga0466970_0047481_933_1634 210
222 3300044901 Ga0466960_0168571 Ga0466960_0168571_137_796 210
223 3300045976 Ga0466967_0033697 Ga0466967_0033697_3063_3782 210
224 3300005441 Ga0070700_100172755 Ga0070700_1001727552 211
225 3300009553 Ga0105249_10343568 Ga0105249_103435682 211
226 3300013306 Ga0163162_10183866 Ga0163162_101838662 211
227 3300025924 Ga0207694_10382995 Ga0207694_103829951 211
228 3300048904 Ga0496101_0142018 Ga0496101_0142018_1010_1726 211
229 3300048905 Ga0496102_0531241 Ga0496102_0531241_153_869 211
230 3300048911 Ga0496108_0869299 Ga0496108_0869299_36_752 211
231 3300048917 Ga0496114_0293832 Ga0496114_0293832_114_830 211
232 3300001989 JGI24739J22299_10019813 JGI24739J22299_100198132 212
233 3300001989 JGI24739J22299_10075160 JGI24739J22299_100751601 212
234 3300001990 JGI24737J22298_10001587 JGI24737J22298_100015875 212
235 3300002067 JGI24735J21928_10065430 JGI24735J21928_100654302 212
236 3300005337 Ga0070682_100479948 Ga0070682_1004799481 212
237 3300005347 Ga0070668_100316855 Ga0070668_1003168552 212
238 3300005539 Ga0068853_100280574 Ga0068853_1002805742 212
239 3300005578 Ga0068854_100503823 Ga0068854_1005038232 212
240 3300005614 Ga0068856_100683443 Ga0068856_1006834431 212
241 3300005834 Ga0068851_10115071 Ga0068851_101150712 212
242 3300006844 Ga0075428_100022273 Ga0075428_1000222736 212
243 3300006846 Ga0075430_100009448 Ga0075430_1000094483 212
244 3300006847 Ga0075431_100053468 Ga0075431_1000534683 212
245 3300009147 Ga0114129_10041652 Ga0114129_100416522 212
246 3300009553 Ga0105249_10551047 Ga0105249_105510472 212
247 3300010375 Ga0105239_10092612 Ga0105239_100926122 212
248 3300025904 Ga0207647_10077381 Ga0207647_100773813 212
249 3300025961 Ga0207712_10246645 Ga0207712_102466452 212
250 3300025972 Ga0207668_10056157 Ga0207668_100561572 212
251 3300025981 Ga0207640_10291440 Ga0207640_102914402 212
252 3300026078 Ga0207702_10793955 Ga0207702_107939551 212
253 3300026116 Ga0207674_10285589 Ga0207674_102855892 212
254 3300026142 Ga0207698_10131092 Ga0207698_101310922 212
255 3300028380 Ga0268265_11160322 Ga0268265_111603221 212
256 3300028794 Ga0307515_10218685 Ga0307515_102186852 212
257 3300031456 Ga0307513_10294356 Ga0307513_102943562 212
258 3300031456 Ga0307513_10345968 Ga0307513_103459681 212
259 3300031456 Ga0307513_10606857 Ga0307513_106068571 212
260 3300046660 Ga0495625_0281093 Ga0495625_0281093_301_1014 212
261 3300048912 Ga0496109_0506445 Ga0496109_0506445_240_953 212
262 3300050507 nmdc:mga05p37_262167_c1 nmdc:mga05p37_262167_c1_294_1007 212
263 3300050509 nmdc:mga0qj67_89332_c1 nmdc:mga0qj67_89332_c1_760_1473 212
264 3300050510 nmdc:mga06r32_57751_c1 nmdc:mga06r32_57751_c1_1781_2494 212
265 3300053099 Ga0500654_133501 Ga0500654_133501_37_750 212
266 iso_pu_bacteria 2816332119 2816420852 212
267 3300039450 Ga0436363_1342941 Ga0436363_1342941_485_1189 213
268 iso_pu_bacteria 2675903060 2676489937 213
269 iso_pu_bacteria 8056060235 8056065168 215
270 3300044658 Ga0466972_0166989 Ga0466972_0166989_269_1018 216
271 3300009098 Ga0105245_10430511 Ga0105245_104305112 218
272 3300048924 Ga0496121_0028645 Ga0496121_0028645_82_789 218
273 3300005347 Ga0070668_100070913 Ga0070668_1000709133 219
274 3300005355 Ga0070671_100008515 Ga0070671_1000085154 219
275 3300005441 Ga0070700_100000011 Ga0070700_100000011123 219
276 3300005548 Ga0070665_100000583 Ga0070665_10000058315 219
277 3300005841 Ga0068863_100001923 Ga0068863_10000192316 219
278 3300005842 Ga0068858_100020875 Ga0068858_1000208753 219
279 3300005843 Ga0068860_100000043 Ga0068860_10000004314 219
280 3300009093 Ga0105240_10107868 Ga0105240_101078683 219
281 3300025931 Ga0207644_10007960 Ga0207644_100079605 219
282 3300025972 Ga0207668_10046090 Ga0207668_100460902 219
283 3300026035 Ga0207703_10061420 Ga0207703_100614203 219
284 3300026075 Ga0207708_10000009 Ga0207708_10000009151 219
285 3300026088 Ga0207641_10003044 Ga0207641_1000304411 219
286 3300028379 Ga0268266_10010053 Ga0268266_100100532 219
287 3300028381 Ga0268264_10000027 Ga0268264_10000027227 219
288 3300048929 Ga0496126_0000006 Ga0496126_0000006_359259_360059 219
289 3300048929 Ga0496126_0091257 Ga0496126_0091257_895_1596 219
290 3300013104 Ga0157370_10030742 Ga0157370_100307426 220
291 3300013307 Ga0157372_10000572 Ga0157372_100005724 220
292 3300025913 Ga0207695_10117098 Ga0207695_101170982 220
293 3300025949 Ga0207667_10412829 Ga0207667_104128292 220
294 3300026142 Ga0207698_10003632 Ga0207698_100036322 220
295 3300044684 Ga0466966_0143083 Ga0466966_0143083_511_1203 220
296 3300044693 Ga0466961_0187100 Ga0466961_0187100_255_947 220
297 3300048916 Ga0496113_0003403 Ga0496113_0003403_3582_4313 220
298 3300049590 Ga0501074_0246950 Ga0501074_0246950_504_1196 220
299 3300049822 Ga0501035_0372983 Ga0501035_0372983_156_848 220
300 3300005329 Ga0070683_100148969 Ga0070683_1001489692 221
301 3300005330 Ga0070690_100048870 Ga0070690_1000488702 221
302 3300005331 Ga0070670_100284830 Ga0070670_1002848302 221
303 3300005334 Ga0068869_100032565 Ga0068869_1000325652 221
304 3300005338 Ga0068868_100012229 Ga0068868_1000122296 221
305 3300005339 Ga0070660_100051151 Ga0070660_1000511511 221
306 3300005341 Ga0070691_10009203 Ga0070691_100092033 221
307 3300005345 Ga0070692_10012197 Ga0070692_100121972 221
308 3300005347 Ga0070668_100026144 Ga0070668_1000261442 221
309 3300005353 Ga0070669_100078905 Ga0070669_1000789052 221
310 3300005355 Ga0070671_100455775 Ga0070671_1004557752 221
311 3300005356 Ga0070674_100326649 Ga0070674_1003266491 221
312 3300005364 Ga0070673_100022819 Ga0070673_1000228193 221
313 3300005366 Ga0070659_100009680 Ga0070659_1000096806 221
314 3300005367 Ga0070667_100042662 Ga0070667_1000426622 221
315 3300005435 Ga0070714_100000006 Ga0070714_10000000694 221
316 3300005435 Ga0070714_100041666 Ga0070714_1000416662 221
317 3300005436 Ga0070713_100340173 Ga0070713_1003401732 221
318 3300005436 Ga0070713_100698712 Ga0070713_1006987122 221
319 3300005437 Ga0070710_10041589 Ga0070710_100415892 221
320 3300005444 Ga0070694_100007551 Ga0070694_1000075513 221
321 3300005455 Ga0070663_100445085 Ga0070663_1004450851 221
322 3300005456 Ga0070678_100015145 Ga0070678_1000151454 221
323 3300005457 Ga0070662_100049004 Ga0070662_1000490042 221
324 3300005458 Ga0070681_10207867 Ga0070681_102078672 221
325 3300005466 Ga0070685_10045194 Ga0070685_100451942 221
326 3300005471 Ga0070698_100421595 Ga0070698_1004215952 221
327 3300005539 Ga0068853_100025489 Ga0068853_1000254895 221
328 3300005544 Ga0070686_100027534 Ga0070686_1000275343 221
329 3300005547 Ga0070693_100078620 Ga0070693_1000786202 221
330 3300005548 Ga0070665_100110403 Ga0070665_1001104032 221
331 3300005549 Ga0070704_100014714 Ga0070704_1000147143 221
332 3300005563 Ga0068855_100028337 Ga0068855_1000283372 221
333 3300005563 Ga0068855_100208469 Ga0068855_1002084691 221
334 3300005564 Ga0070664_100093138 Ga0070664_1000931382 221
335 3300005617 Ga0068859_100007500 Ga0068859_1000075009 221
336 3300005617 Ga0068859_100037500 Ga0068859_1000375002 221
337 3300005718 Ga0068866_10137612 Ga0068866_101376122 221
338 3300005719 Ga0068861_100072988 Ga0068861_1000729882 221
339 3300005841 Ga0068863_100035481 Ga0068863_1000354812 221
340 3300005842 Ga0068858_100078839 Ga0068858_1000788392 221
341 3300005843 Ga0068860_100023775 Ga0068860_1000237754 221
342 3300005937 Ga0081455_10061462 Ga0081455_100614622 221
343 3300005983 Ga0081540_1006605 Ga0081540_10066057 221
344 3300005983 Ga0081540_1065856 Ga0081540_10658561 221
345 3300006028 Ga0070717_10289165 Ga0070717_102891651 221
346 3300006173 Ga0070716_100019555 Ga0070716_1000195552 221
347 3300006175 Ga0070712_100012110 Ga0070712_1000121103 221
348 3300006237 Ga0097621_100083652 Ga0097621_1000836522 221
349 3300006358 Ga0068871_100159110 Ga0068871_1001591102 221
350 3300006852 Ga0075433_10016078 Ga0075433_100160783 221
351 3300006871 Ga0075434_100016850 Ga0075434_1000168502 221
352 3300006914 Ga0075436_100037954 Ga0075436_1000379542 221
353 3300006931 Ga0097620_100007500 Ga0097620_1000075003 221
354 3300006931 Ga0097620_100037501 Ga0097620_1000375012 221
355 3300007076 Ga0075435_100011796 Ga0075435_1000117963 221
356 3300009011 Ga0105251_10027028 Ga0105251_100270282 221
357 3300009148 Ga0105243_10026434 Ga0105243_100264343 221
358 3300009174 Ga0105241_10360934 Ga0105241_103609341 221
359 3300009177 Ga0105248_10038236 Ga0105248_100382365 221
360 3300009545 Ga0105237_10351057 Ga0105237_103510572 221
361 3300009551 Ga0105238_10068670 Ga0105238_100686702 221
362 3300009551 Ga0105238_10692597 Ga0105238_106925971 221
363 3300009553 Ga0105249_10012741 Ga0105249_100127415 221
364 3300011119 Ga0105246_10027733 Ga0105246_100277332 221
365 3300013104 Ga0157370_10031251 Ga0157370_100312513 221
366 3300013296 Ga0157374_10026072 Ga0157374_100260726 221
367 3300013297 Ga0157378_10028408 Ga0157378_100284085 221
368 3300013306 Ga0163162_10024324 Ga0163162_100243243 221
369 3300014325 Ga0163163_10225507 Ga0163163_102255072 221
370 3300017792 Ga0163161_10008970 Ga0163161_100089703 221
371 3300020069 Ga0197907_10054147 Ga0197907_100541472 221
372 3300020069 Ga0197907_10472253 Ga0197907_104722532 221
373 3300020070 Ga0206356_10832449 Ga0206356_108324492 221
374 3300020070 Ga0206356_10895185 Ga0206356_108951852 221
375 3300020076 Ga0206355_1559621 Ga0206355_15596212 221
376 3300020077 Ga0206351_10099769 Ga0206351_100997692 221
377 3300020080 Ga0206350_10343000 Ga0206350_103430002 221
378 3300020080 Ga0206350_10484499 Ga0206350_104844991 221
379 3300020080 Ga0206350_10560694 Ga0206350_105606942 221
380 3300020080 Ga0206350_11523504 Ga0206350_115235041 221
381 3300020081 Ga0206354_10024162 Ga0206354_100241622 221
382 3300020081 Ga0206354_11484205 Ga0206354_114842052 221
383 3300020082 Ga0206353_11129427 Ga0206353_111294272 221
384 3300020082 Ga0206353_11329945 Ga0206353_113299452 221
385 3300020082 Ga0206353_11529310 Ga0206353_115293102 221
386 3300022467 Ga0224712_10011470 Ga0224712_100114702 221
387 3300022467 Ga0224712_10016089 Ga0224712_100160892 221
388 3300025898 Ga0207692_10021505 Ga0207692_100215053 221
389 3300025899 Ga0207642_10027317 Ga0207642_100273172 221
390 3300025900 Ga0207710_10038767 Ga0207710_100387672 221
391 3300025901 Ga0207688_10010631 Ga0207688_100106313 221
392 3300025903 Ga0207680_10123215 Ga0207680_101232152 221
393 3300025904 Ga0207647_10030415 Ga0207647_100304152 221
394 3300025905 Ga0207685_10042083 Ga0207685_100420831 221
395 3300025906 Ga0207699_10063981 Ga0207699_100639812 221
396 3300025912 Ga0207707_10178109 Ga0207707_101781092 221
397 3300025913 Ga0207695_10527083 Ga0207695_105270831 221
398 3300025915 Ga0207693_10002556 Ga0207693_100025565 221
399 3300025917 Ga0207660_10561794 Ga0207660_105617941 221
400 3300025919 Ga0207657_10056954 Ga0207657_100569542 221
401 3300025921 Ga0207652_10108915 Ga0207652_101089152 221
402 3300025924 Ga0207694_10127414 Ga0207694_101274141 221
403 3300025927 Ga0207687_10055765 Ga0207687_100557652 221
404 3300025928 Ga0207700_10270933 Ga0207700_102709332 221
405 3300025929 Ga0207664_10000062 Ga0207664_1000006292 221
406 3300025929 Ga0207664_10192941 Ga0207664_101929411 221
407 3300025933 Ga0207706_10015986 Ga0207706_100159862 221
408 3300025934 Ga0207686_10062672 Ga0207686_100626722 221
409 3300025937 Ga0207669_10293701 Ga0207669_102937012 221
410 3300025939 Ga0207665_10000377 Ga0207665_100003773 221
411 3300025941 Ga0207711_10030837 Ga0207711_100308372 221
412 3300025942 Ga0207689_10022357 Ga0207689_100223574 221
413 3300025944 Ga0207661_10121391 Ga0207661_101213912 221
414 3300025949 Ga0207667_10372205 Ga0207667_103722052 221
415 3300025961 Ga0207712_10018188 Ga0207712_100181884 221
416 3300025972 Ga0207668_10132036 Ga0207668_101320362 221
417 3300026023 Ga0207677_10004763 Ga0207677_100047634 221
418 3300026041 Ga0207639_10031394 Ga0207639_100313942 221
419 3300026067 Ga0207678_10027937 Ga0207678_100279374 221
420 3300026067 Ga0207678_10367799 Ga0207678_103677992 221
421 3300026116 Ga0207674_10122745 Ga0207674_101227452 221
422 3300026118 Ga0207675_100095087 Ga0207675_1000950872 221
423 3300026121 Ga0207683_10000462 Ga0207683_1000046227 221
424 3300028379 Ga0268266_10097607 Ga0268266_100976072 221
425 3300035088 Ga0373940_0004094 Ga0373940_0004094_1873_2625 221
426 3300035091 Ga0373951_0005625 Ga0373951_0005625_1525_2277 221
427 3300035114 Ga0373939_0005397 Ga0373939_0005397_1814_2566 221
428 3300035171 Ga0373946_0278835 Ga0373946_0278835_107_805 221
429 3300035207 Ga0373942_0057807 Ga0373942_0057807_152_904 221
430 3300035242 Ga0373962_0034407 Ga0373962_0034407_372_1124 221
431 3300035691 Ga0373931_0007216 Ga0373931_0007216_2344_3096 221
432 3300035695 Ga0373927_0013483 Ga0373927_0013483_824_1582 221
433 3300039437 Ga0436365_1019911 Ga0436365_1019911_2822_3595 221
434 3300039437 Ga0436365_1132394 Ga0436365_1132394_1874_2698 221
435 3300044656 Ga0466969_0051965 Ga0466969_0051965_1152_1847 221
436 3300044658 Ga0466972_0139281 Ga0466972_0139281_245_937 221
437 3300044693 Ga0466961_0017691 Ga0466961_0017691_1799_2494 221
438 3300044693 Ga0466961_0033365 Ga0466961_0033365_1398_2093 221
439 3300044694 Ga0466963_0152174 Ga0466963_0152174_587_1282 221
440 3300045049 Ga0466959_0022747 Ga0466959_0022747_2489_3184 221
441 3300045049 Ga0466959_0172371 Ga0466959_0172371_33_749 221
442 3300045836 Ga0466958_0014946 Ga0466958_0014946_1312_2004 221
443 3300045836 Ga0466958_0057179 Ga0466958_0057179_525_1220 221
444 3300045976 Ga0466967_0005617 Ga0466967_0005617_237_950 221
445 3300045976 Ga0466967_0023907 Ga0466967_0023907_108_803 221
446 3300045976 Ga0466967_0061671 Ga0466967_0061671_2579_3274 221
447 3300045976 Ga0466967_0156980 Ga0466967_0156980_223_921 221
448 3300045976 Ga0466967_0189135 Ga0466967_0189135_450_1145 221
449 3300045976 Ga0466967_0201328 Ga0466967_0201328_13_708 221
450 3300045976 Ga0466967_0270094 Ga0466967_0270094_401_1150 221
451 3300048903 Ga0496100_0534894 Ga0496100_0534894_44_748 221
452 3300048904 Ga0496101_0035254 Ga0496101_0035254_1578_2330 221
453 3300048905 Ga0496102_0000095 Ga0496102_0000095_1821_2525 221
454 3300048905 Ga0496102_0000682 Ga0496102_0000682_27898_28593 221
455 3300048906 Ga0496103_0000042 Ga0496103_0000042_43710_44414 221
456 3300048906 Ga0496103_0026196 Ga0496103_0026196_829_1524 221
457 3300048907 Ga0496104_0013659 Ga0496104_0013659_825_1547 221
458 3300048908 Ga0496105_0036566 Ga0496105_0036566_2145_2867 221
459 3300048909 Ga0496106_0029251 Ga0496106_0029251_1001_1723 221
460 3300048910 Ga0496107_0028576 Ga0496107_0028576_2590_3342 221
461 3300048911 Ga0496108_0023814 Ga0496108_0023814_541_1263 221
462 3300048912 Ga0496109_0009965 Ga0496109_0009965_2626_3345 221
463 3300048913 Ga0496110_0009051 Ga0496110_0009051_1924_2646 221
464 3300048913 Ga0496110_0226670 Ga0496110_0226670_385_1104 221
465 3300048914 Ga0496111_0026637 Ga0496111_0026637_1659_2381 221
466 3300048914 Ga0496111_0038854 Ga0496111_0038854_1575_2297 221
467 3300048916 Ga0496113_0031947 Ga0496113_0031947_250_972 221
468 3300048916 Ga0496113_0149026 Ga0496113_0149026_195_917 221
469 3300048917 Ga0496114_0012135 Ga0496114_0012135_3667_4389 221
470 3300048918 Ga0496115_0017668 Ga0496115_0017668_1012_1734 221
471 3300048922 Ga0496119_0161770 Ga0496119_0161770_387_1091 221
472 3300048924 Ga0496121_0023550 Ga0496121_0023550_1280_1984 221
473 3300049568 Ga0501031_0007867 Ga0501031_0007867_6078_6791 221
474 3300049571 Ga0501034_0023051 Ga0501034_0023051_3113_3826 221
475 3300049573 Ga0501037_0216433 Ga0501037_0216433_220_933 221
476 3300049574 Ga0501038_0007911 Ga0501038_0007911_6388_7101 221
477 3300049579 Ga0501043_0029182 Ga0501043_0029182_1152_1865 221
478 3300049581 Ga0501047_0048014 Ga0501047_0048014_297_1010 221
479 3300049582 Ga0501048_0007150 Ga0501048_0007150_3483_4196 221
480 3300049586 Ga0501070_0044885 Ga0501070_0044885_1587_2300 221
481 3300049822 Ga0501035_0544760 Ga0501035_0544760_83_811 221
482 3300049823 Ga0501044_0100023 Ga0501044_0100023_27_740 221
483 3300050512 nmdc:mga0n895_121798_c1 nmdc:mga0n895_121798_c1_1122_1874 221
484 3300050513 nmdc:mga0rr50_103138_c1 nmdc:mga0rr50_103138_c1_622_1344 221
485 3300050514 nmdc:mga08x19_25929_c1 nmdc:mga08x19_25929_c1_925_1647 221
486 3300060353 Ga0501082_0220375 Ga0501082_0220375_734_1447 221
487 3300005329 Ga0070683_101071610 Ga0070683_1010716101 222
488 3300005563 Ga0068855_100018263 Ga0068855_1000182636 222
489 3300009093 Ga0105240_10076218 Ga0105240_100762182 222
490 3300009545 Ga0105237_10024906 Ga0105237_100249068 222
491 3300009545 Ga0105237_10175889 Ga0105237_101758892 222
492 3300010375 Ga0105239_11004481 Ga0105239_110044811 222
493 3300022467 Ga0224712_10113989 Ga0224712_101139891 222
494 3300025904 Ga0207647_10022378 Ga0207647_100223782 222
495 3300025913 Ga0207695_10074055 Ga0207695_100740552 222
496 3300025914 Ga0207671_10046923 Ga0207671_100469231 222
497 3300025914 Ga0207671_10076476 Ga0207671_100764762 222
498 3300025924 Ga0207694_10136786 Ga0207694_101367862 222
499 3300025944 Ga0207661_10894267 Ga0207661_108942671 222
500 3300025949 Ga0207667_10136705 Ga0207667_101367052 222
501 3300026078 Ga0207702_10142928 Ga0207702_101429283 222
502 3300044656 Ga0466969_0083026 Ga0466969_0083026_66_764 222
503 3300044658 Ga0466972_0032673 Ga0466972_0032673_1759_2457 222
504 3300044658 Ga0466972_0057291 Ga0466972_0057291_1160_1855 222
505 3300044658 Ga0466972_0253398 Ga0466972_0253398_75_770 222
506 3300044683 Ga0466965_0024385 Ga0466965_0024385_2122_2823 222
507 3300044683 Ga0466965_0210086 Ga0466965_0210086_300_995 222
508 3300044684 Ga0466966_0026650 Ga0466966_0026650_2925_3620 222
509 3300044684 Ga0466966_0038382 Ga0466966_0038382_911_1606 222
510 3300044684 Ga0466966_0045094 Ga0466966_0045094_977_1678 222
511 3300044684 Ga0466966_0055571 Ga0466966_0055571_144_839 222
512 3300044684 Ga0466966_0062172 Ga0466966_0062172_1144_1839 222
513 3300044684 Ga0466966_0481787 Ga0466966_0481787_20_715 222
514 3300044693 Ga0466961_0005646 Ga0466961_0005646_4663_5358 222
515 3300044693 Ga0466961_0009564 Ga0466961_0009564_1214_1909 222
516 3300044693 Ga0466961_0010645 Ga0466961_0010645_4860_5561 222
517 3300044693 Ga0466961_0030202 Ga0466961_0030202_2095_2790 222
518 3300044693 Ga0466961_0038407 Ga0466961_0038407_2218_2913 222
519 3300044693 Ga0466961_0047692 Ga0466961_0047692_953_1651 222
520 3300044693 Ga0466961_0203696 Ga0466961_0203696_510_1208 222
521 3300044694 Ga0466963_0044114 Ga0466963_0044114_1344_2045 222
522 3300044706 Ga0466964_0067599 Ga0466964_0067599_257_952 222
523 3300044719 Ga0466971_0010997 Ga0466971_0010997_410_1111 222
524 3300044719 Ga0466971_0014064 Ga0466971_0014064_2679_3374 222
525 3300044719 Ga0466971_0067476 Ga0466971_0067476_900_1598 222
526 3300044719 Ga0466971_0135614 Ga0466971_0135614_56_751 222
527 3300044765 Ga0466970_0049835 Ga0466970_0049835_394_1095 222
528 3300044842 Ga0466957_0045859 Ga0466957_0045859_1428_2126 222
529 3300044842 Ga0466957_0046335 Ga0466957_0046335_1678_2373 222
530 3300044842 Ga0466957_0047152 Ga0466957_0047152_1334_2035 222
531 3300044901 Ga0466960_0000785 Ga0466960_0000785_2810_3505 222
532 3300044901 Ga0466960_0001736 Ga0466960_0001736_2244_2945 222
533 3300045049 Ga0466959_0058435 Ga0466959_0058435_1141_1842 222
534 3300045049 Ga0466959_0066185 Ga0466959_0066185_212_907 222
535 3300045049 Ga0466959_0101800 Ga0466959_0101800_25_720 222
536 3300045049 Ga0466959_0198452 Ga0466959_0198452_554_1249 222
537 3300045049 Ga0466959_0296373 Ga0466959_0296373_118_816 222
538 3300045836 Ga0466958_0041370 Ga0466958_0041370_1088_1783 222
539 3300045836 Ga0466958_0101020 Ga0466958_0101020_138_839 222
540 3300045836 Ga0466958_0163483 Ga0466958_0163483_392_1087 222
541 3300045836 Ga0466958_0581206 Ga0466958_0581206_21_716 222
542 3300045976 Ga0466967_0131052 Ga0466967_0131052_1216_1917 222
543 3300046511 Ga0495608_0439189 Ga0495608_0439189_24_728 222
544 3300048922 Ga0496119_0000276 Ga0496119_0000276_25008_25715 222
545 3300048923 Ga0496120_0017628 Ga0496120_0017628_1061_1768 222
546 3300001915 JGI24741J21665_1016548 JGI24741J21665_10165481 223
547 3300002459 JGI24751J29686_10000695 JGI24751J29686_100006956 223
548 3300004798 Ga0058859_11291813 Ga0058859_112918131 223
549 3300005327 Ga0070658_10273353 Ga0070658_102733531 223
550 3300005329 Ga0070683_100740823 Ga0070683_1007408231 223
551 3300005330 Ga0070690_100122506 Ga0070690_1001225062 223
552 3300005331 Ga0070670_100148793 Ga0070670_1001487932 223
553 3300005334 Ga0068869_100026523 Ga0068869_1000265232 223
554 3300005336 Ga0070680_100006905 Ga0070680_1000069052 223
555 3300005337 Ga0070682_100004812 Ga0070682_1000048123 223
556 3300005338 Ga0068868_100019278 Ga0068868_1000192783 223
557 3300005340 Ga0070689_100044431 Ga0070689_1000444312 223
558 3300005341 Ga0070691_10000766 Ga0070691_100007665 223
559 3300005344 Ga0070661_100013492 Ga0070661_1000134923 223
560 3300005345 Ga0070692_10004966 Ga0070692_100049663 223
561 3300005354 Ga0070675_100039210 Ga0070675_1000392103 223
562 3300005364 Ga0070673_100150800 Ga0070673_1001508002 223
563 3300005365 Ga0070688_100036075 Ga0070688_1000360752 223
564 3300005434 Ga0070709_10012909 Ga0070709_100129092 223
565 3300005435 Ga0070714_100141872 Ga0070714_1001418722 223
566 3300005436 Ga0070713_100001654 Ga0070713_1000016542 223
567 3300005437 Ga0070710_10047479 Ga0070710_100474792 223
568 3300005438 Ga0070701_10062991 Ga0070701_100629912 223
569 3300005440 Ga0070705_100123441 Ga0070705_1001234411 223
570 3300005455 Ga0070663_100008414 Ga0070663_1000084143 223
571 3300005456 Ga0070678_100008274 Ga0070678_1000082743 223
572 3300005459 Ga0068867_100218413 Ga0068867_1002184132 223
573 3300005530 Ga0070679_100020026 Ga0070679_1000200266 223
574 3300005535 Ga0070684_100680595 Ga0070684_1006805951 223
575 3300005547 Ga0070693_100056308 Ga0070693_1000563083 223
576 3300005548 Ga0070665_100029459 Ga0070665_1000294593 223
577 3300005564 Ga0070664_100104341 Ga0070664_1001043412 223
578 3300005577 Ga0068857_100656316 Ga0068857_1006563161 223
579 3300005578 Ga0068854_100070746 Ga0068854_1000707462 223
580 3300005614 Ga0068856_100257194 Ga0068856_1002571942 223
581 3300005615 Ga0070702_100000733 Ga0070702_1000007331 223
582 3300005616 Ga0068852_100017532 Ga0068852_1000175322 223
583 3300005617 Ga0068859_100139800 Ga0068859_1001398002 223
584 3300005618 Ga0068864_100007753 Ga0068864_1000077537 223
585 3300005719 Ga0068861_100276391 Ga0068861_1002763912 223
586 3300005834 Ga0068851_10011468 Ga0068851_100114685 223
587 3300005840 Ga0068870_10001504 Ga0068870_100015045 223
588 3300005841 Ga0068863_100015654 Ga0068863_1000156545 223
589 3300005842 Ga0068858_100027183 Ga0068858_1000271833 223
590 3300005843 Ga0068860_101010140 Ga0068860_1010101401 223
591 3300005983 Ga0081540_1051198 Ga0081540_10511983 223
592 3300006237 Ga0097621_100007324 Ga0097621_1000073243 223
593 3300006358 Ga0068871_100007410 Ga0068871_1000074102 223
594 3300006844 Ga0075428_100655131 Ga0075428_1006551312 223
595 3300006852 Ga0075433_10006704 Ga0075433_100067046 223
596 3300006871 Ga0075434_100024777 Ga0075434_1000247772 223
597 3300006880 Ga0075429_100158853 Ga0075429_1001588531 223
598 3300006914 Ga0075436_100004139 Ga0075436_1000041397 223
599 3300006931 Ga0097620_100139806 Ga0097620_1001398062 223
600 3300007076 Ga0075435_100005125 Ga0075435_1000051255 223
601 3300009011 Ga0105251_10027850 Ga0105251_100278502 223
602 3300009093 Ga0105240_10140469 Ga0105240_101404692 223
603 3300009094 Ga0111539_10051696 Ga0111539_100516963 223
604 3300009094 Ga0111539_10550896 Ga0111539_105508962 223
605 3300009098 Ga0105245_10016117 Ga0105245_100161175 223
606 3300009101 Ga0105247_10103499 Ga0105247_101034992 223
607 3300009147 Ga0114129_10061250 Ga0114129_100612501 223
608 3300009177 Ga0105248_10044819 Ga0105248_100448193 223
609 3300009545 Ga0105237_10024351 Ga0105237_100243512 223
610 3300009553 Ga0105249_10559088 Ga0105249_105590881 223
611 3300010375 Ga0105239_10050341 Ga0105239_100503412 223
612 3300011119 Ga0105246_10005937 Ga0105246_100059373 223
613 3300013100 Ga0157373_10233368 Ga0157373_102333681 223
614 3300013102 Ga0157371_10029273 Ga0157371_100292732 223
615 3300013105 Ga0157369_10130456 Ga0157369_101304562 223
616 3300013296 Ga0157374_10133909 Ga0157374_101339091 223
617 3300013307 Ga0157372_10038556 Ga0157372_100385563 223
618 3300013308 Ga0157375_10032954 Ga0157375_100329543 223
619 3300014325 Ga0163163_10066080 Ga0163163_100660801 223
620 3300014745 Ga0157377_10001463 Ga0157377_100014637 223
621 3300014745 Ga0157377_10408894 Ga0157377_104088941 223
622 3300014968 Ga0157379_10046413 Ga0157379_100464133 223
623 3300020070 Ga0206356_10697636 Ga0206356_106976362 223
624 3300020075 Ga0206349_1492927 Ga0206349_14929272 223
625 3300020076 Ga0206355_1149142 Ga0206355_11491422 223
626 3300020078 Ga0206352_10998045 Ga0206352_109980451 223
627 3300020080 Ga0206350_11508004 Ga0206350_115080042 223
628 3300020081 Ga0206354_10899815 Ga0206354_108998153 223
629 3300020082 Ga0206353_10066264 Ga0206353_100662641 223
630 3300020082 Ga0206353_10745633 Ga0206353_107456332 223
631 3300022467 Ga0224712_10074384 Ga0224712_100743842 223
632 3300025321 Ga0207656_10003024 Ga0207656_100030243 223
633 3300025735 Ga0207713_1033848 Ga0207713_10338482 223
634 3300025898 Ga0207692_10383621 Ga0207692_103836211 223
635 3300025900 Ga0207710_10088771 Ga0207710_100887712 223
636 3300025903 Ga0207680_10243352 Ga0207680_102433522 223
637 3300025904 Ga0207647_10063959 Ga0207647_100639592 223
638 3300025906 Ga0207699_10015308 Ga0207699_100153084 223
639 3300025907 Ga0207645_10010317 Ga0207645_100103173 223
640 3300025908 Ga0207643_10000767 Ga0207643_1000076715 223
641 3300025909 Ga0207705_10003281 Ga0207705_100032816 223
642 3300025911 Ga0207654_10014312 Ga0207654_100143123 223
643 3300025912 Ga0207707_10011969 Ga0207707_100119693 223
644 3300025914 Ga0207671_10127960 Ga0207671_101279602 223
645 3300025915 Ga0207693_10126653 Ga0207693_101266531 223
646 3300025916 Ga0207663_10050352 Ga0207663_100503523 223
647 3300025919 Ga0207657_10025974 Ga0207657_100259741 223
648 3300025921 Ga0207652_10073567 Ga0207652_100735674 223
649 3300025924 Ga0207694_10261139 Ga0207694_102611391 223
650 3300025925 Ga0207650_10002367 Ga0207650_1000236711 223
651 3300025926 Ga0207659_10121319 Ga0207659_101213192 223
652 3300025927 Ga0207687_10004320 Ga0207687_100043203 223
653 3300025928 Ga0207700_10084217 Ga0207700_100842172 223
654 3300025931 Ga0207644_10006695 Ga0207644_100066955 223
655 3300025932 Ga0207690_10024644 Ga0207690_100246441 223
656 3300025932 Ga0207690_10059282 Ga0207690_100592823 223
657 3300025941 Ga0207711_10051681 Ga0207711_100516814 223
658 3300025942 Ga0207689_10058523 Ga0207689_100585232 223
659 3300025944 Ga0207661_10005626 Ga0207661_100056262 223
660 3300025944 Ga0207661_10096274 Ga0207661_100962741 223
661 3300025945 Ga0207679_10022015 Ga0207679_100220152 223
662 3300025945 Ga0207679_10975054 Ga0207679_109750541 223
663 3300025960 Ga0207651_10093262 Ga0207651_100932622 223
664 3300025961 Ga0207712_10353269 Ga0207712_103532692 223
665 3300026023 Ga0207677_10084891 Ga0207677_100848911 223
666 3300026035 Ga0207703_10228213 Ga0207703_102282132 223
667 3300026078 Ga0207702_10001433 Ga0207702_100014335 223
668 3300026078 Ga0207702_10033754 Ga0207702_100337544 223
669 3300026088 Ga0207641_10020478 Ga0207641_100204785 223
670 3300026095 Ga0207676_10001005 Ga0207676_100010055 223
671 3300026121 Ga0207683_10011522 Ga0207683_100115222 223
672 3300026142 Ga0207698_10006669 Ga0207698_100066692 223
673 3300027907 Ga0207428_10001819 Ga0207428_100018195 223
674 3300028379 Ga0268266_10049778 Ga0268266_100497783 223
675 3300028381 Ga0268264_10476508 Ga0268264_104765082 223
676 3300038443 Ga0395901_0238153 Ga0395901_0238153_1131_1823 223
677 3300042005 Ga0439448_0006700 Ga0439448_0006700_2204_2896 223
678 3300044719 Ga0466971_0093222 Ga0466971_0093222_142_906 223
679 3300048903 Ga0496100_0027221 Ga0496100_0027221_2228_2920 223
680 3300048904 Ga0496101_0016324 Ga0496101_0016324_2002_2694 223
681 3300048905 Ga0496102_0002597 Ga0496102_0002597_3151_3843 223
682 3300048907 Ga0496104_0009220 Ga0496104_0009220_7850_8542 223
683 3300048908 Ga0496105_0003598 Ga0496105_0003598_6043_6735 223
684 3300048909 Ga0496106_0051809 Ga0496106_0051809_1292_1984 223
685 3300048910 Ga0496107_0176721 Ga0496107_0176721_837_1529 223
686 3300048911 Ga0496108_0009746 Ga0496108_0009746_3991_4683 223
687 3300048912 Ga0496109_0085550 Ga0496109_0085550_410_1102 223
688 3300048913 Ga0496110_0013512 Ga0496110_0013512_2897_3589 223
689 3300048914 Ga0496111_0007099 Ga0496111_0007099_2315_3007 223
690 3300048915 Ga0496112_0123457 Ga0496112_0123457_355_1047 223
691 3300048916 Ga0496113_0015498 Ga0496113_0015498_4140_4832 223
692 3300048917 Ga0496114_0120519 Ga0496114_0120519_625_1317 223
693 3300050508 nmdc:mga09592_383619_c1 nmdc:mga09592_383619_c1_288_980 223
694 3300050511 nmdc:mga08y16_1868_c1 nmdc:mga08y16_1868_c1_11841_12533 223
695 3300050512 nmdc:mga0n895_15670_c1 nmdc:mga0n895_15670_c1_2943_3635 223
696 3300050513 nmdc:mga0rr50_8639_c1 nmdc:mga0rr50_8639_c1_2916_3608 223
697 3300050514 nmdc:mga08x19_16502_c1 nmdc:mga08x19_16502_c1_1542_2234 223
698 3300050515 nmdc:mga0a205_742_c1 nmdc:mga0a205_742_c1_21810_22502 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02742

Fe_dep_repr_C

Iron dependent repressor, metal binding and dimerisation domain

99

168

0.98

PF01325

Fe_dep_repress

Iron dependent repressor, N-terminal DNA binding domain

37

96

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b25-assembly1.cif.gz_D dtxr-like iron-dependent regulator ider (q43a variant) complexed with cobalt and its consensus dna-binding sequence 0.9809 6 141
7b1y-assembly1.cif.gz_A dtxr-like iron-dependent regulator ider complexed with cobalt and its consensus dna-binding sequence 0.9795 6 141
1f5t-assembly1.cif.gz_A diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence 0.978 5 123
1bi3-assembly1.cif.gz_B structure of apo-and holo-diphtheria toxin repressor 0.9774 7 141
2it0-assembly1.cif.gz_C crystal structure of a two-domain ider-dna complex crystal form ii 0.9751 6 142
ID Description Score Start End Superfamily
1ddnC02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9966 79 122 1.10.60.10
3glxA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9959 9 75 1.10.10.10
1ddnD02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.994 79 122 1.10.60.10
1f5tA02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9922 79 123 1.10.60.10
2iszA02 Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain 0.9867 79 138 1.10.60.10
ID Description Score Start End GO Terms
AF-A0A1W9YTY5-F1-model_v4 Dihydrofolate reductase 0.9947 12 135 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A259S4L2-F1-model_v4 Dihydrofolate reductase 0.9878 5 132 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A1W9YTY5-F1-model_v4 Dihydrofolate reductase 0.9789 12 135 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A259S4L2-F1-model_v4 Dihydrofolate reductase 0.9727 5 132 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983
AF-A0A838FYR1-F1-model_v4 Manganese transport regulator 0.9682 11 136 GO:0003677
GO:0003700
GO:0045892
GO:0046914
GO:0046983

Feature Viewer

pLDDT pTM Quality
85.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map