F475982
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 346 | 644 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0000006|Ga0496126_0000006_359259_360059 |
| Length | 266 |
| Sequence | VAGSATTLNLVVPIVADRPDRRSIEWSWAAVNEHHSALIDTTEMYLRTVYELEEEGVTPLRARIAERLGQSGPTVSQTVARMERDGLLHVAADRHLELSTEGRRQATAVMRKHRLAERLLLDVIGLEWDQVHIEACRWEHVMSDTVERRIIALLEKPLVCPHGNPIPGLRELGLPLTTVDAKLSTTTLLDAAVDDSDAAALVERISEQLQPDDDLMRELIGAGVLPGRNITLRGCPDGVEVDGPSGTAVIDHFTAEHIFVVLPDLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 5 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 6 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 7 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 8 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 9 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 10 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 11 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 12 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 13 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 14 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 15 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 16 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 17 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 18 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 19 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 20 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 21 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 22 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 23 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 24 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 25 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 26 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 27 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 28 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 29 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 30 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 31 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 32 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 33 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 34 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 35 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 36 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 37 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 38 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 39 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 40 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 41 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 42 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 43 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 44 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 45 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 46 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 103 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 104 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 105 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 106 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 107 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 121 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 122 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 126 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 158 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 159 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 161 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 226 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 235 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 236 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 243 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 256 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 257 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 258 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 326 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 328 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 329 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 330 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 335 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 336 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 337 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 338 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 339 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 340 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 341 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 342 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 343 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 344 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 345 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 346 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.11 |
| Metatranscriptomes | 4.15 |
| Isolates | 7.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.29 |
| Nodule | 0.86 |
| Rhizoplane | 6.16 |
| Rhizosphere | 82.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1016548 | 3300001915 | Bacteria | 1202 |
| 2 | JGI24739J22299_10019813 | 3300001989 | Bacteria | 2406 |
| 3 | JGI24739J22299_10075160 | 3300001989 | Bacteria | 1045 |
| 4 | JGI24737J22298_10001587 | 3300001990 | Bacteria | 8081 |
| 5 | JGI24735J21928_10065430 | 3300002067 | Bacteria | 1043 |
| 6 | JGI24751J29686_10000695 | 3300002459 | Bacteria | 8334 |
| 7 | JGI25406J46586_10047396 | 3300003203 | Bacteria | 1465 |
| 8 | Ga0058859_11291813 | 3300004798 | Bacteria | 890 |
| 9 | Ga0070658_10273353 | 3300005327 | Bacteria | 1437 |
| 10 | Ga0070683_100148969 | 3300005329 | Bacteria | 2218 |
| 11 | Ga0070683_100740823 | 3300005329 | Bacteria | 941 |
| 12 | Ga0070683_101071610 | 3300005329 | Bacteria | 774 |
| 13 | Ga0070690_100048870 | 3300005330 | Bacteria | 2696 |
| 14 | Ga0070690_100122506 | 3300005330 | Bacteria | 1747 |
| 15 | Ga0070670_100148793 | 3300005331 | Bacteria | 2026 |
| 16 | Ga0070670_100284830 | 3300005331 | Bacteria | 1443 |
| 17 | Ga0070670_100637768 | 3300005331 | Bacteria | 955 |
| 18 | Ga0068869_100013871 | 3300005334 | Bacteria | 5373 |
| 19 | Ga0068869_100026523 | 3300005334 | Bacteria | 4034 |
| 20 | Ga0068869_100032565 | 3300005334 | Bacteria | 3674 |
| 21 | Ga0070680_100006905 | 3300005336 | Bacteria | 8651 |
| 22 | Ga0070682_100004812 | 3300005337 | Bacteria | 7497 |
| 23 | Ga0070682_100479948 | 3300005337 | Bacteria | 959 |
| 24 | Ga0068868_100012229 | 3300005338 | Bacteria | 6272 |
| 25 | Ga0068868_100019278 | 3300005338 | Bacteria | 5110 |
| 26 | Ga0068868_100019898 | 3300005338 | Bacteria | 5034 |
| 27 | Ga0070660_100051151 | 3300005339 | Bacteria | 3181 |
| 28 | Ga0070689_100044431 | 3300005340 | Bacteria | 3418 |
| 29 | Ga0070691_10000766 | 3300005341 | Bacteria | 12728 |
| 30 | Ga0070691_10009203 | 3300005341 | Bacteria | 4516 |
| 31 | Ga0070687_100072879 | 3300005343 | Bacteria | 1849 |
| 32 | Ga0070661_100013492 | 3300005344 | Bacteria | 5736 |
| 33 | Ga0070692_10004966 | 3300005345 | Bacteria | 5615 |
| 34 | Ga0070692_10012197 | 3300005345 | Bacteria | 3968 |
| 35 | Ga0070692_10036315 | 3300005345 | Bacteria | 2500 |
| 36 | Ga0070668_100026144 | 3300005347 | Bacteria | 4428 |
| 37 | Ga0070668_100070913 | 3300005347 | Bacteria | 2713 |
| 38 | Ga0070668_100316855 | 3300005347 | Bacteria | 1312 |
| 39 | Ga0070669_100078905 | 3300005353 | Bacteria | 2448 |
| 40 | Ga0070675_100001606 | 3300005354 | Bacteria | 16667 |
| 41 | Ga0070675_100039210 | 3300005354 | Bacteria | 3864 |
| 42 | Ga0070671_100008515 | 3300005355 | Bacteria | 8222 |
| 43 | Ga0070671_100455775 | 3300005355 | Bacteria | 1097 |
| 44 | Ga0070674_100326649 | 3300005356 | Bacteria | 1232 |
| 45 | Ga0070673_100022819 | 3300005364 | Bacteria | 4563 |
| 46 | Ga0070673_100150800 | 3300005364 | Bacteria | 1969 |
| 47 | Ga0070688_100036075 | 3300005365 | Bacteria | 3006 |
| 48 | Ga0070659_100009680 | 3300005366 | Bacteria | 7082 |
| 49 | Ga0070659_100026353 | 3300005366 | Bacteria | 4473 |
| 50 | Ga0070667_100042662 | 3300005367 | Bacteria | 3806 |
| 51 | Ga0070709_10012909 | 3300005434 | Bacteria | 4682 |
| 52 | Ga0070714_100000006 | 3300005435 | Bacteria | 293311 |
| 53 | Ga0070714_100041666 | 3300005435 | Bacteria | 3876 |
| 54 | Ga0070714_100141872 | 3300005435 | Bacteria | 2157 |
| 55 | Ga0070714_100260253 | 3300005435 | Bacteria | 1606 |
| 56 | Ga0070713_100001654 | 3300005436 | Bacteria | 14319 |
| 57 | Ga0070713_100340173 | 3300005436 | Bacteria | 1390 |
| 58 | Ga0070713_100698712 | 3300005436 | Bacteria | 968 |
| 59 | Ga0070710_10041589 | 3300005437 | Bacteria | 2538 |
| 60 | Ga0070710_10047479 | 3300005437 | Bacteria | 2395 |
| 61 | Ga0070701_10062991 | 3300005438 | Bacteria | 1961 |
| 62 | Ga0070705_100123441 | 3300005440 | Bacteria | 1676 |
| 63 | Ga0070700_100000011 | 3300005441 | Bacteria | 173076 |
| 64 | Ga0070700_100038003 | 3300005441 | Bacteria | 2931 |
| 65 | Ga0070700_100172755 | 3300005441 | Bacteria | 1498 |
| 66 | Ga0070694_100007551 | 3300005444 | Bacteria | 6636 |
| 67 | Ga0070663_100007178 | 3300005455 | Bacteria | 6768 |
| 68 | Ga0070663_100008414 | 3300005455 | Bacteria | 6345 |
| 69 | Ga0070663_100445085 | 3300005455 | Bacteria | 1067 |
| 70 | Ga0070678_100008274 | 3300005456 | Bacteria | 6223 |
| 71 | Ga0070678_100015145 | 3300005456 | Bacteria | 4891 |
| 72 | Ga0070678_100077711 | 3300005456 | Bacteria | 2505 |
| 73 | Ga0070662_100010109 | 3300005457 | Bacteria | 6183 |
| 74 | Ga0070662_100049004 | 3300005457 | Bacteria | 3045 |
| 75 | Ga0070681_10207867 | 3300005458 | Bacteria | 1874 |
| 76 | Ga0068867_100218413 | 3300005459 | Bacteria | 1535 |
| 77 | Ga0070685_10045194 | 3300005466 | Bacteria | 2524 |
| 78 | Ga0070698_100421595 | 3300005471 | Bacteria | 1269 |
| 79 | Ga0070679_100020026 | 3300005530 | Bacteria | 6519 |
| 80 | Ga0070679_100100074 | 3300005530 | Bacteria | 2886 |
| 81 | Ga0070679_100667540 | 3300005530 | Bacteria | 982 |
| 82 | Ga0070684_100010223 | 3300005535 | Bacteria | 7427 |
| 83 | Ga0070684_100680595 | 3300005535 | Bacteria | 958 |
| 84 | Ga0068853_100025489 | 3300005539 | Bacteria | 4963 |
| 85 | Ga0068853_100280574 | 3300005539 | Bacteria | 1536 |
| 86 | Ga0070686_100027534 | 3300005544 | Bacteria | 3440 |
| 87 | Ga0070693_100047311 | 3300005547 | Bacteria | 2447 |
| 88 | Ga0070693_100056308 | 3300005547 | Bacteria | 2268 |
| 89 | Ga0070693_100078620 | 3300005547 | Bacteria | 1961 |
| 90 | Ga0070665_100000583 | 3300005548 | Bacteria | 50878 |
| 91 | Ga0070665_100029459 | 3300005548 | Bacteria | 5525 |
| 92 | Ga0070665_100110403 | 3300005548 | Bacteria | 2753 |
| 93 | Ga0070665_100153571 | 3300005548 | Bacteria | 2304 |
| 94 | Ga0070704_100014714 | 3300005549 | Bacteria | 4892 |
| 95 | Ga0068855_100018263 | 3300005563 | Bacteria | 8424 |
| 96 | Ga0068855_100028337 | 3300005563 | Bacteria | 6699 |
| 97 | Ga0068855_100208469 | 3300005563 | Bacteria | 2197 |
| 98 | Ga0070664_100000984 | 3300005564 | Bacteria | 22323 |
| 99 | Ga0070664_100093138 | 3300005564 | Bacteria | 2610 |
| 100 | Ga0070664_100104341 | 3300005564 | Bacteria | 2468 |
| 101 | Ga0068857_100031821 | 3300005577 | Bacteria | 4661 |
| 102 | Ga0068857_100356545 | 3300005577 | Bacteria | 1355 |
| 103 | Ga0068857_100656316 | 3300005577 | Bacteria | 994 |
| 104 | Ga0068854_100070746 | 3300005578 | Bacteria | 2550 |
| 105 | Ga0068854_100503823 | 3300005578 | Bacteria | 1020 |
| 106 | Ga0068856_100002291 | 3300005614 | Bacteria | 19725 |
| 107 | Ga0068856_100257194 | 3300005614 | Bacteria | 1761 |
| 108 | Ga0068856_100683443 | 3300005614 | Bacteria | 1047 |
| 109 | Ga0070702_100000733 | 3300005615 | Bacteria | 12417 |
| 110 | Ga0068852_100017532 | 3300005616 | Bacteria | 5621 |
| 111 | Ga0068852_100093885 | 3300005616 | Bacteria | 2690 |
| 112 | Ga0068859_100007500 | 3300005617 | Bacteria | 11068 |
| 113 | Ga0068859_100037500 | 3300005617 | Bacteria | 4864 |
| 114 | Ga0068859_100139800 | 3300005617 | Bacteria | 2495 |
| 115 | Ga0068859_100438591 | 3300005617 | Bacteria | 1402 |
| 116 | Ga0068864_100007753 | 3300005618 | Bacteria | 8844 |
| 117 | Ga0068864_100118838 | 3300005618 | Bacteria | 2361 |
| 118 | Ga0068866_10137612 | 3300005718 | Bacteria | 1398 |
| 119 | Ga0068861_100016781 | 3300005719 | Bacteria | 5188 |
| 120 | Ga0068861_100072988 | 3300005719 | Bacteria | 2664 |
| 121 | Ga0068861_100276391 | 3300005719 | Bacteria | 1444 |
| 122 | Ga0068851_10011468 | 3300005834 | Bacteria | 4159 |
| 123 | Ga0068851_10115071 | 3300005834 | Bacteria | 1440 |
| 124 | Ga0068870_10001504 | 3300005840 | Bacteria | 9453 |
| 125 | Ga0068863_100001923 | 3300005841 | Bacteria | 20617 |
| 126 | Ga0068863_100015654 | 3300005841 | Bacteria | 7282 |
| 127 | Ga0068863_100035481 | 3300005841 | Bacteria | 4750 |
| 128 | Ga0068858_100020875 | 3300005842 | Bacteria | 6122 |
| 129 | Ga0068858_100027183 | 3300005842 | Bacteria | 5315 |
| 130 | Ga0068858_100078839 | 3300005842 | Bacteria | 3060 |
| 131 | Ga0068860_100000043 | 3300005843 | Bacteria | 225862 |
| 132 | Ga0068860_100023775 | 3300005843 | Bacteria | 5924 |
| 133 | Ga0068860_101010140 | 3300005843 | Bacteria | 850 |
| 134 | Ga0081455_10061462 | 3300005937 | Bacteria | 3161 |
| 135 | Ga0081540_1006605 | 3300005983 | Bacteria | 8414 |
| 136 | Ga0081540_1009262 | 3300005983 | Bacteria | 6792 |
| 137 | Ga0081540_1010669 | 3300005983 | Bacteria | 6197 |
| 138 | Ga0081540_1051198 | 3300005983 | Bacteria | 2044 |
| 139 | Ga0081540_1065856 | 3300005983 | Bacteria | 1701 |
| 140 | Ga0081539_10000536 | 3300005985 | Bacteria | 78807 |
| 141 | Ga0081539_10000709 | 3300005985 | Bacteria | 66741 |
| 142 | Ga0081539_10003417 | 3300005985 | Bacteria | 19544 |
| 143 | Ga0081539_10019247 | 3300005985 | Bacteria | 4683 |
| 144 | Ga0081539_10089590 | 3300005985 | Bacteria | 1593 |
| 145 | Ga0070717_10289165 | 3300006028 | Bacteria | 1455 |
| 146 | Ga0070716_100019555 | 3300006173 | Bacteria | 3540 |
| 147 | Ga0070716_100518198 | 3300006173 | Bacteria | 883 |
| 148 | Ga0070712_100012110 | 3300006175 | Bacteria | 5480 |
| 149 | Ga0097621_100007324 | 3300006237 | Bacteria | 7887 |
| 150 | Ga0097621_100083652 | 3300006237 | Bacteria | 2659 |
| 151 | Ga0068871_100007410 | 3300006358 | Bacteria | 7836 |
| 152 | Ga0068871_100159110 | 3300006358 | Bacteria | 1931 |
| 153 | Ga0075428_100022273 | 3300006844 | Bacteria | 7015 |
| 154 | Ga0075428_100381115 | 3300006844 | Bacteria | 1512 |
| 155 | Ga0075428_100655131 | 3300006844 | Bacteria | 1120 |
| 156 | Ga0075430_100009448 | 3300006846 | Bacteria | 8239 |
| 157 | Ga0075430_100022154 | 3300006846 | Bacteria | 5401 |
| 158 | Ga0075431_100015245 | 3300006847 | Bacteria | 7790 |
| 159 | Ga0075431_100025021 | 3300006847 | Bacteria | 6120 |
| 160 | Ga0075431_100053468 | 3300006847 | Bacteria | 4164 |
| 161 | Ga0075433_10006704 | 3300006852 | Bacteria | 9118 |
| 162 | Ga0075433_10016078 | 3300006852 | Bacteria | 6157 |
| 163 | Ga0075434_100016850 | 3300006871 | Bacteria | 7030 |
| 164 | Ga0075434_100024777 | 3300006871 | Bacteria | 5866 |
| 165 | Ga0075429_100158853 | 3300006880 | Bacteria | 1979 |
| 166 | Ga0075429_100360414 | 3300006880 | Bacteria | 1273 |
| 167 | Ga0075436_100004139 | 3300006914 | Bacteria | 9954 |
| 168 | Ga0075436_100037954 | 3300006914 | Bacteria | 3325 |
| 169 | Ga0097620_100007500 | 3300006931 | Bacteria | 11068 |
| 170 | Ga0097620_100037501 | 3300006931 | Bacteria | 4864 |
| 171 | Ga0097620_100139806 | 3300006931 | Bacteria | 2495 |
| 172 | Ga0097620_100438643 | 3300006931 | Bacteria | 1402 |
| 173 | Ga0075435_100005125 | 3300007076 | Bacteria | 9108 |
| 174 | Ga0075435_100011796 | 3300007076 | Bacteria | 6449 |
| 175 | Ga0105251_10027028 | 3300009011 | Bacteria | 2914 |
| 176 | Ga0105251_10027850 | 3300009011 | Bacteria | 2859 |
| 177 | Ga0105240_10076218 | 3300009093 | Bacteria | 4135 |
| 178 | Ga0105240_10107868 | 3300009093 | Bacteria | 3375 |
| 179 | Ga0105240_10140469 | 3300009093 | Bacteria | 2888 |
| 180 | Ga0111539_10017696 | 3300009094 | Bacteria | 8822 |
| 181 | Ga0111539_10051696 | 3300009094 | Bacteria | 4893 |
| 182 | Ga0111539_10550896 | 3300009094 | Bacteria | 1343 |
| 183 | Ga0105245_10016117 | 3300009098 | Bacteria | 6512 |
| 184 | Ga0105245_10044524 | 3300009098 | Bacteria | 3962 |
| 185 | Ga0105245_10430511 | 3300009098 | Bacteria | 1324 |
| 186 | Ga0105247_10103499 | 3300009101 | Bacteria | 1823 |
| 187 | Ga0114129_10009483 | 3300009147 | Bacteria | 13876 |
| 188 | Ga0114129_10013774 | 3300009147 | Bacteria | 11525 |
| 189 | Ga0114129_10041652 | 3300009147 | Bacteria | 6469 |
| 190 | Ga0114129_10061250 | 3300009147 | Bacteria | 5259 |
| 191 | Ga0114129_10381498 | 3300009147 | Bacteria | 1861 |
| 192 | Ga0105243_10026434 | 3300009148 | Bacteria | 4442 |
| 193 | Ga0105241_10360934 | 3300009174 | Bacteria | 1264 |
| 194 | Ga0105248_10038236 | 3300009177 | Bacteria | 5370 |
| 195 | Ga0105248_10044819 | 3300009177 | Bacteria | 4961 |
| 196 | Ga0105237_10024351 | 3300009545 | Bacteria | 6194 |
| 197 | Ga0105237_10024906 | 3300009545 | Bacteria | 6122 |
| 198 | Ga0105237_10175889 | 3300009545 | Bacteria | 2140 |
| 199 | Ga0105237_10351057 | 3300009545 | Bacteria | 1479 |
| 200 | Ga0105238_10068670 | 3300009551 | Bacteria | 3545 |
| 201 | Ga0105238_10692597 | 3300009551 | Bacteria | 1031 |
| 202 | Ga0105249_10012741 | 3300009553 | Bacteria | 7412 |
| 203 | Ga0105249_10106899 | 3300009553 | Bacteria | 2640 |
| 204 | Ga0105249_10343568 | 3300009553 | Bacteria | 1510 |
| 205 | Ga0105249_10551047 | 3300009553 | Bacteria | 1204 |
| 206 | Ga0105249_10559088 | 3300009553 | Bacteria | 1195 |
| 207 | Ga0105239_10050341 | 3300010375 | Bacteria | 4569 |
| 208 | Ga0105239_10068314 | 3300010375 | Bacteria | 3905 |
| 209 | Ga0105239_10092612 | 3300010375 | Bacteria | 3336 |
| 210 | Ga0105239_11004481 | 3300010375 | Bacteria | 959 |
| 211 | Ga0105246_10005937 | 3300011119 | Bacteria | 7453 |
| 212 | Ga0105246_10027733 | 3300011119 | Bacteria | 3715 |
| 213 | Ga0157373_10233368 | 3300013100 | Bacteria | 1300 |
| 214 | Ga0157371_10029273 | 3300013102 | Bacteria | 3985 |
| 215 | Ga0157370_10030742 | 3300013104 | Bacteria | 5260 |
| 216 | Ga0157370_10031251 | 3300013104 | Bacteria | 5211 |
| 217 | Ga0157369_10130456 | 3300013105 | Bacteria | 2664 |
| 218 | Ga0157374_10026072 | 3300013296 | Bacteria | 5256 |
| 219 | Ga0157374_10133909 | 3300013296 | Bacteria | 2401 |
| 220 | Ga0157378_10028408 | 3300013297 | Bacteria | 4935 |
| 221 | Ga0163162_10024324 | 3300013306 | Bacteria | 5977 |
| 222 | Ga0163162_10183866 | 3300013306 | Bacteria | 2217 |
| 223 | Ga0157372_10000572 | 3300013307 | Bacteria | 40323 |
| 224 | Ga0157372_10038556 | 3300013307 | Bacteria | 5274 |
| 225 | Ga0157375_10032954 | 3300013308 | Bacteria | 4918 |
| 226 | Ga0163163_10066080 | 3300014325 | Bacteria | 3591 |
| 227 | Ga0163163_10225507 | 3300014325 | Bacteria | 1923 |
| 228 | Ga0157380_11063618 | 3300014326 | Bacteria | 846 |
| 229 | Ga0157377_10001463 | 3300014745 | Bacteria | 10217 |
| 230 | Ga0157377_10003575 | 3300014745 | Bacteria | 7035 |
| 231 | Ga0157377_10408894 | 3300014745 | Bacteria | 926 |
| 232 | Ga0157379_10046413 | 3300014968 | Bacteria | 3875 |
| 233 | Ga0163161_10008970 | 3300017792 | Bacteria | 6917 |
| 234 | Ga0197907_10054147 | 3300020069 | Bacteria | 2636 |
| 235 | Ga0197907_10472253 | 3300020069 | Bacteria | 1919 |
| 236 | Ga0197907_11509860 | 3300020069 | Bacteria | 2219 |
| 237 | Ga0206356_10697636 | 3300020070 | Bacteria | 1415 |
| 238 | Ga0206356_10832449 | 3300020070 | Bacteria | 1983 |
| 239 | Ga0206356_10895185 | 3300020070 | Bacteria | 1427 |
| 240 | Ga0206349_1492927 | 3300020075 | Bacteria | 2272 |
| 241 | Ga0206355_1149142 | 3300020076 | Bacteria | 1142 |
| 242 | Ga0206355_1559621 | 3300020076 | Bacteria | 2303 |
| 243 | Ga0206351_10099769 | 3300020077 | Bacteria | 1901 |
| 244 | Ga0206352_10998045 | 3300020078 | Bacteria | 1121 |
| 245 | Ga0206350_10343000 | 3300020080 | Bacteria | 1903 |
| 246 | Ga0206350_10484499 | 3300020080 | Bacteria | 963 |
| 247 | Ga0206350_10560694 | 3300020080 | Bacteria | 1953 |
| 248 | Ga0206350_11508004 | 3300020080 | Bacteria | 1022 |
| 249 | Ga0206350_11523504 | 3300020080 | Bacteria | 2043 |
| 250 | Ga0206354_10024162 | 3300020081 | Bacteria | 2100 |
| 251 | Ga0206354_10899815 | 3300020081 | Bacteria | 2771 |
| 252 | Ga0206354_11484205 | 3300020081 | Bacteria | 2842 |
| 253 | Ga0206353_10066264 | 3300020082 | Bacteria | 904 |
| 254 | Ga0206353_10745633 | 3300020082 | Bacteria | 1756 |
| 255 | Ga0206353_11129427 | 3300020082 | Bacteria | 3475 |
| 256 | Ga0206353_11329945 | 3300020082 | Bacteria | 1636 |
| 257 | Ga0206353_11529310 | 3300020082 | Bacteria | 2411 |
| 258 | Ga0224712_10011470 | 3300022467 | Bacteria | 2752 |
| 259 | Ga0224712_10016089 | 3300022467 | Bacteria | 2449 |
| 260 | Ga0224712_10074384 | 3300022467 | Bacteria | 1388 |
| 261 | Ga0224712_10113989 | 3300022467 | Bacteria | 1163 |
| 262 | Ga0207656_10003024 | 3300025321 | Bacteria | 5754 |
| 263 | Ga0207713_1033848 | 3300025735 | Bacteria | 2226 |
| 264 | Ga0207692_10021505 | 3300025898 | Bacteria | 2952 |
| 265 | Ga0207692_10383621 | 3300025898 | Bacteria | 873 |
| 266 | Ga0207642_10027317 | 3300025899 | Bacteria | 2334 |
| 267 | Ga0207710_10038767 | 3300025900 | Bacteria | 2108 |
| 268 | Ga0207710_10088771 | 3300025900 | Bacteria | 1444 |
| 269 | Ga0207688_10010631 | 3300025901 | Bacteria | 5006 |
| 270 | Ga0207688_10032413 | 3300025901 | Bacteria | 2888 |
| 271 | Ga0207680_10123215 | 3300025903 | Bacteria | 1698 |
| 272 | Ga0207680_10243352 | 3300025903 | Bacteria | 1240 |
| 273 | Ga0207647_10022378 | 3300025904 | Bacteria | 4198 |
| 274 | Ga0207647_10030415 | 3300025904 | Bacteria | 3484 |
| 275 | Ga0207647_10063959 | 3300025904 | Bacteria | 2236 |
| 276 | Ga0207647_10077381 | 3300025904 | Bacteria | 1999 |
| 277 | Ga0207685_10042083 | 3300025905 | Bacteria | 1713 |
| 278 | Ga0207699_10015308 | 3300025906 | Bacteria | 3981 |
| 279 | Ga0207699_10063981 | 3300025906 | Bacteria | 2224 |
| 280 | Ga0207645_10010317 | 3300025907 | Bacteria | 6414 |
| 281 | Ga0207643_10000767 | 3300025908 | Bacteria | 19624 |
| 282 | Ga0207705_10003281 | 3300025909 | Bacteria | 12322 |
| 283 | Ga0207654_10014312 | 3300025911 | Bacteria | 4098 |
| 284 | Ga0207707_10011969 | 3300025912 | Bacteria | 7545 |
| 285 | Ga0207707_10178109 | 3300025912 | Bacteria | 1857 |
| 286 | Ga0207695_10074055 | 3300025913 | Bacteria | 3467 |
| 287 | Ga0207695_10117098 | 3300025913 | Bacteria | 2638 |
| 288 | Ga0207695_10527083 | 3300025913 | Bacteria | 1063 |
| 289 | Ga0207671_10046923 | 3300025914 | Bacteria | 3196 |
| 290 | Ga0207671_10076476 | 3300025914 | Bacteria | 2505 |
| 291 | Ga0207671_10127960 | 3300025914 | Bacteria | 1947 |
| 292 | Ga0207693_10002556 | 3300025915 | Bacteria | 15818 |
| 293 | Ga0207693_10126653 | 3300025915 | Bacteria | 2007 |
| 294 | Ga0207663_10050352 | 3300025916 | Bacteria | 2588 |
| 295 | Ga0207660_10561794 | 3300025917 | Bacteria | 928 |
| 296 | Ga0207657_10025974 | 3300025919 | Bacteria | 5391 |
| 297 | Ga0207657_10056954 | 3300025919 | Bacteria | 3371 |
| 298 | Ga0207652_10073567 | 3300025921 | Bacteria | 2973 |
| 299 | Ga0207652_10108915 | 3300025921 | Bacteria | 2455 |
| 300 | Ga0207652_10601460 | 3300025921 | Bacteria | 986 |
| 301 | Ga0207694_10127414 | 3300025924 | Bacteria | 2038 |
| 302 | Ga0207694_10136786 | 3300025924 | Bacteria | 1968 |
| 303 | Ga0207694_10261139 | 3300025924 | Bacteria | 1419 |
| 304 | Ga0207694_10382995 | 3300025924 | Bacteria | 1168 |
| 305 | Ga0207650_10002367 | 3300025925 | Bacteria | 13116 |
| 306 | Ga0207659_10020914 | 3300025926 | Bacteria | 4334 |
| 307 | Ga0207659_10121319 | 3300025926 | Bacteria | 2003 |
| 308 | Ga0207687_10004320 | 3300025927 | Bacteria | 9488 |
| 309 | Ga0207687_10026136 | 3300025927 | Bacteria | 3909 |
| 310 | Ga0207687_10030883 | 3300025927 | Bacteria | 3616 |
| 311 | Ga0207687_10055765 | 3300025927 | Bacteria | 2770 |
| 312 | Ga0207700_10084217 | 3300025928 | Bacteria | 2492 |
| 313 | Ga0207700_10270933 | 3300025928 | Bacteria | 1457 |
| 314 | Ga0207664_10000062 | 3300025929 | Bacteria | 114238 |
| 315 | Ga0207664_10192941 | 3300025929 | Bacteria | 1754 |
| 316 | Ga0207644_10006695 | 3300025931 | Bacteria | 7507 |
| 317 | Ga0207644_10007960 | 3300025931 | Bacteria | 6931 |
| 318 | Ga0207690_10011066 | 3300025932 | Bacteria | 5381 |
| 319 | Ga0207690_10024644 | 3300025932 | Bacteria | 3770 |
| 320 | Ga0207690_10059282 | 3300025932 | Bacteria | 2593 |
| 321 | Ga0207706_10015986 | 3300025933 | Bacteria | 6780 |
| 322 | Ga0207706_10026723 | 3300025933 | Bacteria | 5167 |
| 323 | Ga0207686_10062672 | 3300025934 | Bacteria | 2362 |
| 324 | Ga0207686_10395769 | 3300025934 | Bacteria | 1051 |
| 325 | Ga0207670_10068986 | 3300025936 | Bacteria | 2438 |
| 326 | Ga0207669_10293701 | 3300025937 | Bacteria | 1232 |
| 327 | Ga0207665_10000377 | 3300025939 | Bacteria | 30785 |
| 328 | Ga0207665_10279579 | 3300025939 | Bacteria | 1242 |
| 329 | Ga0207691_10574914 | 3300025940 | Bacteria | 955 |
| 330 | Ga0207711_10030837 | 3300025941 | Bacteria | 4523 |
| 331 | Ga0207711_10051681 | 3300025941 | Bacteria | 3520 |
| 332 | Ga0207711_10092547 | 3300025941 | Bacteria | 2661 |
| 333 | Ga0207689_10008040 | 3300025942 | Bacteria | 9205 |
| 334 | Ga0207689_10022357 | 3300025942 | Bacteria | 5318 |
| 335 | Ga0207689_10058523 | 3300025942 | Bacteria | 3170 |
| 336 | Ga0207661_10005626 | 3300025944 | Bacteria | 8838 |
| 337 | Ga0207661_10096274 | 3300025944 | Bacteria | 2476 |
| 338 | Ga0207661_10104294 | 3300025944 | Bacteria | 2387 |
| 339 | Ga0207661_10121391 | 3300025944 | Bacteria | 2225 |
| 340 | Ga0207661_10894267 | 3300025944 | Bacteria | 818 |
| 341 | Ga0207679_10010901 | 3300025945 | Bacteria | 5861 |
| 342 | Ga0207679_10022015 | 3300025945 | Bacteria | 4333 |
| 343 | Ga0207679_10975054 | 3300025945 | Bacteria | 777 |
| 344 | Ga0207667_10136705 | 3300025949 | Bacteria | 2524 |
| 345 | Ga0207667_10372205 | 3300025949 | Bacteria | 1456 |
| 346 | Ga0207667_10412829 | 3300025949 | Bacteria | 1374 |
| 347 | Ga0207651_10093262 | 3300025960 | Bacteria | 2210 |
| 348 | Ga0207712_10018188 | 3300025961 | Bacteria | 4574 |
| 349 | Ga0207712_10246645 | 3300025961 | Bacteria | 1441 |
| 350 | Ga0207712_10302330 | 3300025961 | Bacteria | 1313 |
| 351 | Ga0207712_10353269 | 3300025961 | Bacteria | 1223 |
| 352 | Ga0207668_10046090 | 3300025972 | Bacteria | 2977 |
| 353 | Ga0207668_10056157 | 3300025972 | Bacteria | 2741 |
| 354 | Ga0207668_10132036 | 3300025972 | Bacteria | 1908 |
| 355 | Ga0207640_10291440 | 3300025981 | Bacteria | 1287 |
| 356 | Ga0207677_10004763 | 3300026023 | Bacteria | 7318 |
| 357 | Ga0207677_10041489 | 3300026023 | Bacteria | 3043 |
| 358 | Ga0207677_10084891 | 3300026023 | Bacteria | 2284 |
| 359 | Ga0207703_10061420 | 3300026035 | Bacteria | 3076 |
| 360 | Ga0207703_10228213 | 3300026035 | Bacteria | 1668 |
| 361 | Ga0207639_10031394 | 3300026041 | Bacteria | 3904 |
| 362 | Ga0207678_10010962 | 3300026067 | Bacteria | 7966 |
| 363 | Ga0207678_10027937 | 3300026067 | Bacteria | 4925 |
| 364 | Ga0207678_10367799 | 3300026067 | Bacteria | 1242 |
| 365 | Ga0207708_10000009 | 3300026075 | Bacteria | 235909 |
| 366 | Ga0207708_10071639 | 3300026075 | Bacteria | 2655 |
| 367 | Ga0207702_10001433 | 3300026078 | Bacteria | 23769 |
| 368 | Ga0207702_10033754 | 3300026078 | Bacteria | 4275 |
| 369 | Ga0207702_10142928 | 3300026078 | Bacteria | 2168 |
| 370 | Ga0207702_10793955 | 3300026078 | Bacteria | 936 |
| 371 | Ga0207641_10003044 | 3300026088 | Bacteria | 15106 |
| 372 | Ga0207641_10020478 | 3300026088 | Bacteria | 5432 |
| 373 | Ga0207676_10001005 | 3300026095 | Bacteria | 21710 |
| 374 | Ga0207676_10091114 | 3300026095 | Bacteria | 2504 |
| 375 | Ga0207676_10193444 | 3300026095 | Bacteria | 1792 |
| 376 | Ga0207674_10069209 | 3300026116 | Bacteria | 3550 |
| 377 | Ga0207674_10122745 | 3300026116 | Bacteria | 2564 |
| 378 | Ga0207674_10285589 | 3300026116 | Bacteria | 1598 |
| 379 | Ga0207675_100044806 | 3300026118 | Bacteria | 4133 |
| 380 | Ga0207675_100095087 | 3300026118 | Bacteria | 2803 |
| 381 | Ga0207683_10000462 | 3300026121 | Bacteria | 37793 |
| 382 | Ga0207683_10011522 | 3300026121 | Bacteria | 7548 |
| 383 | Ga0207683_10146778 | 3300026121 | Bacteria | 2127 |
| 384 | Ga0207698_10003632 | 3300026142 | Bacteria | 9311 |
| 385 | Ga0207698_10006669 | 3300026142 | Bacteria | 7216 |
| 386 | Ga0207698_10131092 | 3300026142 | Bacteria | 2142 |
| 387 | Ga0207698_10566250 | 3300026142 | Bacteria | 1116 |
| 388 | Ga0207428_10001819 | 3300027907 | Bacteria | 21829 |
| 389 | Ga0207428_10009693 | 3300027907 | Bacteria | 8629 |
| 390 | Ga0268266_10010053 | 3300028379 | Bacteria | 8295 |
| 391 | Ga0268266_10028258 | 3300028379 | Bacteria | 4768 |
| 392 | Ga0268266_10049778 | 3300028379 | Bacteria | 3594 |
| 393 | Ga0268266_10097607 | 3300028379 | Bacteria | 2584 |
| 394 | Ga0268265_11160322 | 3300028380 | Bacteria | 769 |
| 395 | Ga0268264_10000027 | 3300028381 | Bacteria | 440852 |
| 396 | Ga0268264_10476508 | 3300028381 | Bacteria | 1213 |
| 397 | Ga0307517_10098149 | 3300028786 | Bacteria | 2333 |
| 398 | Ga0307517_10126827 | 3300028786 | Bacteria | 1858 |
| 399 | Ga0307515_10000241 | 3300028794 | Bacteria | 135591 |
| 400 | Ga0307515_10002981 | 3300028794 | Bacteria | 35943 |
| 401 | Ga0307515_10040140 | 3300028794 | Bacteria | 7411 |
| 402 | Ga0307515_10043558 | 3300028794 | Bacteria | 6970 |
| 403 | Ga0307515_10218685 | 3300028794 | Bacteria | 1729 |
| 404 | Ga0307512_10003152 | 3300030522 | Bacteria | 19595 |
| 405 | Ga0307512_10006215 | 3300030522 | Bacteria | 12171 |
| 406 | Ga0307513_10000007 | 3300031456 | Bacteria | 451043 |
| 407 | Ga0307513_10020898 | 3300031456 | Bacteria | 7745 |
| 408 | Ga0307513_10294356 | 3300031456 | Bacteria | 1393 |
| 409 | Ga0307513_10345968 | 3300031456 | Bacteria | 1236 |
| 410 | Ga0307513_10606857 | 3300031456 | Bacteria | 803 |
| 411 | Ga0307509_10370337 | 3300031507 | Bacteria | 1149 |
| 412 | Ga0307408_100284047 | 3300031548 | Bacteria | 1379 |
| 413 | Ga0307508_10001698 | 3300031616 | Bacteria | 24436 |
| 414 | Ga0307508_10014255 | 3300031616 | Bacteria | 7250 |
| 415 | Ga0307508_10026635 | 3300031616 | Bacteria | 5239 |
| 416 | Ga0307516_10013193 | 3300031730 | Bacteria | 8824 |
| 417 | Ga0307516_10017972 | 3300031730 | Bacteria | 7357 |
| 418 | Ga0307516_10034862 | 3300031730 | Bacteria | 5053 |
| 419 | Ga0307516_10077699 | 3300031730 | Bacteria | 3167 |
| 420 | Ga0307405_10064589 | 3300031731 | Bacteria | 2327 |
| 421 | Ga0307405_10068504 | 3300031731 | Bacteria | 2271 |
| 422 | Ga0307413_10030269 | 3300031824 | Bacteria | 3040 |
| 423 | Ga0307413_10697241 | 3300031824 | Bacteria | 843 |
| 424 | Ga0307410_10182556 | 3300031852 | Bacteria | 1589 |
| 425 | Ga0307410_10445392 | 3300031852 | Bacteria | 1055 |
| 426 | Ga0326468_10000349 | 3300031889 | Bacteria | 4900 |
| 427 | Ga0307406_10156531 | 3300031901 | Bacteria | 1632 |
| 428 | Ga0307406_10547102 | 3300031901 | Bacteria | 946 |
| 429 | Ga0307407_10076120 | 3300031903 | Bacteria | 2014 |
| 430 | Ga0307409_100014850 | 3300031995 | Bacteria | 5085 |
| 431 | Ga0307409_100043830 | 3300031995 | Bacteria | 3364 |
| 432 | Ga0307409_100075412 | 3300031995 | Bacteria | 2700 |
| 433 | Ga0307409_100118775 | 3300031995 | Bacteria | 2234 |
| 434 | Ga0307409_100146938 | 3300031995 | Bacteria | 2040 |
| 435 | Ga0307416_100046933 | 3300032002 | Bacteria | 3414 |
| 436 | Ga0307411_10202071 | 3300032005 | Bacteria | 1527 |
| 437 | Ga0307411_10457623 | 3300032005 | Bacteria | 1069 |
| 438 | Ga0307415_100821504 | 3300032126 | Bacteria | 850 |
| 439 | Ga0373929_0036903 | 3300035085 | Bacteria | 1069 |
| 440 | Ga0373940_0004094 | 3300035088 | Bacteria | 3052 |
| 441 | Ga0373940_0032710 | 3300035088 | Bacteria | 1395 |
| 442 | Ga0373951_0000082 | 3300035091 | Bacteria | 37430 |
| 443 | Ga0373951_0005625 | 3300035091 | Bacteria | 2902 |
| 444 | Ga0373939_0005397 | 3300035114 | Bacteria | 3045 |
| 445 | Ga0373941_0038233 | 3300035115 | Bacteria | 1468 |
| 446 | Ga0373946_0278835 | 3300035171 | Bacteria | 822 |
| 447 | Ga0373942_0000346 | 3300035207 | Bacteria | 12686 |
| 448 | Ga0373942_0057807 | 3300035207 | Bacteria | 1104 |
| 449 | Ga0373962_0000467 | 3300035242 | Bacteria | 8938 |
| 450 | Ga0373962_0034407 | 3300035242 | Bacteria | 1403 |
| 451 | Ga0373931_0007216 | 3300035691 | Bacteria | 5230 |
| 452 | Ga0373935_0007985 | 3300035692 | Bacteria | 6345 |
| 453 | Ga0373927_0013483 | 3300035695 | Bacteria | 5432 |
| 454 | Ga0373937_0242444 | 3300036401 | Bacteria | 1698 |
| 455 | Ga0395899_0039002 | 3300037312 | Bacteria | 3557 |
| 456 | Ga0395900_0044475 | 3300037418 | Bacteria | 4575 |
| 457 | Ga0395900_0049190 | 3300037418 | Bacteria | 4343 |
| 458 | Ga0395898_0017719 | 3300037466 | Bacteria | 7268 |
| 459 | Ga0395898_0034373 | 3300037466 | Bacteria | 5053 |
| 460 | Ga0395905_0013660 | 3300037471 | Bacteria | 7777 |
| 461 | Ga0395905_0043022 | 3300037471 | Bacteria | 4238 |
| 462 | Ga0395901_0018354 | 3300038443 | Bacteria | 7141 |
| 463 | Ga0395901_0030528 | 3300038443 | Bacteria | 5553 |
| 464 | Ga0395901_0238153 | 3300038443 | Bacteria | 1899 |
| 465 | Ga0436365_1019911 | 3300039437 | Bacteria | 5166 |
| 466 | Ga0436365_1132394 | 3300039437 | Bacteria | 3218 |
| 467 | Ga0436363_1342941 | 3300039450 | Bacteria | 1956 |
| 468 | Ga0451791_1235265 | 3300041451 | Bacteria | 2518 |
| 469 | Ga0451793_0196981 | 3300041452 | Bacteria | 957 |
| 470 | Ga0439448_0006700 | 3300042005 | Bacteria | 3320 |
| 471 | Ga0466969_0051965 | 3300044656 | Bacteria | 2015 |
| 472 | Ga0466969_0083026 | 3300044656 | Bacteria | 1526 |
| 473 | Ga0466972_0032673 | 3300044658 | Bacteria | 2555 |
| 474 | Ga0466972_0057291 | 3300044658 | Bacteria | 1872 |
| 475 | Ga0466972_0139281 | 3300044658 | Bacteria | 1142 |
| 476 | Ga0466972_0166989 | 3300044658 | Bacteria | 1033 |
| 477 | Ga0466972_0253398 | 3300044658 | Bacteria | 823 |
| 478 | Ga0466965_0024385 | 3300044683 | Bacteria | 2926 |
| 479 | Ga0466965_0123030 | 3300044683 | Bacteria | 1341 |
| 480 | Ga0466965_0210086 | 3300044683 | Bacteria | 1035 |
| 481 | Ga0466966_0026650 | 3300044684 | Bacteria | 3773 |
| 482 | Ga0466966_0038382 | 3300044684 | Bacteria | 3087 |
| 483 | Ga0466966_0045094 | 3300044684 | Bacteria | 2820 |
| 484 | Ga0466966_0055571 | 3300044684 | Bacteria | 2505 |
| 485 | Ga0466966_0062172 | 3300044684 | Bacteria | 2355 |
| 486 | Ga0466966_0143083 | 3300044684 | Bacteria | 1460 |
| 487 | Ga0466966_0232504 | 3300044684 | Bacteria | 1112 |
| 488 | Ga0466966_0481787 | 3300044684 | Bacteria | 746 |
| 489 | Ga0466961_0005646 | 3300044693 | Bacteria | 7909 |
| 490 | Ga0466961_0009564 | 3300044693 | Bacteria | 6170 |
| 491 | Ga0466961_0010645 | 3300044693 | Bacteria | 5871 |
| 492 | Ga0466961_0017691 | 3300044693 | Bacteria | 4579 |
| 493 | Ga0466961_0030202 | 3300044693 | Bacteria | 3483 |
| 494 | Ga0466961_0033365 | 3300044693 | Bacteria | 3308 |
| 495 | Ga0466961_0038407 | 3300044693 | Bacteria | 3071 |
| 496 | Ga0466961_0047692 | 3300044693 | Bacteria | 2739 |
| 497 | Ga0466961_0187100 | 3300044693 | Bacteria | 1284 |
| 498 | Ga0466961_0203696 | 3300044693 | Bacteria | 1223 |
| 499 | Ga0466963_0012845 | 3300044694 | Bacteria | 5131 |
| 500 | Ga0466963_0044114 | 3300044694 | Bacteria | 2934 |
| 501 | Ga0466963_0140395 | 3300044694 | Bacteria | 1673 |
| 502 | Ga0466963_0152174 | 3300044694 | Bacteria | 1607 |
| 503 | Ga0466964_0067599 | 3300044706 | Bacteria | 1503 |
| 504 | Ga0466971_0010997 | 3300044719 | Bacteria | 3959 |
| 505 | Ga0466971_0014064 | 3300044719 | Bacteria | 3519 |
| 506 | Ga0466971_0039711 | 3300044719 | Bacteria | 2112 |
| 507 | Ga0466971_0067476 | 3300044719 | Bacteria | 1622 |
| 508 | Ga0466971_0093222 | 3300044719 | Bacteria | 1380 |
| 509 | Ga0466971_0135614 | 3300044719 | Bacteria | 1145 |
| 510 | Ga0466970_0047481 | 3300044765 | Bacteria | 2288 |
| 511 | Ga0466970_0049835 | 3300044765 | Bacteria | 2233 |
| 512 | Ga0466957_0045859 | 3300044842 | Bacteria | 2652 |
| 513 | Ga0466957_0046335 | 3300044842 | Bacteria | 2640 |
| 514 | Ga0466957_0047152 | 3300044842 | Bacteria | 2617 |
| 515 | Ga0466957_0099837 | 3300044842 | Bacteria | 1828 |
| 516 | Ga0466960_0000785 | 3300044901 | Bacteria | 11142 |
| 517 | Ga0466960_0001736 | 3300044901 | Bacteria | 8009 |
| 518 | Ga0466960_0168571 | 3300044901 | Bacteria | 1180 |
| 519 | Ga0466959_0022747 | 3300045049 | Bacteria | 4634 |
| 520 | Ga0466959_0058435 | 3300045049 | Bacteria | 2809 |
| 521 | Ga0466959_0066185 | 3300045049 | Bacteria | 2621 |
| 522 | Ga0466959_0101800 | 3300045049 | Bacteria | 2056 |
| 523 | Ga0466959_0172371 | 3300045049 | Bacteria | 1517 |
| 524 | Ga0466959_0198452 | 3300045049 | Bacteria | 1398 |
| 525 | Ga0466959_0296373 | 3300045049 | Bacteria | 1108 |
| 526 | Ga0466958_0014946 | 3300045836 | Bacteria | 4439 |
| 527 | Ga0466958_0041370 | 3300045836 | Bacteria | 2772 |
| 528 | Ga0466958_0057179 | 3300045836 | Bacteria | 2370 |
| 529 | Ga0466958_0101020 | 3300045836 | Bacteria | 1793 |
| 530 | Ga0466958_0163483 | 3300045836 | Bacteria | 1407 |
| 531 | Ga0466958_0489278 | 3300045836 | Bacteria | 798 |
| 532 | Ga0466958_0581206 | 3300045836 | Bacteria | 728 |
| 533 | Ga0466967_0005617 | 3300045976 | Bacteria | 8722 |
| 534 | Ga0466967_0023907 | 3300045976 | Bacteria | 5016 |
| 535 | Ga0466967_0033697 | 3300045976 | Bacteria | 4339 |
| 536 | Ga0466967_0061671 | 3300045976 | Bacteria | 3327 |
| 537 | Ga0466967_0068974 | 3300045976 | Bacteria | 3159 |
| 538 | Ga0466967_0131052 | 3300045976 | Bacteria | 2327 |
| 539 | Ga0466967_0156980 | 3300045976 | Bacteria | 2132 |
| 540 | Ga0466967_0189135 | 3300045976 | Bacteria | 1945 |
| 541 | Ga0466967_0201328 | 3300045976 | Bacteria | 1886 |
| 542 | Ga0466967_0243877 | 3300045976 | Bacteria | 1715 |
| 543 | Ga0466967_0270094 | 3300045976 | Bacteria | 1629 |
| 544 | Ga0466967_0365934 | 3300045976 | Bacteria | 1398 |
| 545 | Ga0466967_1166930 | 3300045976 | Bacteria | 767 |
| 546 | Ga0495608_0439189 | 3300046511 | Bacteria | 795 |
| 547 | Ga0495625_0281093 | 3300046660 | Bacteria | 1071 |
| 548 | Ga0495672_0071789 | 3300047320 | Bacteria | 1958 |
| 549 | Ga0496100_0027221 | 3300048903 | Bacteria | 3514 |
| 550 | Ga0496100_0534894 | 3300048903 | Bacteria | 905 |
| 551 | Ga0496101_0016324 | 3300048904 | Bacteria | 5013 |
| 552 | Ga0496101_0035254 | 3300048904 | Bacteria | 3538 |
| 553 | Ga0496101_0142018 | 3300048904 | Bacteria | 1831 |
| 554 | Ga0496102_0000095 | 3300048905 | Bacteria | 124981 |
| 555 | Ga0496102_0000682 | 3300048905 | Bacteria | 33965 |
| 556 | Ga0496102_0002597 | 3300048905 | Bacteria | 15420 |
| 557 | Ga0496102_0531241 | 3300048905 | Bacteria | 1099 |
| 558 | Ga0496103_0000042 | 3300048906 | Bacteria | 168701 |
| 559 | Ga0496103_0026196 | 3300048906 | Bacteria | 3530 |
| 560 | Ga0496104_0009220 | 3300048907 | Bacteria | 8771 |
| 561 | Ga0496104_0013659 | 3300048907 | Bacteria | 7321 |
| 562 | Ga0496105_0003598 | 3300048908 | Bacteria | 11508 |
| 563 | Ga0496105_0036566 | 3300048908 | Bacteria | 4045 |
| 564 | Ga0496106_0029251 | 3300048909 | Bacteria | 4105 |
| 565 | Ga0496106_0051809 | 3300048909 | Bacteria | 3095 |
| 566 | Ga0496107_0028576 | 3300048910 | Bacteria | 3963 |
| 567 | Ga0496107_0176721 | 3300048910 | Bacteria | 1585 |
| 568 | Ga0496108_0000028 | 3300048911 | Bacteria | 168580 |
| 569 | Ga0496108_0009746 | 3300048911 | Bacteria | 7780 |
| 570 | Ga0496108_0023814 | 3300048911 | Bacteria | 5038 |
| 571 | Ga0496108_0869299 | 3300048911 | Bacteria | 775 |
| 572 | Ga0496109_0009965 | 3300048912 | Bacteria | 8115 |
| 573 | Ga0496109_0085550 | 3300048912 | Bacteria | 2910 |
| 574 | Ga0496109_0506445 | 3300048912 | Bacteria | 1140 |
| 575 | Ga0496110_0009051 | 3300048913 | Bacteria | 8034 |
| 576 | Ga0496110_0013512 | 3300048913 | Bacteria | 6754 |
| 577 | Ga0496110_0226670 | 3300048913 | Bacteria | 1699 |
| 578 | Ga0496111_0007099 | 3300048914 | Bacteria | 7319 |
| 579 | Ga0496111_0026637 | 3300048914 | Bacteria | 4084 |
| 580 | Ga0496111_0038854 | 3300048914 | Bacteria | 3411 |
| 581 | Ga0496112_0123457 | 3300048915 | Bacteria | 2560 |
| 582 | Ga0496113_0003403 | 3300048916 | Bacteria | 9519 |
| 583 | Ga0496113_0015498 | 3300048916 | Bacteria | 5241 |
| 584 | Ga0496113_0031947 | 3300048916 | Bacteria | 3824 |
| 585 | Ga0496113_0149026 | 3300048916 | Bacteria | 1845 |
| 586 | Ga0496114_0012135 | 3300048917 | Bacteria | 6894 |
| 587 | Ga0496114_0120519 | 3300048917 | Bacteria | 2256 |
| 588 | Ga0496114_0293832 | 3300048917 | Bacteria | 1434 |
| 589 | Ga0496115_0017668 | 3300048918 | Bacteria | 5460 |
| 590 | Ga0496119_0000276 | 3300048922 | Bacteria | 72490 |
| 591 | Ga0496119_0161770 | 3300048922 | Bacteria | 1189 |
| 592 | Ga0496120_0017628 | 3300048923 | Bacteria | 4620 |
| 593 | Ga0496121_0023550 | 3300048924 | Bacteria | 5924 |
| 594 | Ga0496121_0028645 | 3300048924 | Bacteria | 5179 |
| 595 | Ga0496126_0000006 | 3300048929 | Bacteria | 798804 |
| 596 | Ga0496126_0091257 | 3300048929 | Bacteria | 2679 |
| 597 | Ga0496126_0153004 | 3300048929 | Bacteria | 1976 |
| 598 | Ga0501031_0007867 | 3300049568 | Bacteria | 6938 |
| 599 | Ga0501034_0023051 | 3300049571 | Bacteria | 6345 |
| 600 | Ga0501037_0216433 | 3300049573 | Bacteria | 1349 |
| 601 | Ga0501038_0007911 | 3300049574 | Bacteria | 9801 |
| 602 | Ga0501043_0029182 | 3300049579 | Bacteria | 4332 |
| 603 | Ga0501047_0019307 | 3300049581 | Bacteria | 6539 |
| 604 | Ga0501047_0048014 | 3300049581 | Bacteria | 4123 |
| 605 | Ga0501048_0007150 | 3300049582 | Bacteria | 8481 |
| 606 | Ga0501070_0044885 | 3300049586 | Bacteria | 3676 |
| 607 | Ga0501074_0246950 | 3300049590 | Bacteria | 1269 |
| 608 | Ga0501075_0567794 | 3300049591 | Bacteria | 866 |
| 609 | Ga0501035_0372983 | 3300049822 | Bacteria | 1191 |
| 610 | Ga0501035_0544760 | 3300049822 | Bacteria | 951 |
| 611 | Ga0501044_0100023 | 3300049823 | Bacteria | 2918 |
| 612 | Ga0501044_0247063 | 3300049823 | Bacteria | 1727 |
| 613 | nmdc:mga00v17_188879_c1 | 3300050491 | Bacteria | 1330 |
| 614 | nmdc:mga05p37_1207905_c1 | 3300050507 | Bacteria | 780 |
| 615 | nmdc:mga05p37_262167_c1 | 3300050507 | Bacteria | 1678 |
| 616 | nmdc:mga05p37_374669_c1 | 3300050507 | Bacteria | 1670 |
| 617 | nmdc:mga09592_18944_c1 | 3300050508 | Bacteria | 5647 |
| 618 | nmdc:mga09592_383619_c1 | 3300050508 | Bacteria | 1215 |
| 619 | nmdc:mga09592_416687_c1 | 3300050508 | Bacteria | 1160 |
| 620 | nmdc:mga09592_98107_c1 | 3300050508 | Bacteria | 2508 |
| 621 | nmdc:mga0qj67_2612_c1 | 3300050509 | Bacteria | 12907 |
| 622 | nmdc:mga0qj67_89332_c1 | 3300050509 | Bacteria | 2475 |
| 623 | nmdc:mga06r32_199217_c1 | 3300050510 | Bacteria | 1990 |
| 624 | nmdc:mga06r32_57751_c1 | 3300050510 | Bacteria | 3728 |
| 625 | nmdc:mga06r32_6136_c1 | 3300050510 | Bacteria | 10787 |
| 626 | nmdc:mga08y16_1868_c1 | 3300050511 | Bacteria | 21414 |
| 627 | nmdc:mga08y16_4845_c1 | 3300050511 | Bacteria | 14045 |
| 628 | nmdc:mga0n895_121798_c1 | 3300050512 | Bacteria | 2630 |
| 629 | nmdc:mga0n895_15670_c1 | 3300050512 | Bacteria | 6924 |
| 630 | nmdc:mga0rr50_103138_c1 | 3300050513 | Bacteria | 2245 |
| 631 | nmdc:mga0rr50_8639_c1 | 3300050513 | Bacteria | 6349 |
| 632 | nmdc:mga08x19_16502_c1 | 3300050514 | Bacteria | 4505 |
| 633 | nmdc:mga08x19_25929_c1 | 3300050514 | Bacteria | 3655 |
| 634 | nmdc:mga0a205_742_c1 | 3300050515 | Bacteria | 26290 |
| 635 | Ga0500641_0050359 | 3300053096 | Bacteria | 1711 |
| 636 | Ga0500650_0056561 | 3300053098 | Bacteria | 1828 |
| 637 | Ga0500654_133501 | 3300053099 | Bacteria | 931 |
| 638 | Ga0500556_0044346 | 3300053104 | Bacteria | 1582 |
| 639 | Ga0500569_009425 | 3300053109 | Bacteria | 2269 |
| 640 | Ga0500652_004567 | 3300053131 | Bacteria | 4291 |
| 641 | Ga0500658_0211455 | 3300053134 | Bacteria | 888 |
| 642 | Ga0500579_133682 | 3300053143 | Bacteria | 1149 |
| 643 | Ga0501082_0220375 | 3300060353 | Bacteria | 1651 |
| 644 | Ga0466962_0025228 | 3300061719 | Bacteria | 2854 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005985 | Ga0081539_10089590 | Ga0081539_100895902 | 165 |
| 2 | 3300014326 | Ga0157380_11063618 | Ga0157380_110636182 | 167 |
| 3 | 3300036401 | Ga0373937_0242444 | Ga0373937_0242444_259_942 | 177 |
| 4 | 3300025934 | Ga0207686_10395769 | Ga0207686_103957691 | 179 |
| 5 | iso_pu_bacteria | 2855683550 | 2855686043 | 193 |
| 6 | iso_pu_bacteria | 2867312974 | 2867315488 | 193 |
| 7 | iso_pu_bacteria | 2867319477 | 2867324548 | 193 |
| 8 | iso_pu_bacteria | 8003856774 | 8003858829 | 193 |
| 9 | 3300053143 | Ga0500579_133682 | Ga0500579_133682_189_818 | 194 |
| 10 | 3300050507 | nmdc:mga05p37_374669_c1 | nmdc:mga05p37_374669_c1_483_1172 | 195 |
| 11 | 3300050508 | nmdc:mga09592_18944_c1 | nmdc:mga09592_18944_c1_3533_4222 | 195 |
| 12 | 3300035692 | Ga0373935_0007985 | Ga0373935_0007985_2838_3500 | 198 |
| 13 | 3300041452 | Ga0451793_0196981 | Ga0451793_0196981_131_856 | 198 |
| 14 | 3300048911 | Ga0496108_0000028 | Ga0496108_0000028_32596_33252 | 198 |
| 15 | 3300050510 | nmdc:mga06r32_6136_c1 | nmdc:mga06r32_6136_c1_7205_7867 | 198 |
| 16 | iso_pu_bacteria | 2902582711 | 2902587837 | 198 |
| 17 | 3300031730 | Ga0307516_10034862 | Ga0307516_100348623 | 199 |
| 18 | iso_pu_bacteria | 2858902515 | 2858903939 | 201 |
| 19 | 3300045976 | Ga0466967_0365934 | Ga0466967_0365934_13_687 | 202 |
| 20 | iso_pu_bacteria | 8001781756 | 8001781760 | 202 |
| 21 | iso_pu_bacteria | 8001781756 | 8001788883 | 202 |
| 22 | 3300005435 | Ga0070714_100260253 | Ga0070714_1002602532 | 203 |
| 23 | 3300005548 | Ga0070665_100153571 | Ga0070665_1001535712 | 203 |
| 24 | 3300005577 | Ga0068857_100356545 | Ga0068857_1003565451 | 203 |
| 25 | 3300005985 | Ga0081539_10003417 | Ga0081539_100034174 | 203 |
| 26 | 3300005985 | Ga0081539_10019247 | Ga0081539_100192473 | 203 |
| 27 | 3300006173 | Ga0070716_100518198 | Ga0070716_1005181981 | 203 |
| 28 | 3300006844 | Ga0075428_100381115 | Ga0075428_1003811152 | 203 |
| 29 | 3300006846 | Ga0075430_100022154 | Ga0075430_1000221544 | 203 |
| 30 | 3300006847 | Ga0075431_100025021 | Ga0075431_1000250215 | 203 |
| 31 | 3300006880 | Ga0075429_100360414 | Ga0075429_1003604142 | 203 |
| 32 | 3300009147 | Ga0114129_10009483 | Ga0114129_100094834 | 203 |
| 33 | 3300009147 | Ga0114129_10013774 | Ga0114129_1001377413 | 203 |
| 34 | 3300009147 | Ga0114129_10381498 | Ga0114129_103814982 | 203 |
| 35 | 3300025939 | Ga0207665_10279579 | Ga0207665_102795792 | 203 |
| 36 | 3300028379 | Ga0268266_10028258 | Ga0268266_100282584 | 203 |
| 37 | 3300028786 | Ga0307517_10098149 | Ga0307517_100981492 | 203 |
| 38 | 3300028794 | Ga0307515_10002981 | Ga0307515_1000298128 | 203 |
| 39 | 3300028794 | Ga0307515_10043558 | Ga0307515_100435585 | 203 |
| 40 | 3300030522 | Ga0307512_10003152 | Ga0307512_1000315214 | 203 |
| 41 | 3300030522 | Ga0307512_10006215 | Ga0307512_100062154 | 203 |
| 42 | 3300031456 | Ga0307513_10000007 | Ga0307513_10000007189 | 203 |
| 43 | 3300031456 | Ga0307513_10020898 | Ga0307513_100208988 | 203 |
| 44 | 3300031616 | Ga0307508_10014255 | Ga0307508_100142554 | 203 |
| 45 | 3300031616 | Ga0307508_10026635 | Ga0307508_100266353 | 203 |
| 46 | 3300031730 | Ga0307516_10013193 | Ga0307516_100131937 | 203 |
| 47 | 3300049591 | Ga0501075_0567794 | Ga0501075_0567794_38_727 | 203 |
| 48 | 3300050507 | nmdc:mga05p37_1207905_c1 | nmdc:mga05p37_1207905_c1_17_697 | 203 |
| 49 | 3300050508 | nmdc:mga09592_98107_c1 | nmdc:mga09592_98107_c1_890_1570 | 203 |
| 50 | 3300050510 | nmdc:mga06r32_199217_c1 | nmdc:mga06r32_199217_c1_220_945 | 203 |
| 51 | 3300053096 | Ga0500641_0050359 | Ga0500641_0050359_855_1532 | 203 |
| 52 | 3300053098 | Ga0500650_0056561 | Ga0500650_0056561_974_1651 | 203 |
| 53 | 3300053104 | Ga0500556_0044346 | Ga0500556_0044346_253_930 | 203 |
| 54 | 3300053109 | Ga0500569_009425 | Ga0500569_009425_1077_1754 | 203 |
| 55 | 3300053131 | Ga0500652_004567 | Ga0500652_004567_807_1484 | 203 |
| 56 | 3300053134 | Ga0500658_0211455 | Ga0500658_0211455_201_878 | 203 |
| 57 | iso_pu_bacteria | 2501939600 | 2501940780 | 203 |
| 58 | iso_pu_bacteria | 2622736626 | 2623587369 | 203 |
| 59 | iso_pu_bacteria | 2842888712 | 2842891380 | 203 |
| 60 | iso_pu_bacteria | 2856858025 | 2856861233 | 203 |
| 61 | iso_pu_bacteria | 2858868258 | 2858869288 | 203 |
| 62 | iso_pu_bacteria | 2861520306 | 2861523004 | 203 |
| 63 | iso_pu_bacteria | 2867302475 | 2867308105 | 203 |
| 64 | iso_pu_bacteria | 2996221748 | 2996226756 | 203 |
| 65 | iso_pu_bacteria | 649633069 | 649811988 | 203 |
| 66 | iso_pu_bacteria | 8057568493 | 8057573352 | 203 |
| 67 | 3300005331 | Ga0070670_100637768 | Ga0070670_1006377681 | 204 |
| 68 | 3300005334 | Ga0068869_100013871 | Ga0068869_1000138713 | 204 |
| 69 | 3300005338 | Ga0068868_100019898 | Ga0068868_1000198984 | 204 |
| 70 | 3300005343 | Ga0070687_100072879 | Ga0070687_1000728792 | 204 |
| 71 | 3300005345 | Ga0070692_10036315 | Ga0070692_100363152 | 204 |
| 72 | 3300005354 | Ga0070675_100001606 | Ga0070675_1000016064 | 204 |
| 73 | 3300005366 | Ga0070659_100026353 | Ga0070659_1000263534 | 204 |
| 74 | 3300005441 | Ga0070700_100038003 | Ga0070700_1000380033 | 204 |
| 75 | 3300005455 | Ga0070663_100007178 | Ga0070663_1000071785 | 204 |
| 76 | 3300005456 | Ga0070678_100077711 | Ga0070678_1000777113 | 204 |
| 77 | 3300005457 | Ga0070662_100010109 | Ga0070662_1000101093 | 204 |
| 78 | 3300005530 | Ga0070679_100667540 | Ga0070679_1006675402 | 204 |
| 79 | 3300005535 | Ga0070684_100010223 | Ga0070684_1000102233 | 204 |
| 80 | 3300005547 | Ga0070693_100047311 | Ga0070693_1000473112 | 204 |
| 81 | 3300005564 | Ga0070664_100000984 | Ga0070664_1000009844 | 204 |
| 82 | 3300005577 | Ga0068857_100031821 | Ga0068857_1000318213 | 204 |
| 83 | 3300005616 | Ga0068852_100093885 | Ga0068852_1000938853 | 204 |
| 84 | 3300005617 | Ga0068859_100438591 | Ga0068859_1004385912 | 204 |
| 85 | 3300005618 | Ga0068864_100118838 | Ga0068864_1001188383 | 204 |
| 86 | 3300005719 | Ga0068861_100016781 | Ga0068861_1000167814 | 204 |
| 87 | 3300006931 | Ga0097620_100438643 | Ga0097620_1004386432 | 204 |
| 88 | 3300009094 | Ga0111539_10017696 | Ga0111539_100176963 | 204 |
| 89 | 3300009098 | Ga0105245_10044524 | Ga0105245_100445243 | 204 |
| 90 | 3300009553 | Ga0105249_10106899 | Ga0105249_101068993 | 204 |
| 91 | 3300010375 | Ga0105239_10068314 | Ga0105239_100683143 | 204 |
| 92 | 3300014745 | Ga0157377_10003575 | Ga0157377_100035755 | 204 |
| 93 | 3300025901 | Ga0207688_10032413 | Ga0207688_100324133 | 204 |
| 94 | 3300025921 | Ga0207652_10601460 | Ga0207652_106014601 | 204 |
| 95 | 3300025926 | Ga0207659_10020914 | Ga0207659_100209144 | 204 |
| 96 | 3300025927 | Ga0207687_10026136 | Ga0207687_100261363 | 204 |
| 97 | 3300025932 | Ga0207690_10011066 | Ga0207690_100110664 | 204 |
| 98 | 3300025933 | Ga0207706_10026723 | Ga0207706_100267234 | 204 |
| 99 | 3300025936 | Ga0207670_10068986 | Ga0207670_100689862 | 204 |
| 100 | 3300025941 | Ga0207711_10092547 | Ga0207711_100925473 | 204 |
| 101 | 3300025942 | Ga0207689_10008040 | Ga0207689_100080403 | 204 |
| 102 | 3300025944 | Ga0207661_10104294 | Ga0207661_101042942 | 204 |
| 103 | 3300025945 | Ga0207679_10010901 | Ga0207679_100109013 | 204 |
| 104 | 3300026023 | Ga0207677_10041489 | Ga0207677_100414892 | 204 |
| 105 | 3300026067 | Ga0207678_10010962 | Ga0207678_100109623 | 204 |
| 106 | 3300026075 | Ga0207708_10071639 | Ga0207708_100716393 | 204 |
| 107 | 3300026095 | Ga0207676_10091114 | Ga0207676_100911143 | 204 |
| 108 | 3300026116 | Ga0207674_10069209 | Ga0207674_100692093 | 204 |
| 109 | 3300026118 | Ga0207675_100044806 | Ga0207675_1000448063 | 204 |
| 110 | 3300026121 | Ga0207683_10146778 | Ga0207683_101467782 | 204 |
| 111 | 3300026142 | Ga0207698_10566250 | Ga0207698_105662502 | 204 |
| 112 | 3300027907 | Ga0207428_10009693 | Ga0207428_100096935 | 204 |
| 113 | 3300031995 | Ga0307409_100146938 | Ga0307409_1001469383 | 204 |
| 114 | 3300045836 | Ga0466958_0489278 | Ga0466958_0489278_46_762 | 204 |
| 115 | 3300045976 | Ga0466967_0243877 | Ga0466967_0243877_887_1603 | 204 |
| 116 | 3300047320 | Ga0495672_0071789 | Ga0495672_0071789_14_685 | 204 |
| 117 | 3300049581 | Ga0501047_0019307 | Ga0501047_0019307_1238_1921 | 204 |
| 118 | 3300049823 | Ga0501044_0247063 | Ga0501044_0247063_529_1212 | 204 |
| 119 | 3300050508 | nmdc:mga09592_416687_c1 | nmdc:mga09592_416687_c1_420_1097 | 204 |
| 120 | 3300050511 | nmdc:mga08y16_4845_c1 | nmdc:mga08y16_4845_c1_8028_8705 | 204 |
| 121 | iso_pu_bacteria | 2772190715 | 2772644657 | 204 |
| 122 | iso_pu_bacteria | 2855670206 | 2855676766 | 204 |
| 123 | iso_pu_bacteria | 2855676851 | 2855682929 | 204 |
| 124 | iso_pu_bacteria | 2857288857 | 2857295598 | 204 |
| 125 | iso_pu_bacteria | 2858848962 | 2858853468 | 204 |
| 126 | iso_pu_bacteria | 2858882152 | 2858885337 | 204 |
| 127 | iso_pu_bacteria | 2858888857 | 2858893416 | 204 |
| 128 | iso_pu_bacteria | 2858895516 | 2858896510 | 204 |
| 129 | iso_pu_bacteria | 2869048445 | 2869052954 | 204 |
| 130 | iso_pu_bacteria | 2869061728 | 2869063619 | 204 |
| 131 | iso_pu_bacteria | 2869068681 | 2869072315 | 204 |
| 132 | iso_pu_bacteria | 2880489317 | 2880492872 | 204 |
| 133 | iso_pu_bacteria | 2880495981 | 2880499439 | 204 |
| 134 | iso_pu_bacteria | 2929219909 | 2929221411 | 204 |
| 135 | iso_pu_bacteria | 2929226422 | 2929228042 | 204 |
| 136 | iso_pu_bacteria | 8003830390 | 8003831535 | 204 |
| 137 | iso_pu_bacteria | 8003870546 | 8003875171 | 204 |
| 138 | iso_pu_bacteria | 8054704163 | 8054709145 | 204 |
| 139 | iso_pu_bacteria | 8054727385 | 8054732088 | 204 |
| 140 | iso_pu_bacteria | 8054734606 | 8054741042 | 204 |
| 141 | iso_pu_bacteria | 8055412473 | 8055418940 | 204 |
| 142 | 3300005983 | Ga0081540_1010669 | Ga0081540_10106692 | 205 |
| 143 | 3300031731 | Ga0307405_10068504 | Ga0307405_100685042 | 205 |
| 144 | 3300031824 | Ga0307413_10697241 | Ga0307413_106972411 | 205 |
| 145 | 3300031852 | Ga0307410_10445392 | Ga0307410_104453921 | 205 |
| 146 | 3300031901 | Ga0307406_10547102 | Ga0307406_105471022 | 205 |
| 147 | 3300031995 | Ga0307409_100075412 | Ga0307409_1000754124 | 205 |
| 148 | 3300031995 | Ga0307409_100118775 | Ga0307409_1001187753 | 205 |
| 149 | 3300032002 | Ga0307416_100046933 | Ga0307416_1000469332 | 205 |
| 150 | 3300032005 | Ga0307411_10202071 | Ga0307411_102020712 | 205 |
| 151 | 3300035088 | Ga0373940_0032710 | Ga0373940_0032710_19_699 | 205 |
| 152 | 3300035115 | Ga0373941_0038233 | Ga0373941_0038233_352_1032 | 205 |
| 153 | 3300035207 | Ga0373942_0000346 | Ga0373942_0000346_255_935 | 205 |
| 154 | 3300035242 | Ga0373962_0000467 | Ga0373962_0000467_4535_5215 | 205 |
| 155 | 3300037312 | Ga0395899_0039002 | Ga0395899_0039002_1275_1967 | 205 |
| 156 | 3300037418 | Ga0395900_0044475 | Ga0395900_0044475_1566_2258 | 205 |
| 157 | 3300037418 | Ga0395900_0049190 | Ga0395900_0049190_2464_3162 | 205 |
| 158 | 3300037466 | Ga0395898_0017719 | Ga0395898_0017719_2805_3497 | 205 |
| 159 | 3300037466 | Ga0395898_0034373 | Ga0395898_0034373_3337_4035 | 205 |
| 160 | 3300037471 | Ga0395905_0013660 | Ga0395905_0013660_4793_5485 | 205 |
| 161 | 3300037471 | Ga0395905_0043022 | Ga0395905_0043022_1729_2427 | 205 |
| 162 | 3300038443 | Ga0395901_0018354 | Ga0395901_0018354_5220_5912 | 205 |
| 163 | 3300038443 | Ga0395901_0030528 | Ga0395901_0030528_2662_3360 | 205 |
| 164 | 3300050491 | nmdc:mga00v17_188879_c1 | nmdc:mga00v17_188879_c1_254_940 | 205 |
| 165 | iso_pu_bacteria | 2515154088 | 2515494173 | 205 |
| 166 | iso_pu_bacteria | 2515154129 | 2515721970 | 205 |
| 167 | iso_pu_bacteria | 2515154137 | 2515758581 | 205 |
| 168 | iso_pu_bacteria | 2515154202 | 2516086090 | 205 |
| 169 | iso_pu_bacteria | 2515154203 | 2516090580 | 205 |
| 170 | 3300003203 | JGI25406J46586_10047396 | JGI25406J46586_100473963 | 206 |
| 171 | 3300005530 | Ga0070679_100100074 | Ga0070679_1001000743 | 206 |
| 172 | 3300005983 | Ga0081540_1009262 | Ga0081540_10092625 | 206 |
| 173 | 3300005985 | Ga0081539_10000536 | Ga0081539_1000053630 | 206 |
| 174 | 3300006847 | Ga0075431_100015245 | Ga0075431_1000152457 | 206 |
| 175 | 3300028786 | Ga0307517_10126827 | Ga0307517_101268272 | 206 |
| 176 | 3300028794 | Ga0307515_10000241 | Ga0307515_1000024185 | 206 |
| 177 | 3300028794 | Ga0307515_10040140 | Ga0307515_100401408 | 206 |
| 178 | 3300031507 | Ga0307509_10370337 | Ga0307509_103703372 | 206 |
| 179 | 3300031548 | Ga0307408_100284047 | Ga0307408_1002840472 | 206 |
| 180 | 3300031616 | Ga0307508_10001698 | Ga0307508_1000169812 | 206 |
| 181 | 3300031730 | Ga0307516_10017972 | Ga0307516_100179725 | 206 |
| 182 | 3300031824 | Ga0307413_10030269 | Ga0307413_100302693 | 206 |
| 183 | 3300031852 | Ga0307410_10182556 | Ga0307410_101825562 | 206 |
| 184 | 3300031889 | Ga0326468_10000349 | Ga0326468_100003495 | 206 |
| 185 | 3300031901 | Ga0307406_10156531 | Ga0307406_101565312 | 206 |
| 186 | 3300031903 | Ga0307407_10076120 | Ga0307407_100761202 | 206 |
| 187 | 3300031995 | Ga0307409_100043830 | Ga0307409_1000438302 | 206 |
| 188 | 3300032005 | Ga0307411_10457623 | Ga0307411_104576232 | 206 |
| 189 | 3300032126 | Ga0307415_100821504 | Ga0307415_1008215041 | 206 |
| 190 | 3300041451 | Ga0451791_1235265 | Ga0451791_1235265_641_1339 | 206 |
| 191 | 3300048929 | Ga0496126_0153004 | Ga0496126_0153004_1134_1820 | 206 |
| 192 | 3300050509 | nmdc:mga0qj67_2612_c1 | nmdc:mga0qj67_2612_c1_3061_3762 | 206 |
| 193 | 3300031730 | Ga0307516_10077699 | Ga0307516_100776992 | 207 |
| 194 | 3300035091 | Ga0373951_0000082 | Ga0373951_0000082_13910_14611 | 207 |
| 195 | 3300045976 | Ga0466967_0068974 | Ga0466967_0068974_1050_1793 | 207 |
| 196 | iso_pu_bacteria | 2558860112 | 2558908212 | 207 |
| 197 | iso_pu_bacteria | 2862705112 | 2862710149 | 207 |
| 198 | iso_pu_bacteria | 2870782633 | 2870789494 | 207 |
| 199 | iso_pu_bacteria | 8008485437 | 8008485513 | 207 |
| 200 | iso_pu_bacteria | 8025524527 | 8025529987 | 207 |
| 201 | 3300025927 | Ga0207687_10030883 | Ga0207687_100308831 | 208 |
| 202 | 3300031731 | Ga0307405_10064589 | Ga0307405_100645893 | 208 |
| 203 | 3300031995 | Ga0307409_100014850 | Ga0307409_1000148502 | 208 |
| 204 | iso_pu_bacteria | 2721755702 | 2723641345 | 208 |
| 205 | iso_pu_bacteria | 2935409751 | 2935410758 | 208 |
| 206 | 3300005985 | Ga0081539_10000709 | Ga0081539_1000070941 | 209 |
| 207 | 3300026095 | Ga0207676_10193444 | Ga0207676_101934441 | 209 |
| 208 | 3300035085 | Ga0373929_0036903 | Ga0373929_0036903_17_703 | 209 |
| 209 | 3300044694 | Ga0466963_0012845 | Ga0466963_0012845_3138_3794 | 209 |
| 210 | 3300044719 | Ga0466971_0039711 | Ga0466971_0039711_1181_1837 | 209 |
| 211 | 3300044842 | Ga0466957_0099837 | Ga0466957_0099837_706_1362 | 209 |
| 212 | 3300045976 | Ga0466967_1166930 | Ga0466967_1166930_75_752 | 209 |
| 213 | 3300061719 | Ga0466962_0025228 | Ga0466962_0025228_1084_1740 | 209 |
| 214 | 3300005614 | Ga0068856_100002291 | Ga0068856_1000022912 | 210 |
| 215 | 3300020069 | Ga0197907_11509860 | Ga0197907_115098602 | 210 |
| 216 | 3300025940 | Ga0207691_10574914 | Ga0207691_105749142 | 210 |
| 217 | 3300025961 | Ga0207712_10302330 | Ga0207712_103023302 | 210 |
| 218 | 3300044683 | Ga0466965_0123030 | Ga0466965_0123030_81_782 | 210 |
| 219 | 3300044684 | Ga0466966_0232504 | Ga0466966_0232504_319_1020 | 210 |
| 220 | 3300044694 | Ga0466963_0140395 | Ga0466963_0140395_125_784 | 210 |
| 221 | 3300044765 | Ga0466970_0047481 | Ga0466970_0047481_933_1634 | 210 |
| 222 | 3300044901 | Ga0466960_0168571 | Ga0466960_0168571_137_796 | 210 |
| 223 | 3300045976 | Ga0466967_0033697 | Ga0466967_0033697_3063_3782 | 210 |
| 224 | 3300005441 | Ga0070700_100172755 | Ga0070700_1001727552 | 211 |
| 225 | 3300009553 | Ga0105249_10343568 | Ga0105249_103435682 | 211 |
| 226 | 3300013306 | Ga0163162_10183866 | Ga0163162_101838662 | 211 |
| 227 | 3300025924 | Ga0207694_10382995 | Ga0207694_103829951 | 211 |
| 228 | 3300048904 | Ga0496101_0142018 | Ga0496101_0142018_1010_1726 | 211 |
| 229 | 3300048905 | Ga0496102_0531241 | Ga0496102_0531241_153_869 | 211 |
| 230 | 3300048911 | Ga0496108_0869299 | Ga0496108_0869299_36_752 | 211 |
| 231 | 3300048917 | Ga0496114_0293832 | Ga0496114_0293832_114_830 | 211 |
| 232 | 3300001989 | JGI24739J22299_10019813 | JGI24739J22299_100198132 | 212 |
| 233 | 3300001989 | JGI24739J22299_10075160 | JGI24739J22299_100751601 | 212 |
| 234 | 3300001990 | JGI24737J22298_10001587 | JGI24737J22298_100015875 | 212 |
| 235 | 3300002067 | JGI24735J21928_10065430 | JGI24735J21928_100654302 | 212 |
| 236 | 3300005337 | Ga0070682_100479948 | Ga0070682_1004799481 | 212 |
| 237 | 3300005347 | Ga0070668_100316855 | Ga0070668_1003168552 | 212 |
| 238 | 3300005539 | Ga0068853_100280574 | Ga0068853_1002805742 | 212 |
| 239 | 3300005578 | Ga0068854_100503823 | Ga0068854_1005038232 | 212 |
| 240 | 3300005614 | Ga0068856_100683443 | Ga0068856_1006834431 | 212 |
| 241 | 3300005834 | Ga0068851_10115071 | Ga0068851_101150712 | 212 |
| 242 | 3300006844 | Ga0075428_100022273 | Ga0075428_1000222736 | 212 |
| 243 | 3300006846 | Ga0075430_100009448 | Ga0075430_1000094483 | 212 |
| 244 | 3300006847 | Ga0075431_100053468 | Ga0075431_1000534683 | 212 |
| 245 | 3300009147 | Ga0114129_10041652 | Ga0114129_100416522 | 212 |
| 246 | 3300009553 | Ga0105249_10551047 | Ga0105249_105510472 | 212 |
| 247 | 3300010375 | Ga0105239_10092612 | Ga0105239_100926122 | 212 |
| 248 | 3300025904 | Ga0207647_10077381 | Ga0207647_100773813 | 212 |
| 249 | 3300025961 | Ga0207712_10246645 | Ga0207712_102466452 | 212 |
| 250 | 3300025972 | Ga0207668_10056157 | Ga0207668_100561572 | 212 |
| 251 | 3300025981 | Ga0207640_10291440 | Ga0207640_102914402 | 212 |
| 252 | 3300026078 | Ga0207702_10793955 | Ga0207702_107939551 | 212 |
| 253 | 3300026116 | Ga0207674_10285589 | Ga0207674_102855892 | 212 |
| 254 | 3300026142 | Ga0207698_10131092 | Ga0207698_101310922 | 212 |
| 255 | 3300028380 | Ga0268265_11160322 | Ga0268265_111603221 | 212 |
| 256 | 3300028794 | Ga0307515_10218685 | Ga0307515_102186852 | 212 |
| 257 | 3300031456 | Ga0307513_10294356 | Ga0307513_102943562 | 212 |
| 258 | 3300031456 | Ga0307513_10345968 | Ga0307513_103459681 | 212 |
| 259 | 3300031456 | Ga0307513_10606857 | Ga0307513_106068571 | 212 |
| 260 | 3300046660 | Ga0495625_0281093 | Ga0495625_0281093_301_1014 | 212 |
| 261 | 3300048912 | Ga0496109_0506445 | Ga0496109_0506445_240_953 | 212 |
| 262 | 3300050507 | nmdc:mga05p37_262167_c1 | nmdc:mga05p37_262167_c1_294_1007 | 212 |
| 263 | 3300050509 | nmdc:mga0qj67_89332_c1 | nmdc:mga0qj67_89332_c1_760_1473 | 212 |
| 264 | 3300050510 | nmdc:mga06r32_57751_c1 | nmdc:mga06r32_57751_c1_1781_2494 | 212 |
| 265 | 3300053099 | Ga0500654_133501 | Ga0500654_133501_37_750 | 212 |
| 266 | iso_pu_bacteria | 2816332119 | 2816420852 | 212 |
| 267 | 3300039450 | Ga0436363_1342941 | Ga0436363_1342941_485_1189 | 213 |
| 268 | iso_pu_bacteria | 2675903060 | 2676489937 | 213 |
| 269 | iso_pu_bacteria | 8056060235 | 8056065168 | 215 |
| 270 | 3300044658 | Ga0466972_0166989 | Ga0466972_0166989_269_1018 | 216 |
| 271 | 3300009098 | Ga0105245_10430511 | Ga0105245_104305112 | 218 |
| 272 | 3300048924 | Ga0496121_0028645 | Ga0496121_0028645_82_789 | 218 |
| 273 | 3300005347 | Ga0070668_100070913 | Ga0070668_1000709133 | 219 |
| 274 | 3300005355 | Ga0070671_100008515 | Ga0070671_1000085154 | 219 |
| 275 | 3300005441 | Ga0070700_100000011 | Ga0070700_100000011123 | 219 |
| 276 | 3300005548 | Ga0070665_100000583 | Ga0070665_10000058315 | 219 |
| 277 | 3300005841 | Ga0068863_100001923 | Ga0068863_10000192316 | 219 |
| 278 | 3300005842 | Ga0068858_100020875 | Ga0068858_1000208753 | 219 |
| 279 | 3300005843 | Ga0068860_100000043 | Ga0068860_10000004314 | 219 |
| 280 | 3300009093 | Ga0105240_10107868 | Ga0105240_101078683 | 219 |
| 281 | 3300025931 | Ga0207644_10007960 | Ga0207644_100079605 | 219 |
| 282 | 3300025972 | Ga0207668_10046090 | Ga0207668_100460902 | 219 |
| 283 | 3300026035 | Ga0207703_10061420 | Ga0207703_100614203 | 219 |
| 284 | 3300026075 | Ga0207708_10000009 | Ga0207708_10000009151 | 219 |
| 285 | 3300026088 | Ga0207641_10003044 | Ga0207641_1000304411 | 219 |
| 286 | 3300028379 | Ga0268266_10010053 | Ga0268266_100100532 | 219 |
| 287 | 3300028381 | Ga0268264_10000027 | Ga0268264_10000027227 | 219 |
| 288 | 3300048929 | Ga0496126_0000006 | Ga0496126_0000006_359259_360059 | 219 |
| 289 | 3300048929 | Ga0496126_0091257 | Ga0496126_0091257_895_1596 | 219 |
| 290 | 3300013104 | Ga0157370_10030742 | Ga0157370_100307426 | 220 |
| 291 | 3300013307 | Ga0157372_10000572 | Ga0157372_100005724 | 220 |
| 292 | 3300025913 | Ga0207695_10117098 | Ga0207695_101170982 | 220 |
| 293 | 3300025949 | Ga0207667_10412829 | Ga0207667_104128292 | 220 |
| 294 | 3300026142 | Ga0207698_10003632 | Ga0207698_100036322 | 220 |
| 295 | 3300044684 | Ga0466966_0143083 | Ga0466966_0143083_511_1203 | 220 |
| 296 | 3300044693 | Ga0466961_0187100 | Ga0466961_0187100_255_947 | 220 |
| 297 | 3300048916 | Ga0496113_0003403 | Ga0496113_0003403_3582_4313 | 220 |
| 298 | 3300049590 | Ga0501074_0246950 | Ga0501074_0246950_504_1196 | 220 |
| 299 | 3300049822 | Ga0501035_0372983 | Ga0501035_0372983_156_848 | 220 |
| 300 | 3300005329 | Ga0070683_100148969 | Ga0070683_1001489692 | 221 |
| 301 | 3300005330 | Ga0070690_100048870 | Ga0070690_1000488702 | 221 |
| 302 | 3300005331 | Ga0070670_100284830 | Ga0070670_1002848302 | 221 |
| 303 | 3300005334 | Ga0068869_100032565 | Ga0068869_1000325652 | 221 |
| 304 | 3300005338 | Ga0068868_100012229 | Ga0068868_1000122296 | 221 |
| 305 | 3300005339 | Ga0070660_100051151 | Ga0070660_1000511511 | 221 |
| 306 | 3300005341 | Ga0070691_10009203 | Ga0070691_100092033 | 221 |
| 307 | 3300005345 | Ga0070692_10012197 | Ga0070692_100121972 | 221 |
| 308 | 3300005347 | Ga0070668_100026144 | Ga0070668_1000261442 | 221 |
| 309 | 3300005353 | Ga0070669_100078905 | Ga0070669_1000789052 | 221 |
| 310 | 3300005355 | Ga0070671_100455775 | Ga0070671_1004557752 | 221 |
| 311 | 3300005356 | Ga0070674_100326649 | Ga0070674_1003266491 | 221 |
| 312 | 3300005364 | Ga0070673_100022819 | Ga0070673_1000228193 | 221 |
| 313 | 3300005366 | Ga0070659_100009680 | Ga0070659_1000096806 | 221 |
| 314 | 3300005367 | Ga0070667_100042662 | Ga0070667_1000426622 | 221 |
| 315 | 3300005435 | Ga0070714_100000006 | Ga0070714_10000000694 | 221 |
| 316 | 3300005435 | Ga0070714_100041666 | Ga0070714_1000416662 | 221 |
| 317 | 3300005436 | Ga0070713_100340173 | Ga0070713_1003401732 | 221 |
| 318 | 3300005436 | Ga0070713_100698712 | Ga0070713_1006987122 | 221 |
| 319 | 3300005437 | Ga0070710_10041589 | Ga0070710_100415892 | 221 |
| 320 | 3300005444 | Ga0070694_100007551 | Ga0070694_1000075513 | 221 |
| 321 | 3300005455 | Ga0070663_100445085 | Ga0070663_1004450851 | 221 |
| 322 | 3300005456 | Ga0070678_100015145 | Ga0070678_1000151454 | 221 |
| 323 | 3300005457 | Ga0070662_100049004 | Ga0070662_1000490042 | 221 |
| 324 | 3300005458 | Ga0070681_10207867 | Ga0070681_102078672 | 221 |
| 325 | 3300005466 | Ga0070685_10045194 | Ga0070685_100451942 | 221 |
| 326 | 3300005471 | Ga0070698_100421595 | Ga0070698_1004215952 | 221 |
| 327 | 3300005539 | Ga0068853_100025489 | Ga0068853_1000254895 | 221 |
| 328 | 3300005544 | Ga0070686_100027534 | Ga0070686_1000275343 | 221 |
| 329 | 3300005547 | Ga0070693_100078620 | Ga0070693_1000786202 | 221 |
| 330 | 3300005548 | Ga0070665_100110403 | Ga0070665_1001104032 | 221 |
| 331 | 3300005549 | Ga0070704_100014714 | Ga0070704_1000147143 | 221 |
| 332 | 3300005563 | Ga0068855_100028337 | Ga0068855_1000283372 | 221 |
| 333 | 3300005563 | Ga0068855_100208469 | Ga0068855_1002084691 | 221 |
| 334 | 3300005564 | Ga0070664_100093138 | Ga0070664_1000931382 | 221 |
| 335 | 3300005617 | Ga0068859_100007500 | Ga0068859_1000075009 | 221 |
| 336 | 3300005617 | Ga0068859_100037500 | Ga0068859_1000375002 | 221 |
| 337 | 3300005718 | Ga0068866_10137612 | Ga0068866_101376122 | 221 |
| 338 | 3300005719 | Ga0068861_100072988 | Ga0068861_1000729882 | 221 |
| 339 | 3300005841 | Ga0068863_100035481 | Ga0068863_1000354812 | 221 |
| 340 | 3300005842 | Ga0068858_100078839 | Ga0068858_1000788392 | 221 |
| 341 | 3300005843 | Ga0068860_100023775 | Ga0068860_1000237754 | 221 |
| 342 | 3300005937 | Ga0081455_10061462 | Ga0081455_100614622 | 221 |
| 343 | 3300005983 | Ga0081540_1006605 | Ga0081540_10066057 | 221 |
| 344 | 3300005983 | Ga0081540_1065856 | Ga0081540_10658561 | 221 |
| 345 | 3300006028 | Ga0070717_10289165 | Ga0070717_102891651 | 221 |
| 346 | 3300006173 | Ga0070716_100019555 | Ga0070716_1000195552 | 221 |
| 347 | 3300006175 | Ga0070712_100012110 | Ga0070712_1000121103 | 221 |
| 348 | 3300006237 | Ga0097621_100083652 | Ga0097621_1000836522 | 221 |
| 349 | 3300006358 | Ga0068871_100159110 | Ga0068871_1001591102 | 221 |
| 350 | 3300006852 | Ga0075433_10016078 | Ga0075433_100160783 | 221 |
| 351 | 3300006871 | Ga0075434_100016850 | Ga0075434_1000168502 | 221 |
| 352 | 3300006914 | Ga0075436_100037954 | Ga0075436_1000379542 | 221 |
| 353 | 3300006931 | Ga0097620_100007500 | Ga0097620_1000075003 | 221 |
| 354 | 3300006931 | Ga0097620_100037501 | Ga0097620_1000375012 | 221 |
| 355 | 3300007076 | Ga0075435_100011796 | Ga0075435_1000117963 | 221 |
| 356 | 3300009011 | Ga0105251_10027028 | Ga0105251_100270282 | 221 |
| 357 | 3300009148 | Ga0105243_10026434 | Ga0105243_100264343 | 221 |
| 358 | 3300009174 | Ga0105241_10360934 | Ga0105241_103609341 | 221 |
| 359 | 3300009177 | Ga0105248_10038236 | Ga0105248_100382365 | 221 |
| 360 | 3300009545 | Ga0105237_10351057 | Ga0105237_103510572 | 221 |
| 361 | 3300009551 | Ga0105238_10068670 | Ga0105238_100686702 | 221 |
| 362 | 3300009551 | Ga0105238_10692597 | Ga0105238_106925971 | 221 |
| 363 | 3300009553 | Ga0105249_10012741 | Ga0105249_100127415 | 221 |
| 364 | 3300011119 | Ga0105246_10027733 | Ga0105246_100277332 | 221 |
| 365 | 3300013104 | Ga0157370_10031251 | Ga0157370_100312513 | 221 |
| 366 | 3300013296 | Ga0157374_10026072 | Ga0157374_100260726 | 221 |
| 367 | 3300013297 | Ga0157378_10028408 | Ga0157378_100284085 | 221 |
| 368 | 3300013306 | Ga0163162_10024324 | Ga0163162_100243243 | 221 |
| 369 | 3300014325 | Ga0163163_10225507 | Ga0163163_102255072 | 221 |
| 370 | 3300017792 | Ga0163161_10008970 | Ga0163161_100089703 | 221 |
| 371 | 3300020069 | Ga0197907_10054147 | Ga0197907_100541472 | 221 |
| 372 | 3300020069 | Ga0197907_10472253 | Ga0197907_104722532 | 221 |
| 373 | 3300020070 | Ga0206356_10832449 | Ga0206356_108324492 | 221 |
| 374 | 3300020070 | Ga0206356_10895185 | Ga0206356_108951852 | 221 |
| 375 | 3300020076 | Ga0206355_1559621 | Ga0206355_15596212 | 221 |
| 376 | 3300020077 | Ga0206351_10099769 | Ga0206351_100997692 | 221 |
| 377 | 3300020080 | Ga0206350_10343000 | Ga0206350_103430002 | 221 |
| 378 | 3300020080 | Ga0206350_10484499 | Ga0206350_104844991 | 221 |
| 379 | 3300020080 | Ga0206350_10560694 | Ga0206350_105606942 | 221 |
| 380 | 3300020080 | Ga0206350_11523504 | Ga0206350_115235041 | 221 |
| 381 | 3300020081 | Ga0206354_10024162 | Ga0206354_100241622 | 221 |
| 382 | 3300020081 | Ga0206354_11484205 | Ga0206354_114842052 | 221 |
| 383 | 3300020082 | Ga0206353_11129427 | Ga0206353_111294272 | 221 |
| 384 | 3300020082 | Ga0206353_11329945 | Ga0206353_113299452 | 221 |
| 385 | 3300020082 | Ga0206353_11529310 | Ga0206353_115293102 | 221 |
| 386 | 3300022467 | Ga0224712_10011470 | Ga0224712_100114702 | 221 |
| 387 | 3300022467 | Ga0224712_10016089 | Ga0224712_100160892 | 221 |
| 388 | 3300025898 | Ga0207692_10021505 | Ga0207692_100215053 | 221 |
| 389 | 3300025899 | Ga0207642_10027317 | Ga0207642_100273172 | 221 |
| 390 | 3300025900 | Ga0207710_10038767 | Ga0207710_100387672 | 221 |
| 391 | 3300025901 | Ga0207688_10010631 | Ga0207688_100106313 | 221 |
| 392 | 3300025903 | Ga0207680_10123215 | Ga0207680_101232152 | 221 |
| 393 | 3300025904 | Ga0207647_10030415 | Ga0207647_100304152 | 221 |
| 394 | 3300025905 | Ga0207685_10042083 | Ga0207685_100420831 | 221 |
| 395 | 3300025906 | Ga0207699_10063981 | Ga0207699_100639812 | 221 |
| 396 | 3300025912 | Ga0207707_10178109 | Ga0207707_101781092 | 221 |
| 397 | 3300025913 | Ga0207695_10527083 | Ga0207695_105270831 | 221 |
| 398 | 3300025915 | Ga0207693_10002556 | Ga0207693_100025565 | 221 |
| 399 | 3300025917 | Ga0207660_10561794 | Ga0207660_105617941 | 221 |
| 400 | 3300025919 | Ga0207657_10056954 | Ga0207657_100569542 | 221 |
| 401 | 3300025921 | Ga0207652_10108915 | Ga0207652_101089152 | 221 |
| 402 | 3300025924 | Ga0207694_10127414 | Ga0207694_101274141 | 221 |
| 403 | 3300025927 | Ga0207687_10055765 | Ga0207687_100557652 | 221 |
| 404 | 3300025928 | Ga0207700_10270933 | Ga0207700_102709332 | 221 |
| 405 | 3300025929 | Ga0207664_10000062 | Ga0207664_1000006292 | 221 |
| 406 | 3300025929 | Ga0207664_10192941 | Ga0207664_101929411 | 221 |
| 407 | 3300025933 | Ga0207706_10015986 | Ga0207706_100159862 | 221 |
| 408 | 3300025934 | Ga0207686_10062672 | Ga0207686_100626722 | 221 |
| 409 | 3300025937 | Ga0207669_10293701 | Ga0207669_102937012 | 221 |
| 410 | 3300025939 | Ga0207665_10000377 | Ga0207665_100003773 | 221 |
| 411 | 3300025941 | Ga0207711_10030837 | Ga0207711_100308372 | 221 |
| 412 | 3300025942 | Ga0207689_10022357 | Ga0207689_100223574 | 221 |
| 413 | 3300025944 | Ga0207661_10121391 | Ga0207661_101213912 | 221 |
| 414 | 3300025949 | Ga0207667_10372205 | Ga0207667_103722052 | 221 |
| 415 | 3300025961 | Ga0207712_10018188 | Ga0207712_100181884 | 221 |
| 416 | 3300025972 | Ga0207668_10132036 | Ga0207668_101320362 | 221 |
| 417 | 3300026023 | Ga0207677_10004763 | Ga0207677_100047634 | 221 |
| 418 | 3300026041 | Ga0207639_10031394 | Ga0207639_100313942 | 221 |
| 419 | 3300026067 | Ga0207678_10027937 | Ga0207678_100279374 | 221 |
| 420 | 3300026067 | Ga0207678_10367799 | Ga0207678_103677992 | 221 |
| 421 | 3300026116 | Ga0207674_10122745 | Ga0207674_101227452 | 221 |
| 422 | 3300026118 | Ga0207675_100095087 | Ga0207675_1000950872 | 221 |
| 423 | 3300026121 | Ga0207683_10000462 | Ga0207683_1000046227 | 221 |
| 424 | 3300028379 | Ga0268266_10097607 | Ga0268266_100976072 | 221 |
| 425 | 3300035088 | Ga0373940_0004094 | Ga0373940_0004094_1873_2625 | 221 |
| 426 | 3300035091 | Ga0373951_0005625 | Ga0373951_0005625_1525_2277 | 221 |
| 427 | 3300035114 | Ga0373939_0005397 | Ga0373939_0005397_1814_2566 | 221 |
| 428 | 3300035171 | Ga0373946_0278835 | Ga0373946_0278835_107_805 | 221 |
| 429 | 3300035207 | Ga0373942_0057807 | Ga0373942_0057807_152_904 | 221 |
| 430 | 3300035242 | Ga0373962_0034407 | Ga0373962_0034407_372_1124 | 221 |
| 431 | 3300035691 | Ga0373931_0007216 | Ga0373931_0007216_2344_3096 | 221 |
| 432 | 3300035695 | Ga0373927_0013483 | Ga0373927_0013483_824_1582 | 221 |
| 433 | 3300039437 | Ga0436365_1019911 | Ga0436365_1019911_2822_3595 | 221 |
| 434 | 3300039437 | Ga0436365_1132394 | Ga0436365_1132394_1874_2698 | 221 |
| 435 | 3300044656 | Ga0466969_0051965 | Ga0466969_0051965_1152_1847 | 221 |
| 436 | 3300044658 | Ga0466972_0139281 | Ga0466972_0139281_245_937 | 221 |
| 437 | 3300044693 | Ga0466961_0017691 | Ga0466961_0017691_1799_2494 | 221 |
| 438 | 3300044693 | Ga0466961_0033365 | Ga0466961_0033365_1398_2093 | 221 |
| 439 | 3300044694 | Ga0466963_0152174 | Ga0466963_0152174_587_1282 | 221 |
| 440 | 3300045049 | Ga0466959_0022747 | Ga0466959_0022747_2489_3184 | 221 |
| 441 | 3300045049 | Ga0466959_0172371 | Ga0466959_0172371_33_749 | 221 |
| 442 | 3300045836 | Ga0466958_0014946 | Ga0466958_0014946_1312_2004 | 221 |
| 443 | 3300045836 | Ga0466958_0057179 | Ga0466958_0057179_525_1220 | 221 |
| 444 | 3300045976 | Ga0466967_0005617 | Ga0466967_0005617_237_950 | 221 |
| 445 | 3300045976 | Ga0466967_0023907 | Ga0466967_0023907_108_803 | 221 |
| 446 | 3300045976 | Ga0466967_0061671 | Ga0466967_0061671_2579_3274 | 221 |
| 447 | 3300045976 | Ga0466967_0156980 | Ga0466967_0156980_223_921 | 221 |
| 448 | 3300045976 | Ga0466967_0189135 | Ga0466967_0189135_450_1145 | 221 |
| 449 | 3300045976 | Ga0466967_0201328 | Ga0466967_0201328_13_708 | 221 |
| 450 | 3300045976 | Ga0466967_0270094 | Ga0466967_0270094_401_1150 | 221 |
| 451 | 3300048903 | Ga0496100_0534894 | Ga0496100_0534894_44_748 | 221 |
| 452 | 3300048904 | Ga0496101_0035254 | Ga0496101_0035254_1578_2330 | 221 |
| 453 | 3300048905 | Ga0496102_0000095 | Ga0496102_0000095_1821_2525 | 221 |
| 454 | 3300048905 | Ga0496102_0000682 | Ga0496102_0000682_27898_28593 | 221 |
| 455 | 3300048906 | Ga0496103_0000042 | Ga0496103_0000042_43710_44414 | 221 |
| 456 | 3300048906 | Ga0496103_0026196 | Ga0496103_0026196_829_1524 | 221 |
| 457 | 3300048907 | Ga0496104_0013659 | Ga0496104_0013659_825_1547 | 221 |
| 458 | 3300048908 | Ga0496105_0036566 | Ga0496105_0036566_2145_2867 | 221 |
| 459 | 3300048909 | Ga0496106_0029251 | Ga0496106_0029251_1001_1723 | 221 |
| 460 | 3300048910 | Ga0496107_0028576 | Ga0496107_0028576_2590_3342 | 221 |
| 461 | 3300048911 | Ga0496108_0023814 | Ga0496108_0023814_541_1263 | 221 |
| 462 | 3300048912 | Ga0496109_0009965 | Ga0496109_0009965_2626_3345 | 221 |
| 463 | 3300048913 | Ga0496110_0009051 | Ga0496110_0009051_1924_2646 | 221 |
| 464 | 3300048913 | Ga0496110_0226670 | Ga0496110_0226670_385_1104 | 221 |
| 465 | 3300048914 | Ga0496111_0026637 | Ga0496111_0026637_1659_2381 | 221 |
| 466 | 3300048914 | Ga0496111_0038854 | Ga0496111_0038854_1575_2297 | 221 |
| 467 | 3300048916 | Ga0496113_0031947 | Ga0496113_0031947_250_972 | 221 |
| 468 | 3300048916 | Ga0496113_0149026 | Ga0496113_0149026_195_917 | 221 |
| 469 | 3300048917 | Ga0496114_0012135 | Ga0496114_0012135_3667_4389 | 221 |
| 470 | 3300048918 | Ga0496115_0017668 | Ga0496115_0017668_1012_1734 | 221 |
| 471 | 3300048922 | Ga0496119_0161770 | Ga0496119_0161770_387_1091 | 221 |
| 472 | 3300048924 | Ga0496121_0023550 | Ga0496121_0023550_1280_1984 | 221 |
| 473 | 3300049568 | Ga0501031_0007867 | Ga0501031_0007867_6078_6791 | 221 |
| 474 | 3300049571 | Ga0501034_0023051 | Ga0501034_0023051_3113_3826 | 221 |
| 475 | 3300049573 | Ga0501037_0216433 | Ga0501037_0216433_220_933 | 221 |
| 476 | 3300049574 | Ga0501038_0007911 | Ga0501038_0007911_6388_7101 | 221 |
| 477 | 3300049579 | Ga0501043_0029182 | Ga0501043_0029182_1152_1865 | 221 |
| 478 | 3300049581 | Ga0501047_0048014 | Ga0501047_0048014_297_1010 | 221 |
| 479 | 3300049582 | Ga0501048_0007150 | Ga0501048_0007150_3483_4196 | 221 |
| 480 | 3300049586 | Ga0501070_0044885 | Ga0501070_0044885_1587_2300 | 221 |
| 481 | 3300049822 | Ga0501035_0544760 | Ga0501035_0544760_83_811 | 221 |
| 482 | 3300049823 | Ga0501044_0100023 | Ga0501044_0100023_27_740 | 221 |
| 483 | 3300050512 | nmdc:mga0n895_121798_c1 | nmdc:mga0n895_121798_c1_1122_1874 | 221 |
| 484 | 3300050513 | nmdc:mga0rr50_103138_c1 | nmdc:mga0rr50_103138_c1_622_1344 | 221 |
| 485 | 3300050514 | nmdc:mga08x19_25929_c1 | nmdc:mga08x19_25929_c1_925_1647 | 221 |
| 486 | 3300060353 | Ga0501082_0220375 | Ga0501082_0220375_734_1447 | 221 |
| 487 | 3300005329 | Ga0070683_101071610 | Ga0070683_1010716101 | 222 |
| 488 | 3300005563 | Ga0068855_100018263 | Ga0068855_1000182636 | 222 |
| 489 | 3300009093 | Ga0105240_10076218 | Ga0105240_100762182 | 222 |
| 490 | 3300009545 | Ga0105237_10024906 | Ga0105237_100249068 | 222 |
| 491 | 3300009545 | Ga0105237_10175889 | Ga0105237_101758892 | 222 |
| 492 | 3300010375 | Ga0105239_11004481 | Ga0105239_110044811 | 222 |
| 493 | 3300022467 | Ga0224712_10113989 | Ga0224712_101139891 | 222 |
| 494 | 3300025904 | Ga0207647_10022378 | Ga0207647_100223782 | 222 |
| 495 | 3300025913 | Ga0207695_10074055 | Ga0207695_100740552 | 222 |
| 496 | 3300025914 | Ga0207671_10046923 | Ga0207671_100469231 | 222 |
| 497 | 3300025914 | Ga0207671_10076476 | Ga0207671_100764762 | 222 |
| 498 | 3300025924 | Ga0207694_10136786 | Ga0207694_101367862 | 222 |
| 499 | 3300025944 | Ga0207661_10894267 | Ga0207661_108942671 | 222 |
| 500 | 3300025949 | Ga0207667_10136705 | Ga0207667_101367052 | 222 |
| 501 | 3300026078 | Ga0207702_10142928 | Ga0207702_101429283 | 222 |
| 502 | 3300044656 | Ga0466969_0083026 | Ga0466969_0083026_66_764 | 222 |
| 503 | 3300044658 | Ga0466972_0032673 | Ga0466972_0032673_1759_2457 | 222 |
| 504 | 3300044658 | Ga0466972_0057291 | Ga0466972_0057291_1160_1855 | 222 |
| 505 | 3300044658 | Ga0466972_0253398 | Ga0466972_0253398_75_770 | 222 |
| 506 | 3300044683 | Ga0466965_0024385 | Ga0466965_0024385_2122_2823 | 222 |
| 507 | 3300044683 | Ga0466965_0210086 | Ga0466965_0210086_300_995 | 222 |
| 508 | 3300044684 | Ga0466966_0026650 | Ga0466966_0026650_2925_3620 | 222 |
| 509 | 3300044684 | Ga0466966_0038382 | Ga0466966_0038382_911_1606 | 222 |
| 510 | 3300044684 | Ga0466966_0045094 | Ga0466966_0045094_977_1678 | 222 |
| 511 | 3300044684 | Ga0466966_0055571 | Ga0466966_0055571_144_839 | 222 |
| 512 | 3300044684 | Ga0466966_0062172 | Ga0466966_0062172_1144_1839 | 222 |
| 513 | 3300044684 | Ga0466966_0481787 | Ga0466966_0481787_20_715 | 222 |
| 514 | 3300044693 | Ga0466961_0005646 | Ga0466961_0005646_4663_5358 | 222 |
| 515 | 3300044693 | Ga0466961_0009564 | Ga0466961_0009564_1214_1909 | 222 |
| 516 | 3300044693 | Ga0466961_0010645 | Ga0466961_0010645_4860_5561 | 222 |
| 517 | 3300044693 | Ga0466961_0030202 | Ga0466961_0030202_2095_2790 | 222 |
| 518 | 3300044693 | Ga0466961_0038407 | Ga0466961_0038407_2218_2913 | 222 |
| 519 | 3300044693 | Ga0466961_0047692 | Ga0466961_0047692_953_1651 | 222 |
| 520 | 3300044693 | Ga0466961_0203696 | Ga0466961_0203696_510_1208 | 222 |
| 521 | 3300044694 | Ga0466963_0044114 | Ga0466963_0044114_1344_2045 | 222 |
| 522 | 3300044706 | Ga0466964_0067599 | Ga0466964_0067599_257_952 | 222 |
| 523 | 3300044719 | Ga0466971_0010997 | Ga0466971_0010997_410_1111 | 222 |
| 524 | 3300044719 | Ga0466971_0014064 | Ga0466971_0014064_2679_3374 | 222 |
| 525 | 3300044719 | Ga0466971_0067476 | Ga0466971_0067476_900_1598 | 222 |
| 526 | 3300044719 | Ga0466971_0135614 | Ga0466971_0135614_56_751 | 222 |
| 527 | 3300044765 | Ga0466970_0049835 | Ga0466970_0049835_394_1095 | 222 |
| 528 | 3300044842 | Ga0466957_0045859 | Ga0466957_0045859_1428_2126 | 222 |
| 529 | 3300044842 | Ga0466957_0046335 | Ga0466957_0046335_1678_2373 | 222 |
| 530 | 3300044842 | Ga0466957_0047152 | Ga0466957_0047152_1334_2035 | 222 |
| 531 | 3300044901 | Ga0466960_0000785 | Ga0466960_0000785_2810_3505 | 222 |
| 532 | 3300044901 | Ga0466960_0001736 | Ga0466960_0001736_2244_2945 | 222 |
| 533 | 3300045049 | Ga0466959_0058435 | Ga0466959_0058435_1141_1842 | 222 |
| 534 | 3300045049 | Ga0466959_0066185 | Ga0466959_0066185_212_907 | 222 |
| 535 | 3300045049 | Ga0466959_0101800 | Ga0466959_0101800_25_720 | 222 |
| 536 | 3300045049 | Ga0466959_0198452 | Ga0466959_0198452_554_1249 | 222 |
| 537 | 3300045049 | Ga0466959_0296373 | Ga0466959_0296373_118_816 | 222 |
| 538 | 3300045836 | Ga0466958_0041370 | Ga0466958_0041370_1088_1783 | 222 |
| 539 | 3300045836 | Ga0466958_0101020 | Ga0466958_0101020_138_839 | 222 |
| 540 | 3300045836 | Ga0466958_0163483 | Ga0466958_0163483_392_1087 | 222 |
| 541 | 3300045836 | Ga0466958_0581206 | Ga0466958_0581206_21_716 | 222 |
| 542 | 3300045976 | Ga0466967_0131052 | Ga0466967_0131052_1216_1917 | 222 |
| 543 | 3300046511 | Ga0495608_0439189 | Ga0495608_0439189_24_728 | 222 |
| 544 | 3300048922 | Ga0496119_0000276 | Ga0496119_0000276_25008_25715 | 222 |
| 545 | 3300048923 | Ga0496120_0017628 | Ga0496120_0017628_1061_1768 | 222 |
| 546 | 3300001915 | JGI24741J21665_1016548 | JGI24741J21665_10165481 | 223 |
| 547 | 3300002459 | JGI24751J29686_10000695 | JGI24751J29686_100006956 | 223 |
| 548 | 3300004798 | Ga0058859_11291813 | Ga0058859_112918131 | 223 |
| 549 | 3300005327 | Ga0070658_10273353 | Ga0070658_102733531 | 223 |
| 550 | 3300005329 | Ga0070683_100740823 | Ga0070683_1007408231 | 223 |
| 551 | 3300005330 | Ga0070690_100122506 | Ga0070690_1001225062 | 223 |
| 552 | 3300005331 | Ga0070670_100148793 | Ga0070670_1001487932 | 223 |
| 553 | 3300005334 | Ga0068869_100026523 | Ga0068869_1000265232 | 223 |
| 554 | 3300005336 | Ga0070680_100006905 | Ga0070680_1000069052 | 223 |
| 555 | 3300005337 | Ga0070682_100004812 | Ga0070682_1000048123 | 223 |
| 556 | 3300005338 | Ga0068868_100019278 | Ga0068868_1000192783 | 223 |
| 557 | 3300005340 | Ga0070689_100044431 | Ga0070689_1000444312 | 223 |
| 558 | 3300005341 | Ga0070691_10000766 | Ga0070691_100007665 | 223 |
| 559 | 3300005344 | Ga0070661_100013492 | Ga0070661_1000134923 | 223 |
| 560 | 3300005345 | Ga0070692_10004966 | Ga0070692_100049663 | 223 |
| 561 | 3300005354 | Ga0070675_100039210 | Ga0070675_1000392103 | 223 |
| 562 | 3300005364 | Ga0070673_100150800 | Ga0070673_1001508002 | 223 |
| 563 | 3300005365 | Ga0070688_100036075 | Ga0070688_1000360752 | 223 |
| 564 | 3300005434 | Ga0070709_10012909 | Ga0070709_100129092 | 223 |
| 565 | 3300005435 | Ga0070714_100141872 | Ga0070714_1001418722 | 223 |
| 566 | 3300005436 | Ga0070713_100001654 | Ga0070713_1000016542 | 223 |
| 567 | 3300005437 | Ga0070710_10047479 | Ga0070710_100474792 | 223 |
| 568 | 3300005438 | Ga0070701_10062991 | Ga0070701_100629912 | 223 |
| 569 | 3300005440 | Ga0070705_100123441 | Ga0070705_1001234411 | 223 |
| 570 | 3300005455 | Ga0070663_100008414 | Ga0070663_1000084143 | 223 |
| 571 | 3300005456 | Ga0070678_100008274 | Ga0070678_1000082743 | 223 |
| 572 | 3300005459 | Ga0068867_100218413 | Ga0068867_1002184132 | 223 |
| 573 | 3300005530 | Ga0070679_100020026 | Ga0070679_1000200266 | 223 |
| 574 | 3300005535 | Ga0070684_100680595 | Ga0070684_1006805951 | 223 |
| 575 | 3300005547 | Ga0070693_100056308 | Ga0070693_1000563083 | 223 |
| 576 | 3300005548 | Ga0070665_100029459 | Ga0070665_1000294593 | 223 |
| 577 | 3300005564 | Ga0070664_100104341 | Ga0070664_1001043412 | 223 |
| 578 | 3300005577 | Ga0068857_100656316 | Ga0068857_1006563161 | 223 |
| 579 | 3300005578 | Ga0068854_100070746 | Ga0068854_1000707462 | 223 |
| 580 | 3300005614 | Ga0068856_100257194 | Ga0068856_1002571942 | 223 |
| 581 | 3300005615 | Ga0070702_100000733 | Ga0070702_1000007331 | 223 |
| 582 | 3300005616 | Ga0068852_100017532 | Ga0068852_1000175322 | 223 |
| 583 | 3300005617 | Ga0068859_100139800 | Ga0068859_1001398002 | 223 |
| 584 | 3300005618 | Ga0068864_100007753 | Ga0068864_1000077537 | 223 |
| 585 | 3300005719 | Ga0068861_100276391 | Ga0068861_1002763912 | 223 |
| 586 | 3300005834 | Ga0068851_10011468 | Ga0068851_100114685 | 223 |
| 587 | 3300005840 | Ga0068870_10001504 | Ga0068870_100015045 | 223 |
| 588 | 3300005841 | Ga0068863_100015654 | Ga0068863_1000156545 | 223 |
| 589 | 3300005842 | Ga0068858_100027183 | Ga0068858_1000271833 | 223 |
| 590 | 3300005843 | Ga0068860_101010140 | Ga0068860_1010101401 | 223 |
| 591 | 3300005983 | Ga0081540_1051198 | Ga0081540_10511983 | 223 |
| 592 | 3300006237 | Ga0097621_100007324 | Ga0097621_1000073243 | 223 |
| 593 | 3300006358 | Ga0068871_100007410 | Ga0068871_1000074102 | 223 |
| 594 | 3300006844 | Ga0075428_100655131 | Ga0075428_1006551312 | 223 |
| 595 | 3300006852 | Ga0075433_10006704 | Ga0075433_100067046 | 223 |
| 596 | 3300006871 | Ga0075434_100024777 | Ga0075434_1000247772 | 223 |
| 597 | 3300006880 | Ga0075429_100158853 | Ga0075429_1001588531 | 223 |
| 598 | 3300006914 | Ga0075436_100004139 | Ga0075436_1000041397 | 223 |
| 599 | 3300006931 | Ga0097620_100139806 | Ga0097620_1001398062 | 223 |
| 600 | 3300007076 | Ga0075435_100005125 | Ga0075435_1000051255 | 223 |
| 601 | 3300009011 | Ga0105251_10027850 | Ga0105251_100278502 | 223 |
| 602 | 3300009093 | Ga0105240_10140469 | Ga0105240_101404692 | 223 |
| 603 | 3300009094 | Ga0111539_10051696 | Ga0111539_100516963 | 223 |
| 604 | 3300009094 | Ga0111539_10550896 | Ga0111539_105508962 | 223 |
| 605 | 3300009098 | Ga0105245_10016117 | Ga0105245_100161175 | 223 |
| 606 | 3300009101 | Ga0105247_10103499 | Ga0105247_101034992 | 223 |
| 607 | 3300009147 | Ga0114129_10061250 | Ga0114129_100612501 | 223 |
| 608 | 3300009177 | Ga0105248_10044819 | Ga0105248_100448193 | 223 |
| 609 | 3300009545 | Ga0105237_10024351 | Ga0105237_100243512 | 223 |
| 610 | 3300009553 | Ga0105249_10559088 | Ga0105249_105590881 | 223 |
| 611 | 3300010375 | Ga0105239_10050341 | Ga0105239_100503412 | 223 |
| 612 | 3300011119 | Ga0105246_10005937 | Ga0105246_100059373 | 223 |
| 613 | 3300013100 | Ga0157373_10233368 | Ga0157373_102333681 | 223 |
| 614 | 3300013102 | Ga0157371_10029273 | Ga0157371_100292732 | 223 |
| 615 | 3300013105 | Ga0157369_10130456 | Ga0157369_101304562 | 223 |
| 616 | 3300013296 | Ga0157374_10133909 | Ga0157374_101339091 | 223 |
| 617 | 3300013307 | Ga0157372_10038556 | Ga0157372_100385563 | 223 |
| 618 | 3300013308 | Ga0157375_10032954 | Ga0157375_100329543 | 223 |
| 619 | 3300014325 | Ga0163163_10066080 | Ga0163163_100660801 | 223 |
| 620 | 3300014745 | Ga0157377_10001463 | Ga0157377_100014637 | 223 |
| 621 | 3300014745 | Ga0157377_10408894 | Ga0157377_104088941 | 223 |
| 622 | 3300014968 | Ga0157379_10046413 | Ga0157379_100464133 | 223 |
| 623 | 3300020070 | Ga0206356_10697636 | Ga0206356_106976362 | 223 |
| 624 | 3300020075 | Ga0206349_1492927 | Ga0206349_14929272 | 223 |
| 625 | 3300020076 | Ga0206355_1149142 | Ga0206355_11491422 | 223 |
| 626 | 3300020078 | Ga0206352_10998045 | Ga0206352_109980451 | 223 |
| 627 | 3300020080 | Ga0206350_11508004 | Ga0206350_115080042 | 223 |
| 628 | 3300020081 | Ga0206354_10899815 | Ga0206354_108998153 | 223 |
| 629 | 3300020082 | Ga0206353_10066264 | Ga0206353_100662641 | 223 |
| 630 | 3300020082 | Ga0206353_10745633 | Ga0206353_107456332 | 223 |
| 631 | 3300022467 | Ga0224712_10074384 | Ga0224712_100743842 | 223 |
| 632 | 3300025321 | Ga0207656_10003024 | Ga0207656_100030243 | 223 |
| 633 | 3300025735 | Ga0207713_1033848 | Ga0207713_10338482 | 223 |
| 634 | 3300025898 | Ga0207692_10383621 | Ga0207692_103836211 | 223 |
| 635 | 3300025900 | Ga0207710_10088771 | Ga0207710_100887712 | 223 |
| 636 | 3300025903 | Ga0207680_10243352 | Ga0207680_102433522 | 223 |
| 637 | 3300025904 | Ga0207647_10063959 | Ga0207647_100639592 | 223 |
| 638 | 3300025906 | Ga0207699_10015308 | Ga0207699_100153084 | 223 |
| 639 | 3300025907 | Ga0207645_10010317 | Ga0207645_100103173 | 223 |
| 640 | 3300025908 | Ga0207643_10000767 | Ga0207643_1000076715 | 223 |
| 641 | 3300025909 | Ga0207705_10003281 | Ga0207705_100032816 | 223 |
| 642 | 3300025911 | Ga0207654_10014312 | Ga0207654_100143123 | 223 |
| 643 | 3300025912 | Ga0207707_10011969 | Ga0207707_100119693 | 223 |
| 644 | 3300025914 | Ga0207671_10127960 | Ga0207671_101279602 | 223 |
| 645 | 3300025915 | Ga0207693_10126653 | Ga0207693_101266531 | 223 |
| 646 | 3300025916 | Ga0207663_10050352 | Ga0207663_100503523 | 223 |
| 647 | 3300025919 | Ga0207657_10025974 | Ga0207657_100259741 | 223 |
| 648 | 3300025921 | Ga0207652_10073567 | Ga0207652_100735674 | 223 |
| 649 | 3300025924 | Ga0207694_10261139 | Ga0207694_102611391 | 223 |
| 650 | 3300025925 | Ga0207650_10002367 | Ga0207650_1000236711 | 223 |
| 651 | 3300025926 | Ga0207659_10121319 | Ga0207659_101213192 | 223 |
| 652 | 3300025927 | Ga0207687_10004320 | Ga0207687_100043203 | 223 |
| 653 | 3300025928 | Ga0207700_10084217 | Ga0207700_100842172 | 223 |
| 654 | 3300025931 | Ga0207644_10006695 | Ga0207644_100066955 | 223 |
| 655 | 3300025932 | Ga0207690_10024644 | Ga0207690_100246441 | 223 |
| 656 | 3300025932 | Ga0207690_10059282 | Ga0207690_100592823 | 223 |
| 657 | 3300025941 | Ga0207711_10051681 | Ga0207711_100516814 | 223 |
| 658 | 3300025942 | Ga0207689_10058523 | Ga0207689_100585232 | 223 |
| 659 | 3300025944 | Ga0207661_10005626 | Ga0207661_100056262 | 223 |
| 660 | 3300025944 | Ga0207661_10096274 | Ga0207661_100962741 | 223 |
| 661 | 3300025945 | Ga0207679_10022015 | Ga0207679_100220152 | 223 |
| 662 | 3300025945 | Ga0207679_10975054 | Ga0207679_109750541 | 223 |
| 663 | 3300025960 | Ga0207651_10093262 | Ga0207651_100932622 | 223 |
| 664 | 3300025961 | Ga0207712_10353269 | Ga0207712_103532692 | 223 |
| 665 | 3300026023 | Ga0207677_10084891 | Ga0207677_100848911 | 223 |
| 666 | 3300026035 | Ga0207703_10228213 | Ga0207703_102282132 | 223 |
| 667 | 3300026078 | Ga0207702_10001433 | Ga0207702_100014335 | 223 |
| 668 | 3300026078 | Ga0207702_10033754 | Ga0207702_100337544 | 223 |
| 669 | 3300026088 | Ga0207641_10020478 | Ga0207641_100204785 | 223 |
| 670 | 3300026095 | Ga0207676_10001005 | Ga0207676_100010055 | 223 |
| 671 | 3300026121 | Ga0207683_10011522 | Ga0207683_100115222 | 223 |
| 672 | 3300026142 | Ga0207698_10006669 | Ga0207698_100066692 | 223 |
| 673 | 3300027907 | Ga0207428_10001819 | Ga0207428_100018195 | 223 |
| 674 | 3300028379 | Ga0268266_10049778 | Ga0268266_100497783 | 223 |
| 675 | 3300028381 | Ga0268264_10476508 | Ga0268264_104765082 | 223 |
| 676 | 3300038443 | Ga0395901_0238153 | Ga0395901_0238153_1131_1823 | 223 |
| 677 | 3300042005 | Ga0439448_0006700 | Ga0439448_0006700_2204_2896 | 223 |
| 678 | 3300044719 | Ga0466971_0093222 | Ga0466971_0093222_142_906 | 223 |
| 679 | 3300048903 | Ga0496100_0027221 | Ga0496100_0027221_2228_2920 | 223 |
| 680 | 3300048904 | Ga0496101_0016324 | Ga0496101_0016324_2002_2694 | 223 |
| 681 | 3300048905 | Ga0496102_0002597 | Ga0496102_0002597_3151_3843 | 223 |
| 682 | 3300048907 | Ga0496104_0009220 | Ga0496104_0009220_7850_8542 | 223 |
| 683 | 3300048908 | Ga0496105_0003598 | Ga0496105_0003598_6043_6735 | 223 |
| 684 | 3300048909 | Ga0496106_0051809 | Ga0496106_0051809_1292_1984 | 223 |
| 685 | 3300048910 | Ga0496107_0176721 | Ga0496107_0176721_837_1529 | 223 |
| 686 | 3300048911 | Ga0496108_0009746 | Ga0496108_0009746_3991_4683 | 223 |
| 687 | 3300048912 | Ga0496109_0085550 | Ga0496109_0085550_410_1102 | 223 |
| 688 | 3300048913 | Ga0496110_0013512 | Ga0496110_0013512_2897_3589 | 223 |
| 689 | 3300048914 | Ga0496111_0007099 | Ga0496111_0007099_2315_3007 | 223 |
| 690 | 3300048915 | Ga0496112_0123457 | Ga0496112_0123457_355_1047 | 223 |
| 691 | 3300048916 | Ga0496113_0015498 | Ga0496113_0015498_4140_4832 | 223 |
| 692 | 3300048917 | Ga0496114_0120519 | Ga0496114_0120519_625_1317 | 223 |
| 693 | 3300050508 | nmdc:mga09592_383619_c1 | nmdc:mga09592_383619_c1_288_980 | 223 |
| 694 | 3300050511 | nmdc:mga08y16_1868_c1 | nmdc:mga08y16_1868_c1_11841_12533 | 223 |
| 695 | 3300050512 | nmdc:mga0n895_15670_c1 | nmdc:mga0n895_15670_c1_2943_3635 | 223 |
| 696 | 3300050513 | nmdc:mga0rr50_8639_c1 | nmdc:mga0rr50_8639_c1_2916_3608 | 223 |
| 697 | 3300050514 | nmdc:mga08x19_16502_c1 | nmdc:mga08x19_16502_c1_1542_2234 | 223 |
| 698 | 3300050515 | nmdc:mga0a205_742_c1 | nmdc:mga0a205_742_c1_21810_22502 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b25-assembly1.cif.gz_D | dtxr-like iron-dependent regulator ider (q43a variant) complexed with cobalt and its consensus dna-binding sequence | 0.9809 | 6 | 141 |
| 7b1y-assembly1.cif.gz_A | dtxr-like iron-dependent regulator ider complexed with cobalt and its consensus dna-binding sequence | 0.9795 | 6 | 141 |
| 1f5t-assembly1.cif.gz_A | diphtheria tox repressor (c102d mutant) complexed with nickel and dtxr consensus binding sequence | 0.978 | 5 | 123 |
| 1bi3-assembly1.cif.gz_B | structure of apo-and holo-diphtheria toxin repressor | 0.9774 | 7 | 141 |
| 2it0-assembly1.cif.gz_C | crystal structure of a two-domain ider-dna complex crystal form ii | 0.9751 | 6 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ddnC02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 0.9966 | 79 | 122 | 1.10.60.10 |
| 3glxA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9959 | 9 | 75 | 1.10.10.10 |
| 1ddnD02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 0.994 | 79 | 122 | 1.10.60.10 |
| 1f5tA02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 0.9922 | 79 | 123 | 1.10.60.10 |
| 2iszA02 | Mainly Alpha;Orthogonal Bundle;Diphtheria Toxin Repressor; domain 2;Iron dependent repressor, metal binding and dimerisation domain | 0.9867 | 79 | 138 | 1.10.60.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9YTY5-F1-model_v4 | Dihydrofolate reductase | 0.9947 | 12 | 135 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A259S4L2-F1-model_v4 | Dihydrofolate reductase | 0.9878 | 5 | 132 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A1W9YTY5-F1-model_v4 | Dihydrofolate reductase | 0.9789 | 12 | 135 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A259S4L2-F1-model_v4 | Dihydrofolate reductase | 0.9727 | 5 | 132 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
| AF-A0A838FYR1-F1-model_v4 | Manganese transport regulator | 0.9682 | 11 | 136 |
GO:0003677
GO:0003700 GO:0045892 GO:0046914 GO:0046983 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar