F475869

General Info

Members Datasets Scaffolds Average Seq Length
696 332 636 258

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237150|2513952980
Length 297
Sequence RPASPAVPAGRMVAVVSRRIRYNLGLFVLGYCRDFAMLIVLSPAKSLDYETPARIKTHTLPRFIDRSAALIERLRRLAPQDVGALMDISDKLAVLNVTRYADWSPTFTAANSKQAVLAFNGDVYDGLDAKSLSADDLGFAQKHLRILSGLYGVLRPLDWMQPYRLEMGTRLDNAAGKDLYAFWGDDVTQMLNADMAALKQEGAPVLVNLASEEYFKVVRPKVLQARIVTPVFEDWKGGRYKIISFHAKRARGTMARYAVTHRVTDPEKLKRFAEDGYAFDKAASDATRWVFRRRPED

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
5 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
6 2547132374 Acidovorax radicis N35 Isolate Unclassified
7 2547132512 Azospira oryzae 6a3 Isolate Unclassified
8 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
9 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
10 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
11 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
12 2643221556 Massilia sp. Root1485 Isolate Unclassified
13 2643221570 Acidovorax sp. Root568 Isolate Unclassified
14 2643221585 Pelomonas sp. Root662 Isolate Unclassified
15 2643221596 Acidovorax sp. Root70 Isolate Unclassified
16 2643221609 Acidovorax sp. Root217 Isolate Unclassified
17 2643221611 Acidovorax sp. Root219 Isolate Unclassified
18 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
19 2643221652 Acidovorax sp. Root402 Isolate Unclassified
20 2643221656 Pelomonas sp. Root405 Isolate Unclassified
21 2643221684 Massilia sp. Root133 Isolate Unclassified
22 2643221717 Acidovorax sp. Root267 Isolate Unclassified
23 2721755523 Delftia sp. HK171 Isolate Unclassified
24 2738541337 Pelomonas sp. BT06 Isolate Unclassified
25 2738543012 Acidovorax sp. CF301 Isolate Unclassified
26 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
27 2816332133 Acidovorax radicis 2721A Isolate Unclassified
28 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
29 2831864461 Roseateles noduli HZ7 Isolate Nodule
30 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
31 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
32 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
33 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
34 2855730933 Achromobacter sp. HZ28 Isolate Nodule
35 2855767633 Achromobacter sp. HZ34 Isolate Nodule
36 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
37 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
38 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
39 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
40 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
41 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
42 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
43 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
44 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
45 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
46 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
47 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
48 2928058823 Ralstonia sp. 1138 Isolate Unclassified
49 2932406140 Serratia sp. 2723 Isolate Rhizosphere
50 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
51 2939577877 Serratia sp. 509 Isolate Rhizosphere
52 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
53 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
54 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
55 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
56 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
57 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
58 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
59 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
60 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
61 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
62 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
65 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
66 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
67 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
68 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
69 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
70 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
71 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
72 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
76 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
95 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
96 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
114 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
179 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
182 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
183 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
184 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
185 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
186 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
187 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
188 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
300 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
301 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
304 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
305 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
308 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
311 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
312 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
313 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
314 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
328 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
329 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
330 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
331 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
332 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 0
Isolates 8.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.36
Nodule 2.16
Rhizoplane 2.44
Rhizosphere 70.83
Stem 0
Stem Tuber 0
Unclassified 12.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000095 3300001915 Bacteria 22931
2 JGI24740J21852_10000583 3300001979 Bacteria 15702
3 JGI24735J21928_10000244 3300002067 Bacteria 19138
4 JGI24735J21928_10001284 3300002067 Bacteria 8912
5 JGI25155J39150_1000322 3300002704 Bacteria 16056
6 JGI25155J39150_1000431 3300002704 Bacteria 11242
7 JGI25156J39149_1001211 3300002705 Bacteria 11419
8 JGI25156J39149_1004182 3300002705 Bacteria 4471
9 JGI25162J39368_1004645 3300002737 Bacteria 3083
10 JGI25154J39366_1001024 3300002738 Bacteria 11245
11 JGI25154J39366_1001313 3300002738 Bacteria 9226
12 JGI25157J39369_1000382 3300002741 Bacteria 30479
13 JGI25151J46595_10000189 3300003187 Bacteria 75938
14 JGI25151J46595_10002320 3300003187 Bacteria 11607
15 JGI25151J46595_10002802 3300003187 Bacteria 10093
16 JGI25151J46595_10019711 3300003187 Bacteria 2859
17 JGI25151J46595_10034624 3300003187 Bacteria 1929
18 rootH1_10019850 3300003316 Bacteria 6409
19 rootH1_10052597 3300003316 Bacteria 5342
20 rootH2_10121114 3300003320 Bacteria 2186
21 rootL2_10000757 3300003322 Bacteria 81071
22 rootL2_10218078 3300003322 Bacteria 3054
23 rootH1_10023957 3300003323 Bacteria 8735
24 Ga0055532_1000050 3300003758 Bacteria 169240
25 Ga0055525_1000013 3300003759 Bacteria 440870
26 Ga0055525_1000025 3300003759 Bacteria 347582
27 Ga0055527_1005104 3300003760 Bacteria 1738
28 Ga0055542_1021151 3300003762 Bacteria 943
29 Ga0055529_1001265 3300003763 Bacteria 9145
30 Ga0055529_1002174 3300003763 Bacteria 4083
31 Ga0055526_1003989 3300003771 Bacteria 9084
32 Ga0055526_1021716 3300003771 Bacteria 2219
33 Ga0055526_1033750 3300003771 Bacteria 1414
34 Ga0055524_1000197 3300003775 Bacteria 66126
35 Ga0055524_1001275 3300003775 Bacteria 14776
36 Ga0055524_1003854 3300003775 Bacteria 7115
37 Ga0055524_1008526 3300003775 Bacteria 4249
38 Ga0055524_1023019 3300003775 Bacteria 2016
39 Ga0055536_1000130 3300003781 Bacteria 64676
40 Ga0055534_1001092 3300003784 Bacteria 11571
41 Ga0055531_10001392 3300003794 Bacteria 17911
42 Ga0055531_10007438 3300003794 Bacteria 5977
43 Ga0055531_10011279 3300003794 Bacteria 4332
44 Ga0055543_1002526 3300004625 Bacteria 5979
45 Ga0065165_1000024 3300005262 Bacteria 247672
46 Ga0065165_1000076 3300005262 Bacteria 163890
47 Ga0065165_1011315 3300005262 Bacteria 3741
48 Ga0070658_10022666 3300005327 Bacteria 5039
49 Ga0070670_100707648 3300005331 Bacteria 906
50 Ga0070682_100321969 3300005337 Bacteria 1142
51 Ga0070660_100055054 3300005339 Bacteria 3073
52 Ga0070660_100062549 3300005339 Bacteria 2892
53 Ga0070661_100001813 3300005344 Bacteria 14820
54 Ga0070661_100115955 3300005344 Bacteria 2003
55 Ga0070661_100138941 3300005344 Bacteria 1830
56 Ga0070659_100003416 3300005366 Bacteria 11314
57 Ga0070659_100053802 3300005366 Bacteria 3169
58 Ga0070659_100163209 3300005366 Bacteria 1822
59 Ga0070662_100004066 3300005457 Bacteria 9192
60 Ga0070662_100189709 3300005457 Bacteria 1625
61 Ga0070664_100002662 3300005564 Bacteria 14405
62 Ga0070664_100026437 3300005564 Bacteria 4814
63 Ga0070664_100081106 3300005564 Bacteria 2795
64 Ga0070664_100090437 3300005564 Bacteria 2649
65 Ga0068854_100001923 3300005578 Bacteria 12663
66 Ga0068856_100062243 3300005614 Bacteria 3686
67 Ga0068856_100424300 3300005614 Bacteria 1350
68 Ga0068852_100239274 3300005616 Bacteria 1734
69 Ga0068852_100512165 3300005616 Bacteria 1196
70 Ga0075364_10394477 3300006051 Bacteria 944
71 Ga0075364_10395658 3300006051 Bacteria 943
72 Ga0075366_10013631 3300006195 Bacteria 4633
73 Ga0075370_10002214 3300006353 Bacteria 8935
74 Ga0075370_10157011 3300006353 Bacteria 1334
75 Ga0075370_10189087 3300006353 Bacteria 1213
76 Ga0099823_1009406 3300006944 Bacteria 9930
77 Ga0079104_1000002 3300006946 Bacteria 514469
78 Ga0079104_1000013 3300006946 Bacteria 349477
79 Ga0099826_10000004 3300006948 Bacteria 802669
80 Ga0105251_10020734 3300009011 Bacteria 3447
81 Ga0105244_10081521 3300009036 Bacteria 1601
82 Ga0105250_10000528 3300009092 Bacteria 26590
83 Ga0105240_10003428 3300009093 Bacteria 24641
84 Ga0105240_10007958 3300009093 Bacteria 15290
85 Ga0105240_10126548 3300009093 Bacteria 3070
86 Ga0105240_10234303 3300009093 Bacteria 2132
87 Ga0114129_10022114 3300009147 Bacteria 9025
88 Ga0105243_10002695 3300009148 Bacteria 14753
89 Ga0105243_10053802 3300009148 Bacteria 3194
90 Ga0105243_10055980 3300009148 Bacteria 3134
91 Ga0105241_10013357 3300009174 Bacteria 6020
92 Ga0105242_10001240 3300009176 Bacteria 20102
93 Ga0105238_10044050 3300009551 Bacteria 4514
94 Ga0105246_10247793 3300011119 Bacteria 1412
95 Ga0157370_10460176 3300013104 Bacteria 1169
96 Ga0157369_10069343 3300013105 Bacteria 3788
97 Ga0163162_10023799 3300013306 Bacteria 6045
98 Ga0157372_10495465 3300013307 Bacteria 1425
99 Ga0182008_10010663 3300014497 Bacteria 4914
100 Ga0182008_10163248 3300014497 Bacteria 1122
101 Ga0213872_10000439 3300021361 Bacteria 34128
102 Ga0213872_10000535 3300021361 Bacteria 29790
103 Ga0213872_10016234 3300021361 Bacteria 3457
104 Ga0213872_10019688 3300021361 Bacteria 3108
105 Ga0209435_100205 3300025206 Bacteria 17074
106 Ga0209435_100316 3300025206 Bacteria 11600
107 Ga0209147_100004 3300025229 Bacteria 1371850
108 Ga0209563_100003 3300025230 Bacteria 1932942
109 Ga0209563_100025 3300025230 Bacteria 596456
110 Ga0209437_100053 3300025233 Bacteria 375580
111 Ga0209258_100720 3300025242 Bacteria 22119
112 Ga0209258_102490 3300025242 Bacteria 4702
113 Ga0209646_1000073 3300025246 Bacteria 224301
114 Ga0209646_1000109 3300025246 Bacteria 158348
115 Ga0209026_1000467 3300025250 Bacteria 31163
116 Ga0209026_1002391 3300025250 Bacteria 7079
117 Ga0209677_103294 3300025253 Bacteria 5341
118 Ga0209148_1002423 3300025254 Bacteria 6448
119 Ga0209759_1000064 3300025256 Bacteria 193120
120 Ga0209759_1001647 3300025256 Bacteria 11774
121 Ga0209565_1000217 3300025263 Bacteria 65539
122 Ga0209455_1012050 3300025272 Bacteria 2090
123 Ga0209673_1006916 3300025273 Bacteria 5368
124 Ga0209673_1012377 3300025273 Bacteria 3440
125 Ga0209673_1013773 3300025273 Bacteria 3172
126 Ga0209675_1000125 3300025291 Bacteria 105527
127 Ga0209675_1000242 3300025291 Bacteria 54636
128 Ga0209675_1006215 3300025291 Bacteria 4837
129 Ga0209676_1000014 3300025292 Bacteria 793514
130 Ga0209025_1000027 3300025294 Bacteria 505882
131 Ga0209025_1000379 3300025294 Bacteria 92457
132 Ga0209025_1000772 3300025294 Bacteria 53069
133 Ga0209025_1000811 3300025294 Bacteria 50182
134 Ga0209025_1002088 3300025294 Bacteria 22585
135 Ga0209564_1000005 3300025295 Bacteria 1147192
136 Ga0209564_1001161 3300025295 Bacteria 30619
137 Ga0209564_1003191 3300025295 Bacteria 11515
138 Ga0209564_1003312 3300025295 Bacteria 11189
139 Ga0209050_1006371 3300025298 Bacteria 7004
140 Ga0209050_1011664 3300025298 Bacteria 4134
141 Ga0209256_1000130 3300025299 Bacteria 163227
142 Ga0209256_1000474 3300025299 Bacteria 60300
143 Ga0209256_1000726 3300025299 Bacteria 43520
144 Ga0209256_1001296 3300025299 Bacteria 26977
145 Ga0209256_1001803 3300025299 Bacteria 20177
146 Ga0209051_1001144 3300025303 Bacteria 24179
147 Ga0209257_1000032 3300025304 Bacteria 680354
148 Ga0209257_1002554 3300025304 Bacteria 17754
149 Ga0209257_1002706 3300025304 Bacteria 16895
150 Ga0207713_1023996 3300025735 Bacteria 2854
151 Ga0207705_10007180 3300025909 Bacteria 8207
152 Ga0207654_10007015 3300025911 Bacteria 5674
153 Ga0207695_10002265 3300025913 Bacteria 28809
154 Ga0207695_10030679 3300025913 Bacteria 5914
155 Ga0207657_10016257 3300025919 Bacteria 7182
156 Ga0207657_10027737 3300025919 Bacteria 5180
157 Ga0207649_10001333 3300025920 Bacteria 14674
158 Ga0207649_10061127 3300025920 Bacteria 2370
159 Ga0207690_10001070 3300025932 Bacteria 17526
160 Ga0207706_10005589 3300025933 Bacteria 11715
161 Ga0207706_10045035 3300025933 Bacteria 3909
162 Ga0207686_10002565 3300025934 Bacteria 9879
163 Ga0207686_10006748 3300025934 Bacteria 6182
164 Ga0207709_10000015 3300025935 Bacteria 493221
165 Ga0207679_10000119 3300025945 Bacteria 63967
166 Ga0207679_10112213 3300025945 Bacteria 2154
167 Ga0207679_10191721 3300025945 Bacteria 1700
168 Ga0207667_10003481 3300025949 Bacteria 19435
169 Ga0207667_10014372 3300025949 Bacteria 9029
170 Ga0207667_10335682 3300025949 Bacteria 1543
171 Ga0207639_10334462 3300026041 Bacteria 1349
172 Ga0207702_10109988 3300026078 Bacteria 2448
173 Ga0207702_10180837 3300026078 Bacteria 1942
174 Ga0207702_10478220 3300026078 Bacteria 1212
175 Ga0207698_10617684 3300026142 Bacteria 1070
176 Ga0209281_1000007 3300027111 Bacteria 938265
177 Ga0209281_1000373 3300027111 Bacteria 71724
178 Ga0209282_1000015 3300027666 Bacteria 206531
179 Ga0209974_10068336 3300027876 Bacteria 1210
180 Ga0209974_10107284 3300027876 Bacteria 980
181 Ga0265323_10001835 3300028653 Bacteria 10077
182 Ga0307515_10008096 3300028794 Bacteria 20595
183 Ga0307515_10033350 3300028794 Bacteria 8483
184 Ga0307515_10139190 3300028794 Bacteria 2615
185 Ga0265332_10000021 3300031238 Bacteria 217090
186 Ga0265328_10015400 3300031239 Bacteria 2995
187 Ga0265327_10000184 3300031251 Bacteria 133023
188 Ga0265316_10000115 3300031344 Bacteria 86934
189 Ga0307513_10000008 3300031456 Bacteria 442128
190 Ga0307509_10000245 3300031507 Bacteria 87456
191 Ga0307408_100000046 3300031548 Bacteria 167686
192 Ga0307408_100001631 3300031548 Bacteria 16601
193 Ga0307516_10000654 3300031730 Bacteria 46810
194 Ga0307516_10004643 3300031730 Bacteria 16850
195 Ga0307516_10050099 3300031730 Bacteria 4099
196 Ga0307518_10130034 3300031838 Bacteria 1771
197 Ga0307406_10014564 3300031901 Bacteria 4528
198 Ga0307406_10162656 3300031901 Bacteria 1606
199 Ga0307414_10155180 3300032004 Bacteria 1811
200 Ga0373939_0000004 3300035114 Bacteria 106519
201 Ga0373960_0001434 3300035121 Bacteria 5279
202 Ga0373931_0001005 3300035691 Bacteria 11928
203 Ga0373925_0410082 3300037068 Bacteria 1106
204 Ga0395899_0000038 3300037312 Bacteria 272627
205 Ga0395899_0003383 3300037312 Bacteria 12655
206 Ga0395899_0014136 3300037312 Bacteria 6092
207 Ga0395899_0017993 3300037312 Bacteria 5377
208 Ga0395899_0022470 3300037312 Bacteria 4783
209 Ga0395899_0104739 3300037312 Bacteria 2038
210 Ga0395899_0124692 3300037312 Bacteria 1842
211 Ga0395899_0135059 3300037312 Bacteria 1759
212 Ga0395899_0142198 3300037312 Bacteria 1706
213 Ga0395899_0274234 3300037312 Bacteria 1149
214 Ga0395900_0000149 3300037418 Bacteria 117114
215 Ga0395900_0000722 3300037418 Bacteria 43960
216 Ga0395900_0001065 3300037418 Bacteria 35011
217 Ga0395900_0002833 3300037418 Bacteria 18928
218 Ga0395900_0052640 3300037418 Bacteria 4190
219 Ga0395900_0076700 3300037418 Bacteria 3434
220 Ga0395900_0081405 3300037418 Bacteria 3326
221 Ga0395900_0259912 3300037418 Bacteria 1734
222 Ga0395900_0512506 3300037418 Bacteria 1148
223 Ga0395898_0007471 3300037466 Bacteria 11604
224 Ga0395898_0024440 3300037466 Bacteria 6095
225 Ga0395898_0364205 3300037466 Bacteria 1378
226 Ga0395898_0401792 3300037466 Bacteria 1306
227 Ga0395898_0565814 3300037466 Bacteria 1079
228 Ga0395905_0001290 3300037471 Bacteria 30783
229 Ga0395905_0016039 3300037471 Bacteria 7121
230 Ga0395905_0561051 3300037471 Bacteria 1043
231 Ga0395905_0696008 3300037471 Bacteria 918
232 Ga0395905_0732475 3300037471 Bacteria 891
233 Ga0395901_0000002 3300038443 Bacteria 761045
234 Ga0395901_0000025 3300038443 Bacteria 263463
235 Ga0395901_0004022 3300038443 Bacteria 14808
236 Ga0395901_0107203 3300038443 Bacteria 2932
237 Ga0395901_0329602 3300038443 Bacteria 1578
238 Ga0395901_0470280 3300038443 Bacteria 1283
239 Ga0395901_0486226 3300038443 Bacteria 1258
240 Ga0395901_0532276 3300038443 Bacteria 1192
241 Ga0400487_44861 3300039110 Bacteria 21509
242 Ga0436360_0354560 3300039438 Bacteria 1465
243 Ga0436361_0076543 3300039447 Bacteria 28188
244 Ga0436361_0146317 3300039447 Bacteria 92155
245 Ga0436361_0346541 3300039447 Bacteria 2897
246 Ga0436361_0380881 3300039447 Bacteria 3961
247 Ga0436361_0567910 3300039447 Bacteria 16830
248 Ga0436361_0605002 3300039447 Bacteria 2730
249 Ga0439448_0003255 3300042005 Bacteria 4483
250 Ga0439449_0071467 3300042007 Bacteria 1278
251 Ga0439450_017345 3300042008 Bacteria 1500
252 Ga0439455_0032180 3300042012 Bacteria 1310
253 Ga0450917_000350 3300042120 Bacteria 3472
254 Ga0450923_023980 3300042125 Bacteria 1207
255 Ga0450888_000965 3300042126 Bacteria 2725
256 Ga0450890_006533 3300042127 Bacteria 1490
257 Ga0450891_000163 3300042129 Bacteria 6353
258 Ga0450903_002120 3300042138 Bacteria 3561
259 Ga0450889_004133 3300042144 Bacteria 1433
260 Ga0450889_007100 3300042144 Bacteria 1129
261 Ga0450906_015551 3300042145 Bacteria 1381
262 Ga0439434_0029072 3300042435 Bacteria 1675
263 Ga0439459_0000757 3300042438 Bacteria 4442
264 Ga0439464_0004308 3300042439 Bacteria 3637
265 Ga0439464_0020064 3300042439 Bacteria 1829
266 Ga0450893_0001105 3300042532 Bacteria 4063
267 Ga0450893_0018804 3300042532 Bacteria 1179
268 Ga0451577_0004032 3300042876 Bacteria 15796
269 Ga0451577_0444005 3300042876 Bacteria 1178
270 Ga0466969_0000005 3300044656 Bacteria 167170
271 Ga0466969_0004860 3300044656 Bacteria 7156
272 Ga0466969_0026577 3300044656 Bacteria 2967
273 Ga0466972_0032984 3300044658 Bacteria 2540
274 Ga0466972_0081766 3300044658 Bacteria 1538
275 Ga0466965_0003675 3300044683 Bacteria 6769
276 Ga0466965_0021679 3300044683 Bacteria 3094
277 Ga0466965_0071552 3300044683 Bacteria 1745
278 Ga0466965_0104854 3300044683 Bacteria 1448
279 Ga0466966_0011522 3300044684 Bacteria 5865
280 Ga0466966_0022230 3300044684 Bacteria 4163
281 Ga0466966_0033794 3300044684 Bacteria 3310
282 Ga0466966_0036979 3300044684 Bacteria 3150
283 Ga0466966_0062475 3300044684 Bacteria 2348
284 Ga0466966_0093572 3300044684 Bacteria 1863
285 Ga0466961_0009600 3300044693 Bacteria 6159
286 Ga0466961_0070815 3300044693 Bacteria 2213
287 Ga0466961_0123823 3300044693 Bacteria 1622
288 Ga0466963_0053174 3300044694 Bacteria 2688
289 Ga0466963_0076285 3300044694 Bacteria 2263
290 Ga0466964_0001584 3300044706 Bacteria 7841
291 Ga0466964_0007404 3300044706 Bacteria 4105
292 Ga0466964_0025215 3300044706 Bacteria 2320
293 Ga0453684_0001611 3300044712 Bacteria 61948
294 Ga0453684_0069422 3300044712 Bacteria 4469
295 Ga0453684_0485398 3300044712 Bacteria 1370
296 Ga0466968_0000616 3300044735 Bacteria 12152
297 Ga0466968_0001715 3300044735 Bacteria 7905
298 Ga0466968_0102542 3300044735 Bacteria 1279
299 Ga0466970_0013863 3300044765 Bacteria 4135
300 Ga0466957_0002534 3300044842 Bacteria 9832
301 Ga0466957_0006819 3300044842 Bacteria 6451
302 Ga0466957_0046479 3300044842 Bacteria 2635
303 Ga0466957_0075008 3300044842 Bacteria 2098
304 Ga0466957_0248321 3300044842 Bacteria 1182
305 Ga0466957_0298534 3300044842 Bacteria 1082
306 Ga0466957_0473847 3300044842 Bacteria 865
307 Ga0466960_0276598 3300044901 Bacteria 940
308 Ga0466959_0001619 3300045049 Bacteria 13887
309 Ga0466959_0009776 3300045049 Bacteria 6832
310 Ga0466959_0018064 3300045049 Bacteria 5175
311 Ga0466959_0042406 3300045049 Bacteria 3356
312 Ga0466959_0057342 3300045049 Bacteria 2839
313 Ga0466959_0122204 3300045049 Bacteria 1850
314 Ga0466959_0218811 3300045049 Bacteria 1321
315 Ga0451576_0011745 3300045051 Bacteria 9918
316 Ga0451576_0080854 3300045051 Bacteria 3380
317 Ga0451576_0807491 3300045051 Bacteria 985
318 Ga0466958_0003451 3300045836 Bacteria 8200
319 Ga0466958_0019518 3300045836 Bacteria 3947
320 Ga0466958_0053078 3300045836 Bacteria 2458
321 Ga0466958_0069835 3300045836 Bacteria 2148
322 Ga0466967_0002962 3300045976 Bacteria 10852
323 Ga0466967_0019271 3300045976 Bacteria 5482
324 Ga0466967_0054840 3300045976 Bacteria 3510
325 Ga0466967_0295503 3300045976 Bacteria 1557
326 Ga0466967_0882355 3300045976 Bacteria 889
327 Ga0495617_000045 3300046452 Bacteria 116918
328 Ga0495603_0038768 3300046455 Bacteria 2856
329 Ga0495590_0000518 3300046457 Bacteria 18773
330 Ga0495590_0006887 3300046457 Bacteria 4413
331 Ga0495590_0020004 3300046457 Bacteria 2380
332 Ga0495590_0025211 3300046457 Bacteria 2091
333 Ga0495629_0099556 3300046459 Bacteria 2028
334 Ga0495629_0271271 3300046459 Bacteria 1165
335 Ga0495638_0031427 3300046460 Bacteria 3413
336 Ga0495653_0039133 3300046463 Bacteria 3717
337 Ga0495653_0043919 3300046463 Bacteria 3471
338 Ga0495653_0044012 3300046463 Bacteria 3467
339 Ga0495580_0049204 3300046472 Bacteria 2982
340 Ga0495582_0002499 3300046473 Bacteria 10230
341 Ga0495582_0103200 3300046473 Bacteria 1597
342 Ga0495605_0000179 3300046474 Bacteria 80278
343 Ga0495605_0002373 3300046474 Bacteria 11699
344 Ga0495605_0004958 3300046474 Bacteria 7777
345 Ga0495605_0005231 3300046474 Bacteria 7571
346 Ga0495605_0019124 3300046474 Bacteria 3664
347 Ga0495605_0055936 3300046474 Bacteria 1904
348 Ga0495664_0112879 3300046477 Bacteria 1641
349 Ga0495584_0002614 3300046491 Bacteria 10152
350 Ga0495584_0003448 3300046491 Bacteria 8698
351 Ga0495584_0009505 3300046491 Bacteria 5006
352 Ga0495584_0020434 3300046491 Bacteria 3364
353 Ga0495584_0022962 3300046491 Bacteria 3165
354 Ga0495584_0040613 3300046491 Bacteria 2349
355 Ga0495584_0074249 3300046491 Bacteria 1709
356 Ga0495585_0000003 3300046492 Bacteria 406344
357 Ga0495585_0000261 3300046492 Bacteria 53904
358 Ga0495585_0104496 3300046492 Bacteria 1511
359 Ga0495594_0063669 3300046499 Bacteria 2043
360 Ga0495594_0167499 3300046499 Bacteria 1249
361 Ga0495594_0220082 3300046499 Bacteria 1082
362 Ga0495596_0000695 3300046500 Bacteria 20862
363 Ga0495596_0000926 3300046500 Bacteria 17499
364 Ga0495596_0001911 3300046500 Bacteria 11552
365 Ga0495596_0016356 3300046500 Bacteria 3083
366 Ga0495596_0017532 3300046500 Bacteria 2961
367 Ga0495596_0019043 3300046500 Bacteria 2824
368 Ga0495596_0019741 3300046500 Bacteria 2765
369 Ga0495596_0027688 3300046500 Bacteria 2277
370 Ga0495596_0074212 3300046500 Bacteria 1321
371 Ga0495607_0000109 3300046501 Bacteria 86702
372 Ga0495607_0001942 3300046501 Bacteria 17474
373 Ga0495607_0004965 3300046501 Bacteria 9657
374 Ga0495607_0005121 3300046501 Bacteria 9477
375 Ga0495607_0007294 3300046501 Bacteria 7668
376 Ga0495607_0016193 3300046501 Bacteria 4815
377 Ga0495607_0046794 3300046501 Bacteria 2537
378 Ga0495607_0108391 3300046501 Bacteria 1476
379 Ga0495607_0256475 3300046501 Bacteria 839
380 Ga0495583_0000378 3300046506 Bacteria 69104
381 Ga0495583_0000408 3300046506 Bacteria 65197
382 Ga0495583_0031410 3300046506 Bacteria 2574
383 Ga0495583_0075889 3300046506 Bacteria 1469
384 Ga0495583_0078525 3300046506 Bacteria 1437
385 Ga0495583_0085210 3300046506 Bacteria 1368
386 Ga0495606_0000087 3300046507 Bacteria 156407
387 Ga0495606_0002093 3300046507 Bacteria 24302
388 Ga0495606_0015390 3300046507 Bacteria 5895
389 Ga0495606_0037462 3300046507 Bacteria 3294
390 Ga0495606_0092817 3300046507 Bacteria 1853
391 Ga0495606_0168702 3300046507 Bacteria 1271
392 Ga0495606_0224493 3300046507 Bacteria 1056
393 Ga0495610_0008122 3300046512 Bacteria 6858
394 Ga0495610_0053011 3300046512 Bacteria 1967
395 Ga0495616_0000426 3300046513 Bacteria 32236
396 Ga0495616_0001149 3300046513 Bacteria 18706
397 Ga0495616_0002192 3300046513 Bacteria 13058
398 Ga0495616_0010482 3300046513 Bacteria 5363
399 Ga0495616_0010780 3300046513 Bacteria 5270
400 Ga0495616_0075963 3300046513 Bacteria 1615
401 Ga0495630_0032338 3300046517 Bacteria 3898
402 Ga0495630_0383073 3300046517 Bacteria 1077
403 Ga0495631_0000527 3300046518 Bacteria 25718
404 Ga0495631_0001364 3300046518 Bacteria 14906
405 Ga0495631_0047929 3300046518 Bacteria 1874
406 Ga0495631_0199127 3300046518 Bacteria 856
407 Ga0495632_0000044 3300046519 Bacteria 141051
408 Ga0495632_0002563 3300046519 Bacteria 13759
409 Ga0495632_0013405 3300046519 Bacteria 4679
410 Ga0495632_0123288 3300046519 Bacteria 1209
411 Ga0495637_0034487 3300046520 Bacteria 2216
412 Ga0495643_0000391 3300046522 Bacteria 57750
413 Ga0495643_0000869 3300046522 Bacteria 32227
414 Ga0495643_0005390 3300046522 Bacteria 8657
415 Ga0495643_0017889 3300046522 Bacteria 4132
416 Ga0495643_0039083 3300046522 Bacteria 2596
417 Ga0495644_0166751 3300046523 Bacteria 845
418 Ga0495648_0000011 3300046524 Bacteria 299518
419 Ga0495648_0007725 3300046524 Bacteria 8565
420 Ga0495648_0014229 3300046524 Bacteria 5835
421 Ga0495648_0059285 3300046524 Bacteria 2284
422 Ga0495648_0080155 3300046524 Bacteria 1861
423 Ga0495666_0000729 3300046526 Bacteria 15049
424 Ga0495666_0001684 3300046526 Bacteria 10917
425 Ga0495666_0056261 3300046526 Bacteria 1884
426 Ga0495642_0003750 3300046528 Bacteria 5947
427 Ga0495642_0003892 3300046528 Bacteria 5851
428 Ga0495642_0007776 3300046528 Bacteria 4107
429 Ga0495642_0026327 3300046528 Bacteria 2309
430 Ga0495642_0070233 3300046528 Bacteria 1464
431 Ga0495642_0076924 3300046528 Bacteria 1401
432 Ga0495652_0004643 3300046529 Bacteria 13096
433 Ga0495654_0002852 3300046530 Bacteria 10852
434 Ga0495654_0048377 3300046530 Bacteria 2087
435 Ga0495665_0020963 3300046531 Bacteria 3512
436 Ga0495665_0045196 3300046531 Bacteria 2339
437 Ga0495665_0071981 3300046531 Bacteria 1820
438 Ga0495586_0019356 3300046535 Bacteria 3622
439 Ga0495609_0000001 3300046538 Bacteria 1060094
440 Ga0495609_0002658 3300046538 Bacteria 10828
441 Ga0495609_0009697 3300046538 Bacteria 4645
442 Ga0495609_0019931 3300046538 Bacteria 3101
443 Ga0495609_0028507 3300046538 Bacteria 2547
444 Ga0495609_0078386 3300046538 Bacteria 1446
445 Ga0495597_0000009 3300046542 Bacteria 227319
446 Ga0495597_0000110 3300046542 Bacteria 72678
447 Ga0495597_0002021 3300046542 Bacteria 13584
448 Ga0495597_0002561 3300046542 Bacteria 11388
449 Ga0495597_0003715 3300046542 Bacteria 8730
450 Ga0495597_0031740 3300046542 Bacteria 2401
451 Ga0495622_0002816 3300046557 Bacteria 8295
452 Ga0495622_0006438 3300046557 Bacteria 5448
453 Ga0495633_0007914 3300046558 Bacteria 6062
454 Ga0495633_0042837 3300046558 Bacteria 2148
455 Ga0495633_0052857 3300046558 Bacteria 1912
456 Ga0495668_0001888 3300046616 Bacteria 18772
457 Ga0495668_0015582 3300046616 Bacteria 4435
458 Ga0495634_0028008 3300046642 Bacteria 3914
459 Ga0495625_0003448 3300046660 Bacteria 15761
460 Ga0495625_0010656 3300046660 Bacteria 7577
461 Ga0495625_0048662 3300046660 Bacteria 3051
462 Ga0495625_0067826 3300046660 Bacteria 2509
463 Ga0495635_0004664 3300046663 Bacteria 9517
464 Ga0495661_0000206 3300046665 Bacteria 68072
465 Ga0495661_0000322 3300046665 Unclassified 52843
466 Ga0495661_0003474 3300046665 Bacteria 11628
467 Ga0495661_0005577 3300046665 Bacteria 8923
468 Ga0495661_0011423 3300046665 Bacteria 6028
469 Ga0495661_0015675 3300046665 Bacteria 5052
470 Ga0495661_0060698 3300046665 Bacteria 2245
471 Ga0495661_0086270 3300046665 Bacteria 1797
472 Ga0495661_0088739 3300046665 Bacteria 1764
473 Ga0495588_0000041 3300046674 Bacteria 377896
474 Ga0495588_0013280 3300046674 Bacteria 3921
475 Ga0495588_0030436 3300046674 Bacteria 2713
476 Ga0495623_0010880 3300046679 Bacteria 5890
477 Ga0495669_0000343 3300046684 Bacteria 24394
478 Ga0495669_0084114 3300046684 Bacteria 1463
479 Ga0495624_0046628 3300046690 Bacteria 2755
480 Ga0495670_0000681 3300046691 Bacteria 16145
481 Ga0495670_0030348 3300046691 Bacteria 2685
482 Ga0495670_0062311 3300046691 Bacteria 1876
483 Ga0495671_0016990 3300046692 Bacteria 3876
484 Ga0495671_0042948 3300046692 Bacteria 2270
485 Ga0495671_0192392 3300046692 Bacteria 990
486 Ga0495649_0001622 3300046694 Bacteria 16731
487 Ga0495649_0036940 3300046694 Bacteria 2683
488 Ga0495649_0063334 3300046694 Bacteria 1987
489 Ga0495649_0104429 3300046694 Bacteria 1504
490 Ga0495589_0000152 3300046794 Bacteria 64153
491 Ga0495589_0000349 3300046794 Bacteria 36218
492 Ga0495589_0000581 3300046794 Bacteria 25212
493 Ga0495589_0007293 3300046794 Bacteria 5791
494 Ga0495589_0040458 3300046794 Bacteria 2327
495 Ga0495660_0000293 3300046810 Bacteria 46071
496 Ga0495660_0002047 3300046810 Bacteria 13110
497 Ga0495660_0037094 3300046810 Bacteria 2716
498 Ga0495660_0046958 3300046810 Bacteria 2366
499 Ga0495581_0158817 3300047315 Bacteria 1322
500 Ga0495604_0038842 3300047317 Bacteria 3745
501 Ga0495604_0097511 3300047317 Bacteria 2167
502 Ga0495604_0108172 3300047317 Bacteria 2031
503 Ga0495604_0115594 3300047317 Bacteria 1949
504 Ga0495636_0023449 3300047318 Bacteria 2498
505 Ga0495674_0004801 3300047319 Bacteria 13004
506 Ga0495672_0000290 3300047320 Bacteria 69104
507 Ga0495672_0002954 3300047320 Bacteria 14972
508 Ga0495672_0004741 3300047320 Bacteria 10980
509 Ga0495672_0012894 3300047320 Bacteria 5795
510 Ga0495672_0058453 3300047320 Bacteria 2235
511 Ga0495672_0076688 3300047320 Bacteria 1876
512 Ga0495672_0185657 3300047320 Bacteria 1049
513 Ga0495672_0186318 3300047320 Bacteria 1047
514 Ga0495676_0001530 3300047321 Bacteria 20020
515 Ga0495676_0221689 3300047321 Bacteria 1303
516 Ga0495680_0010219 3300047322 Bacteria 8379
517 Ga0495683_0000001 3300047323 Unclassified 2230803
518 Ga0495683_0000378 3300047323 Bacteria 36355
519 Ga0495683_0001646 3300047323 Bacteria 14315
520 Ga0495683_0032369 3300047323 Bacteria 2663
521 Ga0495683_0096475 3300047323 Bacteria 1426
522 Ga0495687_000023 3300047443 Bacteria 317750
523 Ga0495687_000027 3300047443 Bacteria 299689
524 Ga0495687_000048 3300047443 Bacteria 205967
525 Ga0495687_001030 3300047443 Bacteria 27749
526 Ga0495687_001038 3300047443 Bacteria 27582
527 Ga0495687_080099 3300047443 Bacteria 1282
528 Ga0495675_0023999 3300047444 Bacteria 3886
529 Ga0495675_0031233 3300047444 Bacteria 3400
530 Ga0495675_0054849 3300047444 Bacteria 2528
531 Ga0495675_0121288 3300047444 Bacteria 1628
532 Ga0495677_0000001 3300047445 Bacteria 715000
533 Ga0495677_0002954 3300047445 Bacteria 6610
534 Ga0495677_0005300 3300047445 Bacteria 4892
535 Ga0495679_006948 3300047446 Bacteria 4796
536 Ga0495685_030036 3300047447 Bacteria 1868
537 Ga0495673_0109506 3300047469 Bacteria 1106
538 Ga0495681_0003837 3300047470 Bacteria 10402
539 Ga0495681_0048061 3300047470 Bacteria 2025
540 Ga0495681_0135567 3300047470 Bacteria 1044
541 Ga0495686_0000222 3300047472 Bacteria 104411
542 Ga0495593_0041985 3300047673 Bacteria 2457
543 Ga0495602_0126959 3300048088 Bacteria 2041
544 Ga0495614_0001966 3300048089 Bacteria 9039
545 Ga0495614_0002201 3300048089 Bacteria 8639
546 Ga0495626_0000015 3300048091 Bacteria 232238
547 Ga0495626_0000037 3300048091 Bacteria 178573
548 Ga0495626_0001295 3300048091 Bacteria 20411
549 Ga0495626_0005901 3300048091 Bacteria 7051
550 Ga0495626_0009781 3300048091 Bacteria 5162
551 Ga0495626_0024616 3300048091 Bacteria 2950
552 Ga0495626_0026199 3300048091 Bacteria 2844
553 Ga0495626_0038690 3300048091 Bacteria 2260
554 Ga0495626_0055865 3300048091 Bacteria 1808
555 Ga0495626_0064819 3300048091 Bacteria 1654
556 Ga0496100_0096659 3300048903 Bacteria 2027
557 Ga0496101_0214063 3300048904 Bacteria 1494
558 Ga0496102_0125769 3300048905 Bacteria 2396
559 Ga0496104_0330560 3300048907 Bacteria 1437
560 Ga0496106_0253787 3300048909 Bacteria 1406
561 Ga0496107_0182145 3300048910 Bacteria 1560
562 Ga0496109_0189775 3300048912 Bacteria 1931
563 Ga0496110_0000042 3300048913 Bacteria 62522
564 Ga0496110_0113963 3300048913 Bacteria 2432
565 Ga0496111_0153257 3300048914 Bacteria 1710
566 Ga0496113_0002475 3300048916 Bacteria 10755
567 Ga0496113_0298006 3300048916 Bacteria 1291
568 Ga0496114_0013604 3300048917 Bacteria 6526
569 Ga0496114_0017789 3300048917 Bacteria 5744
570 Ga0496115_0148000 3300048918 Bacteria 1938
571 Ga0496115_0422399 3300048918 Bacteria 1080
572 Ga0496116_0006577 3300048919 Bacteria 10523
573 Ga0496116_0006724 3300048919 Bacteria 10356
574 Ga0496116_0010436 3300048919 Bacteria 7780
575 Ga0496118_0108183 3300048921 Bacteria 1854
576 Ga0496121_0007101 3300048924 Bacteria 13594
577 Ga0496121_0013777 3300048924 Bacteria 8655
578 Ga0496121_0221004 3300048924 Bacteria 1334
579 Ga0496122_0001831 3300048925 Bacteria 32402
580 Ga0496122_0002346 3300048925 Bacteria 27289
581 Ga0496122_0004234 3300048925 Bacteria 18001
582 Ga0496122_0022639 3300048925 Bacteria 5577
583 Ga0496123_0002340 3300048926 Bacteria 23785
584 Ga0496123_0006360 3300048926 Bacteria 11466
585 Ga0496123_0016046 3300048926 Bacteria 6106
586 Ga0496124_0021653 3300048927 Bacteria 5921
587 Ga0496124_0021906 3300048927 Bacteria 5878
588 Ga0496124_0024529 3300048927 Bacteria 5480
589 Ga0496124_0042259 3300048927 Bacteria 3926
590 Ga0496124_0082827 3300048927 Bacteria 2633
591 Ga0496124_0098856 3300048927 Bacteria 2367
592 Ga0496124_0270380 3300048927 Bacteria 1245
593 Ga0496125_0002187 3300048928 Bacteria 26101
594 Ga0496125_0051403 3300048928 Bacteria 3399
595 Ga0496125_0163003 3300048928 Bacteria 1511
596 Ga0495678_000100 3300049459 Bacteria 106118
597 Ga0495678_000574 3300049459 Bacteria 34979
598 Ga0495678_009138 3300049459 Bacteria 4937
599 Ga0495682_0000809 3300049460 Bacteria 19750
600 Ga0501298_033184 3300049521 Bacteria 1022
601 Ga0501034_0000588 3300049571 Bacteria 57446
602 Ga0501034_0168021 3300049571 Bacteria 2162
603 Ga0501201_004634 3300049651 Bacteria 1277
604 Ga0501211_000129 3300049658 Bacteria 5863
605 Ga0501217_003788 3300049661 Bacteria 3074
606 Ga0501223_005346 3300049663 Bacteria 2701
607 Ga0501249_022059 3300049679 Bacteria 1392
608 Ga0501221_001033 3300049704 Bacteria 4572
609 Ga0501225_0047958 3300049705 Bacteria 1186
610 Ga0501229_000324 3300049706 Bacteria 5434
611 Ga0501229_002498 3300049706 Bacteria 2170
612 Ga0501262_003528 3300049759 Bacteria 1795
613 Ga0501267_003694 3300049764 Bacteria 1403
614 Ga0501269_003067 3300049766 Bacteria 2029
615 Ga0501272_000651 3300049769 Bacteria 3107
616 Ga0501035_0008697 3300049822 Bacteria 9453
617 Ga0501035_0023790 3300049822 Bacteria 5620
618 Ga0501035_0090258 3300049822 Bacteria 2698
619 Ga0501044_0001496 3300049823 Bacteria 27380
620 Ga0501044_0114121 3300049823 Bacteria 2708
621 nmdc:mga00v17_309052_c1 3300050491 Bacteria 1027
622 nmdc:mga00v17_350829_c1 3300050491 Bacteria 959
623 nmdc:mga0k408_46455_c1 3300050493 Bacteria 2507
624 nmdc:mga07m45_15465_c1 3300050496 Bacteria 4075
625 nmdc:mga07m45_249513_c1 3300050496 Bacteria 1033
626 nmdc:mga07m45_78400_c1 3300050496 Bacteria 1885
627 nmdc:mga05p37_161633_c1 3300050507 Bacteria 2735
628 Ga0500651_0002682 3300053093 Bacteria 9477
629 Ga0500593_000152 3300053117 Bacteria 27719
630 Ga0500559_0060352 3300053136 Bacteria 1690
631 Ga0500622_0003419 3300053156 Bacteria 10646
632 Ga0500624_010983 3300053157 Bacteria 1313
633 Ga0500634_0033061 3300053161 Bacteria 2819
634 Ga0500634_0052929 3300053161 Bacteria 2179
635 Ga0466962_0076615 3300061719 Bacteria 1598
636 Ga0466962_0119341 3300061719 Bacteria 1272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0807491 Ga0451576_0807491_333_962 207
2 3300044842 Ga0466957_0473847 Ga0466957_0473847_219_848 208
3 3300045976 Ga0466967_0882355 Ga0466967_0882355_236_865 208
4 3300053136 Ga0500559_0060352 Ga0500559_0060352_31_660 208
5 3300003322 rootL2_10218078 rootL2_102180782 220
6 3300028794 Ga0307515_10139190 Ga0307515_101391903 238
7 3300005331 Ga0070670_100707648 Ga0070670_1007076481 246
8 3300048905 Ga0496102_0125769 Ga0496102_0125769_46_822 246
9 3300048912 Ga0496109_0189775 Ga0496109_0189775_407_1183 246
10 3300048914 Ga0496111_0153257 Ga0496111_0153257_681_1457 246
11 3300048917 Ga0496114_0013604 Ga0496114_0013604_697_1473 246
12 3300046665 Ga0495661_0086270 Ga0495661_0086270_20_790 247
13 3300044712 Ga0453684_0485398 Ga0453684_0485398_276_1034 249
14 iso_pu_bacteria 2721755523 2722882207 250
15 iso_pu_bacteria 2839138175 2839138359 250
16 iso_pu_bacteria 2547132374 2548499928 251
17 iso_pu_bacteria 2643221544 2643745953 251
18 iso_pu_bacteria 2643221556 2643799072 251
19 iso_pu_bacteria 2643221639 2644220833 251
20 iso_pu_bacteria 2643221684 2644473597 251
21 iso_pu_bacteria 2643221717 2644644754 251
22 iso_pu_bacteria 2738541337 2739057255 251
23 iso_pu_bacteria 8047673197 8047679329 251
24 3300042144 Ga0450889_007100 Ga0450889_007100_179_949 252
25 iso_pu_bacteria 2501025502 2501076877 252
26 iso_pu_bacteria 2510917013 2511088947 252
27 iso_pu_bacteria 2643221570 2643868159 252
28 iso_pu_bacteria 2643221585 2643936927 252
29 iso_pu_bacteria 2643221596 2643993846 252
30 iso_pu_bacteria 2643221609 2644059721 252
31 iso_pu_bacteria 2643221611 2644074864 252
32 iso_pu_bacteria 2643221652 2644293766 252
33 iso_pu_bacteria 2643221656 2644318092 252
34 iso_pu_bacteria 2738543012 2739241249 252
35 iso_pu_bacteria 2816332133 2816473415 252
36 iso_pu_bacteria 2831864461 2831869698 252
37 iso_pu_bacteria 2834641062 2834641754 252
38 iso_pu_bacteria 2842718218 2842721379 252
39 iso_pu_bacteria 2886848708 2886848916 252
40 iso_pu_bacteria 2886848708 2886853773 252
41 iso_pu_bacteria 2932406140 2932406546 252
42 iso_pu_bacteria 2932422444 2932423753 252
43 iso_pu_bacteria 2939577877 2939578032 252
44 iso_pu_bacteria 2990710928 2990713482 252
45 iso_pu_bacteria 2998344455 2998346259 252
46 iso_pu_bacteria 8003400568 8003402762 252
47 iso_pu_bacteria 8055225921 8055228056 252
48 3300003775 Ga0055524_1000197 Ga0055524_100019756 253
49 3300005339 Ga0070660_100062549 Ga0070660_1000625493 253
50 3300005344 Ga0070661_100001813 Ga0070661_1000018133 253
51 3300005366 Ga0070659_100003416 Ga0070659_1000034164 253
52 3300005564 Ga0070664_100002662 Ga0070664_10000266213 253
53 3300006946 Ga0079104_1000013 Ga0079104_1000013102 253
54 3300025299 Ga0209256_1000130 Ga0209256_100013057 253
55 3300025920 Ga0207649_10001333 Ga0207649_100013333 253
56 3300025932 Ga0207690_10001070 Ga0207690_100010709 253
57 3300025945 Ga0207679_10000119 Ga0207679_1000011933 253
58 3300027111 Ga0209281_1000373 Ga0209281_100037335 253
59 3300031456 Ga0307513_10000008 Ga0307513_10000008307 253
60 3300031901 Ga0307406_10162656 Ga0307406_101626562 253
61 3300048917 Ga0496114_0017789 Ga0496114_0017789_1629_2411 253
62 3300053093 Ga0500651_0002682 Ga0500651_0002682_1232_2008 253
63 iso_pu_bacteria 2511231003 2511248053 253
64 iso_pu_bacteria 2513237165 2514043917 253
65 iso_pu_bacteria 2547132512 2548848421 253
66 iso_pu_bacteria 2548876994 2550693292 253
67 iso_pu_bacteria 2596583598 2597030070 253
68 iso_pu_bacteria 2599185178 2599443926 253
69 iso_pu_bacteria 2818991445 2819593486 253
70 iso_pu_bacteria 2843690924 2843694495 253
71 iso_pu_bacteria 2855730933 2855735959 253
72 iso_pu_bacteria 2855767633 2855772897 253
73 iso_pu_bacteria 2856287931 2856294067 253
74 iso_pu_bacteria 2857357740 2857362496 253
75 iso_pu_bacteria 2857576091 2857576574 253
76 iso_pu_bacteria 2858688981 2858692697 253
77 iso_pu_bacteria 2881412998 2881416467 253
78 iso_pu_bacteria 2884811622 2884814824 253
79 iso_pu_bacteria 2884836552 2884840019 253
80 iso_pu_bacteria 2884852848 2884857213 253
81 iso_pu_bacteria 2896154374 2896157800 253
82 iso_pu_bacteria 2900577576 2900578371 253
83 iso_pu_bacteria 2904479285 2904481692 253
84 iso_pu_bacteria 2928058823 2928062207 253
85 iso_pu_bacteria 8002392321 8002395085 253
86 3300005564 Ga0070664_100090437 Ga0070664_1000904372 254
87 3300006946 Ga0079104_1000002 Ga0079104_1000002348 254
88 3300009092 Ga0105250_10000528 Ga0105250_1000052821 254
89 3300009148 Ga0105243_10002695 Ga0105243_100026959 254
90 3300021361 Ga0213872_10000439 Ga0213872_100004399 254
91 3300025935 Ga0207709_10000015 Ga0207709_10000015340 254
92 3300025945 Ga0207679_10112213 Ga0207679_101122132 254
93 3300027111 Ga0209281_1000007 Ga0209281_1000007566 254
94 3300039110 Ga0400487_44861 Ga0400487_44861_16442_17326 254
95 3300039447 Ga0436361_0076543 Ga0436361_0076543_9839_10657 254
96 3300042439 Ga0439464_0020064 Ga0439464_0020064_158_934 254
97 3300003316 rootH1_10019850 rootH1_100198504 255
98 3300003759 Ga0055525_1000025 Ga0055525_1000025263 255
99 3300003762 Ga0055542_1021151 Ga0055542_10211511 255
100 3300005262 Ga0065165_1011315 Ga0065165_10113153 255
101 3300005339 Ga0070660_100055054 Ga0070660_1000550543 255
102 3300005344 Ga0070661_100115955 Ga0070661_1001159553 255
103 3300005344 Ga0070661_100138941 Ga0070661_1001389412 255
104 3300005366 Ga0070659_100053802 Ga0070659_1000538023 255
105 3300005366 Ga0070659_100163209 Ga0070659_1001632091 255
106 3300005457 Ga0070662_100189709 Ga0070662_1001897092 255
107 3300005564 Ga0070664_100026437 Ga0070664_1000264374 255
108 3300005564 Ga0070664_100081106 Ga0070664_1000811062 255
109 3300005614 Ga0068856_100424300 Ga0068856_1004243002 255
110 3300006353 Ga0075370_10157011 Ga0075370_101570112 255
111 3300006353 Ga0075370_10189087 Ga0075370_101890872 255
112 3300009036 Ga0105244_10081521 Ga0105244_100815211 255
113 3300009148 Ga0105243_10053802 Ga0105243_100538023 255
114 3300009148 Ga0105243_10055980 Ga0105243_100559802 255
115 3300009174 Ga0105241_10013357 Ga0105241_100133572 255
116 3300013104 Ga0157370_10460176 Ga0157370_104601762 255
117 3300013105 Ga0157369_10069343 Ga0157369_100693433 255
118 3300013307 Ga0157372_10495465 Ga0157372_104954652 255
119 3300025230 Ga0209563_100003 Ga0209563_1000031041 255
120 3300025253 Ga0209677_103294 Ga0209677_1032942 255
121 3300025254 Ga0209148_1002423 Ga0209148_10024234 255
122 3300025909 Ga0207705_10007180 Ga0207705_100071807 255
123 3300025911 Ga0207654_10007015 Ga0207654_100070156 255
124 3300025919 Ga0207657_10016257 Ga0207657_100162573 255
125 3300025919 Ga0207657_10027737 Ga0207657_100277375 255
126 3300025920 Ga0207649_10061127 Ga0207649_100611271 255
127 3300025933 Ga0207706_10045035 Ga0207706_100450354 255
128 3300025934 Ga0207686_10006748 Ga0207686_100067486 255
129 3300025945 Ga0207679_10191721 Ga0207679_101917212 255
130 3300025949 Ga0207667_10014372 Ga0207667_100143724 255
131 3300026041 Ga0207639_10334462 Ga0207639_103344622 255
132 3300026078 Ga0207702_10180837 Ga0207702_101808372 255
133 3300028794 Ga0307515_10008096 Ga0307515_100080964 255
134 3300028794 Ga0307515_10033350 Ga0307515_100333505 255
135 3300031548 Ga0307408_100000046 Ga0307408_10000004681 255
136 3300031730 Ga0307516_10000654 Ga0307516_100006544 255
137 3300031838 Ga0307518_10130034 Ga0307518_101300341 255
138 3300032004 Ga0307414_10155180 Ga0307414_101551803 255
139 3300035114 Ga0373939_0000004 Ga0373939_0000004_52747_53526 255
140 3300035121 Ga0373960_0001434 Ga0373960_0001434_3468_4247 255
141 3300035691 Ga0373931_0001005 Ga0373931_0001005_5984_6763 255
142 3300037312 Ga0395899_0014136 Ga0395899_0014136_297_1067 255
143 3300037312 Ga0395899_0017993 Ga0395899_0017993_2426_3208 255
144 3300037312 Ga0395899_0022470 Ga0395899_0022470_721_1491 255
145 3300037312 Ga0395899_0104739 Ga0395899_0104739_635_1405 255
146 3300037312 Ga0395899_0124692 Ga0395899_0124692_623_1405 255
147 3300037312 Ga0395899_0135059 Ga0395899_0135059_751_1521 255
148 3300037312 Ga0395899_0142198 Ga0395899_0142198_304_1074 255
149 3300037312 Ga0395899_0274234 Ga0395899_0274234_33_803 255
150 3300037418 Ga0395900_0000149 Ga0395900_0000149_66574_67344 255
151 3300037418 Ga0395900_0001065 Ga0395900_0001065_879_1649 255
152 3300037418 Ga0395900_0002833 Ga0395900_0002833_341_1111 255
153 3300037418 Ga0395900_0052640 Ga0395900_0052640_356_1138 255
154 3300037418 Ga0395900_0076700 Ga0395900_0076700_2467_3237 255
155 3300037418 Ga0395900_0081405 Ga0395900_0081405_1723_2493 255
156 3300037418 Ga0395900_0259912 Ga0395900_0259912_137_907 255
157 3300037418 Ga0395900_0512506 Ga0395900_0512506_291_1061 255
158 3300037466 Ga0395898_0024440 Ga0395898_0024440_4447_5217 255
159 3300037466 Ga0395898_0364205 Ga0395898_0364205_501_1271 255
160 3300037466 Ga0395898_0401792 Ga0395898_0401792_75_845 255
161 3300037466 Ga0395898_0565814 Ga0395898_0565814_268_1050 255
162 3300037471 Ga0395905_0561051 Ga0395905_0561051_18_788 255
163 3300038443 Ga0395901_0000025 Ga0395901_0000025_77059_77829 255
164 3300038443 Ga0395901_0004022 Ga0395901_0004022_4981_5751 255
165 3300038443 Ga0395901_0107203 Ga0395901_0107203_610_1380 255
166 3300038443 Ga0395901_0329602 Ga0395901_0329602_263_1033 255
167 3300038443 Ga0395901_0470280 Ga0395901_0470280_426_1196 255
168 3300038443 Ga0395901_0486226 Ga0395901_0486226_166_936 255
169 3300038443 Ga0395901_0532276 Ga0395901_0532276_301_1071 255
170 3300042005 Ga0439448_0003255 Ga0439448_0003255_1823_2593 255
171 3300042007 Ga0439449_0071467 Ga0439449_0071467_417_1187 255
172 3300042008 Ga0439450_017345 Ga0439450_017345_437_1207 255
173 3300042012 Ga0439455_0032180 Ga0439455_0032180_35_805 255
174 3300042120 Ga0450917_000350 Ga0450917_000350_1470_2249 255
175 3300042126 Ga0450888_000965 Ga0450888_000965_1903_2682 255
176 3300042129 Ga0450891_000163 Ga0450891_000163_869_1648 255
177 3300042144 Ga0450889_004133 Ga0450889_004133_172_951 255
178 3300042145 Ga0450906_015551 Ga0450906_015551_197_967 255
179 3300042532 Ga0450893_0001105 Ga0450893_0001105_2929_3708 255
180 3300044658 Ga0466972_0032984 Ga0466972_0032984_1148_1918 255
181 3300044683 Ga0466965_0003675 Ga0466965_0003675_164_934 255
182 3300044683 Ga0466965_0021679 Ga0466965_0021679_1866_2636 255
183 3300044684 Ga0466966_0022230 Ga0466966_0022230_1958_2728 255
184 3300044684 Ga0466966_0036979 Ga0466966_0036979_1814_2584 255
185 3300044706 Ga0466964_0007404 Ga0466964_0007404_2154_2924 255
186 3300044706 Ga0466964_0025215 Ga0466964_0025215_1087_1857 255
187 3300044735 Ga0466968_0000616 Ga0466968_0000616_10050_10820 255
188 3300044735 Ga0466968_0102542 Ga0466968_0102542_216_986 255
189 3300044842 Ga0466957_0002534 Ga0466957_0002534_3854_4624 255
190 3300044842 Ga0466957_0046479 Ga0466957_0046479_594_1364 255
191 3300044842 Ga0466957_0075008 Ga0466957_0075008_388_1194 255
192 3300044842 Ga0466957_0248321 Ga0466957_0248321_279_1049 255
193 3300045049 Ga0466959_0042406 Ga0466959_0042406_982_1752 255
194 3300045049 Ga0466959_0122204 Ga0466959_0122204_564_1334 255
195 3300045051 Ga0451576_0011745 Ga0451576_0011745_1931_2761 255
196 3300045836 Ga0466958_0019518 Ga0466958_0019518_2640_3410 255
197 3300045836 Ga0466958_0053078 Ga0466958_0053078_600_1370 255
198 3300045976 Ga0466967_0019271 Ga0466967_0019271_3657_4427 255
199 3300045976 Ga0466967_0054840 Ga0466967_0054840_1605_2375 255
200 3300045976 Ga0466967_0295503 Ga0466967_0295503_345_1115 255
201 3300046452 Ga0495617_000045 Ga0495617_000045_73142_73912 255
202 3300046455 Ga0495603_0038768 Ga0495603_0038768_216_986 255
203 3300046457 Ga0495590_0000518 Ga0495590_0000518_16841_17611 255
204 3300046457 Ga0495590_0020004 Ga0495590_0020004_571_1341 255
205 3300046457 Ga0495590_0025211 Ga0495590_0025211_864_1634 255
206 3300046459 Ga0495629_0099556 Ga0495629_0099556_731_1501 255
207 3300046459 Ga0495629_0271271 Ga0495629_0271271_340_1110 255
208 3300046460 Ga0495638_0031427 Ga0495638_0031427_464_1234 255
209 3300046463 Ga0495653_0039133 Ga0495653_0039133_2805_3575 255
210 3300046463 Ga0495653_0043919 Ga0495653_0043919_1852_2622 255
211 3300046463 Ga0495653_0044012 Ga0495653_0044012_2034_2804 255
212 3300046472 Ga0495580_0049204 Ga0495580_0049204_651_1421 255
213 3300046473 Ga0495582_0002499 Ga0495582_0002499_7015_7785 255
214 3300046473 Ga0495582_0103200 Ga0495582_0103200_110_880 255
215 3300046474 Ga0495605_0000179 Ga0495605_0000179_49266_50036 255
216 3300046474 Ga0495605_0004958 Ga0495605_0004958_868_1638 255
217 3300046474 Ga0495605_0005231 Ga0495605_0005231_6632_7402 255
218 3300046474 Ga0495605_0019124 Ga0495605_0019124_87_857 255
219 3300046474 Ga0495605_0055936 Ga0495605_0055936_728_1498 255
220 3300046491 Ga0495584_0002614 Ga0495584_0002614_2736_3506 255
221 3300046491 Ga0495584_0003448 Ga0495584_0003448_6861_7631 255
222 3300046491 Ga0495584_0009505 Ga0495584_0009505_3867_4637 255
223 3300046491 Ga0495584_0020434 Ga0495584_0020434_2176_2946 255
224 3300046491 Ga0495584_0022962 Ga0495584_0022962_1014_1784 255
225 3300046491 Ga0495584_0040613 Ga0495584_0040613_424_1194 255
226 3300046491 Ga0495584_0074249 Ga0495584_0074249_908_1675 255
227 3300046492 Ga0495585_0000003 Ga0495585_0000003_187946_188716 255
228 3300046492 Ga0495585_0000261 Ga0495585_0000261_51665_52435 255
229 3300046492 Ga0495585_0104496 Ga0495585_0104496_387_1157 255
230 3300046499 Ga0495594_0063669 Ga0495594_0063669_154_924 255
231 3300046499 Ga0495594_0167499 Ga0495594_0167499_81_851 255
232 3300046499 Ga0495594_0220082 Ga0495594_0220082_62_829 255
233 3300046500 Ga0495596_0000926 Ga0495596_0000926_15501_16271 255
234 3300046500 Ga0495596_0001911 Ga0495596_0001911_3213_3983 255
235 3300046500 Ga0495596_0016356 Ga0495596_0016356_1022_1792 255
236 3300046500 Ga0495596_0017532 Ga0495596_0017532_1758_2528 255
237 3300046500 Ga0495596_0019043 Ga0495596_0019043_1292_2062 255
238 3300046500 Ga0495596_0019741 Ga0495596_0019741_1181_1951 255
239 3300046500 Ga0495596_0027688 Ga0495596_0027688_288_1058 255
240 3300046501 Ga0495607_0001942 Ga0495607_0001942_7061_7831 255
241 3300046501 Ga0495607_0004965 Ga0495607_0004965_3697_4467 255
242 3300046501 Ga0495607_0005121 Ga0495607_0005121_3697_4467 255
243 3300046501 Ga0495607_0007294 Ga0495607_0007294_5131_5901 255
244 3300046501 Ga0495607_0046794 Ga0495607_0046794_944_1714 255
245 3300046501 Ga0495607_0108391 Ga0495607_0108391_418_1188 255
246 3300046501 Ga0495607_0256475 Ga0495607_0256475_45_815 255
247 3300046506 Ga0495583_0000378 Ga0495583_0000378_60911_61681 255
248 3300046506 Ga0495583_0000408 Ga0495583_0000408_15263_16033 255
249 3300046506 Ga0495583_0031410 Ga0495583_0031410_83_853 255
250 3300046506 Ga0495583_0075889 Ga0495583_0075889_113_883 255
251 3300046506 Ga0495583_0078525 Ga0495583_0078525_464_1234 255
252 3300046506 Ga0495583_0085210 Ga0495583_0085210_249_1019 255
253 3300046507 Ga0495606_0000087 Ga0495606_0000087_121428_122198 255
254 3300046507 Ga0495606_0002093 Ga0495606_0002093_22566_23336 255
255 3300046507 Ga0495606_0015390 Ga0495606_0015390_3077_3847 255
256 3300046507 Ga0495606_0037462 Ga0495606_0037462_653_1423 255
257 3300046507 Ga0495606_0092817 Ga0495606_0092817_402_1172 255
258 3300046507 Ga0495606_0168702 Ga0495606_0168702_308_1078 255
259 3300046507 Ga0495606_0224493 Ga0495606_0224493_26_796 255
260 3300046512 Ga0495610_0053011 Ga0495610_0053011_518_1288 255
261 3300046513 Ga0495616_0000426 Ga0495616_0000426_16406_17176 255
262 3300046513 Ga0495616_0001149 Ga0495616_0001149_17311_18081 255
263 3300046513 Ga0495616_0002192 Ga0495616_0002192_3111_3881 255
264 3300046513 Ga0495616_0010780 Ga0495616_0010780_2788_3558 255
265 3300046513 Ga0495616_0075963 Ga0495616_0075963_128_898 255
266 3300046517 Ga0495630_0032338 Ga0495630_0032338_2914_3885 255
267 3300046517 Ga0495630_0383073 Ga0495630_0383073_64_834 255
268 3300046518 Ga0495631_0000527 Ga0495631_0000527_7166_7936 255
269 3300046518 Ga0495631_0001364 Ga0495631_0001364_10144_10914 255
270 3300046518 Ga0495631_0047929 Ga0495631_0047929_942_1712 255
271 3300046518 Ga0495631_0199127 Ga0495631_0199127_73_843 255
272 3300046519 Ga0495632_0000044 Ga0495632_0000044_100553_101323 255
273 3300046519 Ga0495632_0002563 Ga0495632_0002563_2727_3509 255
274 3300046519 Ga0495632_0013405 Ga0495632_0013405_2615_3385 255
275 3300046519 Ga0495632_0123288 Ga0495632_0123288_301_1071 255
276 3300046520 Ga0495637_0034487 Ga0495637_0034487_493_1263 255
277 3300046522 Ga0495643_0000391 Ga0495643_0000391_50350_51120 255
278 3300046522 Ga0495643_0000869 Ga0495643_0000869_27741_28511 255
279 3300046522 Ga0495643_0005390 Ga0495643_0005390_7339_8109 255
280 3300046522 Ga0495643_0017889 Ga0495643_0017889_187_957 255
281 3300046522 Ga0495643_0039083 Ga0495643_0039083_1495_2265 255
282 3300046523 Ga0495644_0166751 Ga0495644_0166751_13_783 255
283 3300046524 Ga0495648_0000011 Ga0495648_0000011_113037_113807 255
284 3300046524 Ga0495648_0007725 Ga0495648_0007725_7465_8235 255
285 3300046524 Ga0495648_0014229 Ga0495648_0014229_2348_3118 255
286 3300046524 Ga0495648_0059285 Ga0495648_0059285_986_1756 255
287 3300046526 Ga0495666_0000729 Ga0495666_0000729_14033_14803 255
288 3300046526 Ga0495666_0001684 Ga0495666_0001684_630_1400 255
289 3300046526 Ga0495666_0056261 Ga0495666_0056261_796_1566 255
290 3300046528 Ga0495642_0003750 Ga0495642_0003750_3353_4123 255
291 3300046528 Ga0495642_0003892 Ga0495642_0003892_567_1337 255
292 3300046528 Ga0495642_0026327 Ga0495642_0026327_394_1164 255
293 3300046528 Ga0495642_0070233 Ga0495642_0070233_186_956 255
294 3300046528 Ga0495642_0076924 Ga0495642_0076924_222_992 255
295 3300046529 Ga0495652_0004643 Ga0495652_0004643_10253_11023 255
296 3300046530 Ga0495654_0002852 Ga0495654_0002852_9471_10241 255
297 3300046530 Ga0495654_0048377 Ga0495654_0048377_1254_2024 255
298 3300046531 Ga0495665_0020963 Ga0495665_0020963_226_996 255
299 3300046531 Ga0495665_0045196 Ga0495665_0045196_870_1640 255
300 3300046531 Ga0495665_0071981 Ga0495665_0071981_819_1589 255
301 3300046535 Ga0495586_0019356 Ga0495586_0019356_1886_2656 255
302 3300046538 Ga0495609_0000001 Ga0495609_0000001_450361_451131 255
303 3300046538 Ga0495609_0009697 Ga0495609_0009697_583_1353 255
304 3300046538 Ga0495609_0019931 Ga0495609_0019931_1170_1940 255
305 3300046538 Ga0495609_0028507 Ga0495609_0028507_240_1010 255
306 3300046538 Ga0495609_0078386 Ga0495609_0078386_480_1250 255
307 3300046542 Ga0495597_0000009 Ga0495597_0000009_82855_83625 255
308 3300046542 Ga0495597_0002021 Ga0495597_0002021_6296_7066 255
309 3300046542 Ga0495597_0002561 Ga0495597_0002561_5436_6206 255
310 3300046542 Ga0495597_0003715 Ga0495597_0003715_6401_7171 255
311 3300046542 Ga0495597_0031740 Ga0495597_0031740_500_1270 255
312 3300046557 Ga0495622_0002816 Ga0495622_0002816_2004_2774 255
313 3300046557 Ga0495622_0006438 Ga0495622_0006438_3164_3931 255
314 3300046558 Ga0495633_0007914 Ga0495633_0007914_3968_4738 255
315 3300046558 Ga0495633_0042837 Ga0495633_0042837_787_1557 255
316 3300046558 Ga0495633_0052857 Ga0495633_0052857_1056_1826 255
317 3300046616 Ga0495668_0001888 Ga0495668_0001888_1013_1783 255
318 3300046616 Ga0495668_0015582 Ga0495668_0015582_1949_2719 255
319 3300046642 Ga0495634_0028008 Ga0495634_0028008_2706_3476 255
320 3300046660 Ga0495625_0010656 Ga0495625_0010656_4504_5274 255
321 3300046660 Ga0495625_0048662 Ga0495625_0048662_2187_2954 255
322 3300046660 Ga0495625_0067826 Ga0495625_0067826_1357_2127 255
323 3300046663 Ga0495635_0004664 Ga0495635_0004664_5115_5885 255
324 3300046665 Ga0495661_0000206 Ga0495661_0000206_43480_44250 255
325 3300046665 Ga0495661_0003474 Ga0495661_0003474_5851_6621 255
326 3300046665 Ga0495661_0005577 Ga0495661_0005577_241_1023 255
327 3300046665 Ga0495661_0011423 Ga0495661_0011423_3992_4762 255
328 3300046665 Ga0495661_0060698 Ga0495661_0060698_241_1011 255
329 3300046665 Ga0495661_0088739 Ga0495661_0088739_741_1529 255
330 3300046674 Ga0495588_0000041 Ga0495588_0000041_233416_234186 255
331 3300046674 Ga0495588_0013280 Ga0495588_0013280_272_1042 255
332 3300046674 Ga0495588_0030436 Ga0495588_0030436_1692_2462 255
333 3300046679 Ga0495623_0010880 Ga0495623_0010880_1348_2118 255
334 3300046684 Ga0495669_0000343 Ga0495669_0000343_17267_18037 255
335 3300046690 Ga0495624_0046628 Ga0495624_0046628_1137_1907 255
336 3300046691 Ga0495670_0000681 Ga0495670_0000681_6499_7269 255
337 3300046691 Ga0495670_0030348 Ga0495670_0030348_1871_2641 255
338 3300046691 Ga0495670_0062311 Ga0495670_0062311_558_1328 255
339 3300046692 Ga0495671_0042948 Ga0495671_0042948_811_1581 255
340 3300046692 Ga0495671_0192392 Ga0495671_0192392_48_818 255
341 3300046694 Ga0495649_0001622 Ga0495649_0001622_12871_13641 255
342 3300046694 Ga0495649_0063334 Ga0495649_0063334_326_1096 255
343 3300046694 Ga0495649_0104429 Ga0495649_0104429_276_1046 255
344 3300046794 Ga0495589_0000152 Ga0495589_0000152_30374_31144 255
345 3300046794 Ga0495589_0000349 Ga0495589_0000349_30148_30918 255
346 3300046794 Ga0495589_0000581 Ga0495589_0000581_19339_20109 255
347 3300046794 Ga0495589_0007293 Ga0495589_0007293_1089_1859 255
348 3300046794 Ga0495589_0040458 Ga0495589_0040458_1349_2119 255
349 3300046810 Ga0495660_0000293 Ga0495660_0000293_44435_45205 255
350 3300046810 Ga0495660_0002047 Ga0495660_0002047_5418_6188 255
351 3300046810 Ga0495660_0037094 Ga0495660_0037094_1866_2636 255
352 3300046810 Ga0495660_0046958 Ga0495660_0046958_676_1446 255
353 3300047315 Ga0495581_0158817 Ga0495581_0158817_444_1214 255
354 3300047317 Ga0495604_0038842 Ga0495604_0038842_884_1654 255
355 3300047317 Ga0495604_0108172 Ga0495604_0108172_205_975 255
356 3300047319 Ga0495674_0004801 Ga0495674_0004801_9151_9921 255
357 3300047320 Ga0495672_0000290 Ga0495672_0000290_47960_48730 255
358 3300047320 Ga0495672_0004741 Ga0495672_0004741_2356_3126 255
359 3300047320 Ga0495672_0012894 Ga0495672_0012894_248_1018 255
360 3300047320 Ga0495672_0076688 Ga0495672_0076688_932_1702 255
361 3300047320 Ga0495672_0185657 Ga0495672_0185657_222_992 255
362 3300047320 Ga0495672_0186318 Ga0495672_0186318_75_845 255
363 3300047321 Ga0495676_0001530 Ga0495676_0001530_590_1360 255
364 3300047321 Ga0495676_0221689 Ga0495676_0221689_50_820 255
365 3300047322 Ga0495680_0010219 Ga0495680_0010219_5958_6728 255
366 3300047323 Ga0495683_0000001 Ga0495683_0000001_1876831_1877673 255
367 3300047323 Ga0495683_0000378 Ga0495683_0000378_5749_6519 255
368 3300047323 Ga0495683_0001646 Ga0495683_0001646_43_813 255
369 3300047323 Ga0495683_0032369 Ga0495683_0032369_1307_2077 255
370 3300047323 Ga0495683_0096475 Ga0495683_0096475_613_1383 255
371 3300047443 Ga0495687_000023 Ga0495687_000023_46942_47712 255
372 3300047443 Ga0495687_000027 Ga0495687_000027_108633_109403 255
373 3300047443 Ga0495687_000048 Ga0495687_000048_51883_52653 255
374 3300047443 Ga0495687_001038 Ga0495687_001038_21835_22605 255
375 3300047443 Ga0495687_080099 Ga0495687_080099_27_797 255
376 3300047444 Ga0495675_0023999 Ga0495675_0023999_3031_3801 255
377 3300047444 Ga0495675_0031233 Ga0495675_0031233_2429_3199 255
378 3300047444 Ga0495675_0054849 Ga0495675_0054849_1603_2373 255
379 3300047444 Ga0495675_0121288 Ga0495675_0121288_246_1016 255
380 3300047445 Ga0495677_0000001 Ga0495677_0000001_108714_109484 255
381 3300047445 Ga0495677_0002954 Ga0495677_0002954_5438_6208 255
382 3300047445 Ga0495677_0005300 Ga0495677_0005300_1942_2712 255
383 3300047446 Ga0495679_006948 Ga0495679_006948_3728_4498 255
384 3300047447 Ga0495685_030036 Ga0495685_030036_138_908 255
385 3300047470 Ga0495681_0003837 Ga0495681_0003837_6495_7265 255
386 3300047470 Ga0495681_0048061 Ga0495681_0048061_746_1516 255
387 3300047470 Ga0495681_0135567 Ga0495681_0135567_209_979 255
388 3300047472 Ga0495686_0000222 Ga0495686_0000222_49812_50582 255
389 3300047673 Ga0495593_0041985 Ga0495593_0041985_713_1483 255
390 3300048088 Ga0495602_0126959 Ga0495602_0126959_564_1334 255
391 3300048089 Ga0495614_0001966 Ga0495614_0001966_5204_5974 255
392 3300048089 Ga0495614_0002201 Ga0495614_0002201_6956_7726 255
393 3300048091 Ga0495626_0000015 Ga0495626_0000015_42245_43015 255
394 3300048091 Ga0495626_0000037 Ga0495626_0000037_128538_129308 255
395 3300048091 Ga0495626_0001295 Ga0495626_0001295_2902_3672 255
396 3300048091 Ga0495626_0005901 Ga0495626_0005901_2130_2900 255
397 3300048091 Ga0495626_0009781 Ga0495626_0009781_2961_3731 255
398 3300048091 Ga0495626_0024616 Ga0495626_0024616_1825_2595 255
399 3300048091 Ga0495626_0026199 Ga0495626_0026199_1670_2440 255
400 3300048091 Ga0495626_0038690 Ga0495626_0038690_1060_1830 255
401 3300048091 Ga0495626_0055865 Ga0495626_0055865_651_1421 255
402 3300048091 Ga0495626_0064819 Ga0495626_0064819_319_1089 255
403 3300048903 Ga0496100_0096659 Ga0496100_0096659_108_878 255
404 3300048904 Ga0496101_0214063 Ga0496101_0214063_248_1018 255
405 3300048907 Ga0496104_0330560 Ga0496104_0330560_139_909 255
406 3300048909 Ga0496106_0253787 Ga0496106_0253787_172_942 255
407 3300048910 Ga0496107_0182145 Ga0496107_0182145_470_1240 255
408 3300048913 Ga0496110_0000042 Ga0496110_0000042_17301_18071 255
409 3300048916 Ga0496113_0002475 Ga0496113_0002475_1432_2202 255
410 3300048918 Ga0496115_0148000 Ga0496115_0148000_74_844 255
411 3300048918 Ga0496115_0422399 Ga0496115_0422399_175_945 255
412 3300048925 Ga0496122_0002346 Ga0496122_0002346_5208_5978 255
413 3300048925 Ga0496122_0022639 Ga0496122_0022639_4370_5140 255
414 3300048926 Ga0496123_0016046 Ga0496123_0016046_4310_5080 255
415 3300048927 Ga0496124_0021653 Ga0496124_0021653_3596_4366 255
416 3300048927 Ga0496124_0021906 Ga0496124_0021906_1402_2175 255
417 3300048927 Ga0496124_0042259 Ga0496124_0042259_563_1333 255
418 3300048927 Ga0496124_0082827 Ga0496124_0082827_948_1718 255
419 3300048927 Ga0496124_0098856 Ga0496124_0098856_1065_1835 255
420 3300048927 Ga0496124_0270380 Ga0496124_0270380_465_1235 255
421 3300048928 Ga0496125_0163003 Ga0496125_0163003_639_1409 255
422 3300049459 Ga0495678_000100 Ga0495678_000100_943_1713 255
423 3300049459 Ga0495678_000574 Ga0495678_000574_1010_1780 255
424 3300049459 Ga0495678_009138 Ga0495678_009138_3580_4350 255
425 3300049460 Ga0495682_0000809 Ga0495682_0000809_5337_6107 255
426 3300049521 Ga0501298_033184 Ga0501298_033184_96_875 255
427 3300049571 Ga0501034_0168021 Ga0501034_0168021_1238_2008 255
428 3300049651 Ga0501201_004634 Ga0501201_004634_443_1222 255
429 3300049658 Ga0501211_000129 Ga0501211_000129_4060_4839 255
430 3300049661 Ga0501217_003788 Ga0501217_003788_1904_2683 255
431 3300049663 Ga0501223_005346 Ga0501223_005346_567_1346 255
432 3300049679 Ga0501249_022059 Ga0501249_022059_204_983 255
433 3300049704 Ga0501221_001033 Ga0501221_001033_315_1094 255
434 3300049705 Ga0501225_0047958 Ga0501225_0047958_91_870 255
435 3300049706 Ga0501229_000324 Ga0501229_000324_832_1611 255
436 3300049706 Ga0501229_002498 Ga0501229_002498_1321_2100 255
437 3300049759 Ga0501262_003528 Ga0501262_003528_972_1751 255
438 3300049764 Ga0501267_003694 Ga0501267_003694_358_1137 255
439 3300049766 Ga0501269_003067 Ga0501269_003067_812_1591 255
440 3300049769 Ga0501272_000651 Ga0501272_000651_217_996 255
441 3300049822 Ga0501035_0008697 Ga0501035_0008697_8618_9388 255
442 3300049823 Ga0501044_0114121 Ga0501044_0114121_1782_2552 255
443 3300050496 nmdc:mga07m45_249513_c1 nmdc:mga07m45_249513_c1_148_927 255
444 3300050496 nmdc:mga07m45_78400_c1 nmdc:mga07m45_78400_c1_1028_1807 255
445 iso_pu_bacteria 2808606418 2809143035 255
446 3300002067 JGI24735J21928_10000244 JGI24735J21928_100002442 256
447 3300003316 rootH1_10052597 rootH1_100525978 256
448 3300003320 rootH2_10121114 rootH2_101211143 256
449 3300003322 rootL2_10000757 rootL2_1000075760 256
450 3300003323 rootH1_10023957 rootH1_100239574 256
451 3300003759 Ga0055525_1000013 Ga0055525_100001386 256
452 3300003763 Ga0055529_1001265 Ga0055529_10012652 256
453 3300003763 Ga0055529_1002174 Ga0055529_10021742 256
454 3300003771 Ga0055526_1003989 Ga0055526_10039892 256
455 3300003775 Ga0055524_1003854 Ga0055524_10038545 256
456 3300003775 Ga0055524_1008526 Ga0055524_10085264 256
457 3300003794 Ga0055531_10001392 Ga0055531_100013924 256
458 3300003794 Ga0055531_10007438 Ga0055531_100074382 256
459 3300003794 Ga0055531_10011279 Ga0055531_100112793 256
460 3300004625 Ga0055543_1002526 Ga0055543_10025264 256
461 3300005262 Ga0065165_1000024 Ga0065165_1000024230 256
462 3300005262 Ga0065165_1000076 Ga0065165_100007619 256
463 3300005337 Ga0070682_100321969 Ga0070682_1003219692 256
464 3300005457 Ga0070662_100004066 Ga0070662_1000040663 256
465 3300005616 Ga0068852_100239274 Ga0068852_1002392741 256
466 3300006195 Ga0075366_10013631 Ga0075366_100136312 256
467 3300006353 Ga0075370_10002214 Ga0075370_100022147 256
468 3300006944 Ga0099823_1009406 Ga0099823_10094065 256
469 3300009093 Ga0105240_10126548 Ga0105240_101265482 256
470 3300009093 Ga0105240_10234303 Ga0105240_102343032 256
471 3300009147 Ga0114129_10022114 Ga0114129_100221148 256
472 3300009176 Ga0105242_10001240 Ga0105242_100012403 256
473 3300011119 Ga0105246_10247793 Ga0105246_102477931 256
474 3300013306 Ga0163162_10023799 Ga0163162_100237996 256
475 3300021361 Ga0213872_10000535 Ga0213872_100005357 256
476 3300025230 Ga0209563_100025 Ga0209563_100025500 256
477 3300025242 Ga0209258_102490 Ga0209258_1024903 256
478 3300025273 Ga0209673_1006916 Ga0209673_10069165 256
479 3300025273 Ga0209673_1012377 Ga0209673_10123774 256
480 3300025273 Ga0209673_1013773 Ga0209673_10137734 256
481 3300025295 Ga0209564_1000005 Ga0209564_1000005810 256
482 3300025298 Ga0209050_1006371 Ga0209050_10063716 256
483 3300025298 Ga0209050_1011664 Ga0209050_10116645 256
484 3300025299 Ga0209256_1000474 Ga0209256_10004744 256
485 3300025299 Ga0209256_1001296 Ga0209256_10012964 256
486 3300025303 Ga0209051_1001144 Ga0209051_10011441 256
487 3300025304 Ga0209257_1000032 Ga0209257_1000032371 256
488 3300025304 Ga0209257_1002554 Ga0209257_100255414 256
489 3300025304 Ga0209257_1002706 Ga0209257_100270613 256
490 3300025933 Ga0207706_10005589 Ga0207706_100055892 256
491 3300025934 Ga0207686_10002565 Ga0207686_1000256510 256
492 3300026078 Ga0207702_10109988 Ga0207702_101099883 256
493 3300027876 Ga0209974_10068336 Ga0209974_100683362 256
494 3300027876 Ga0209974_10107284 Ga0209974_101072841 256
495 3300031239 Ga0265328_10015400 Ga0265328_100154002 256
496 3300031251 Ga0265327_10000184 Ga0265327_10000184122 256
497 3300031344 Ga0265316_10000115 Ga0265316_1000011579 256
498 3300031548 Ga0307408_100001631 Ga0307408_1000016312 256
499 3300031730 Ga0307516_10004643 Ga0307516_1000464310 256
500 3300031730 Ga0307516_10050099 Ga0307516_100500993 256
501 3300031901 Ga0307406_10014564 Ga0307406_100145642 256
502 3300037312 Ga0395899_0003383 Ga0395899_0003383_6141_6917 256
503 3300037418 Ga0395900_0000722 Ga0395900_0000722_29539_30315 256
504 3300037466 Ga0395898_0007471 Ga0395898_0007471_3265_4041 256
505 3300037471 Ga0395905_0016039 Ga0395905_0016039_5092_5877 256
506 3300037471 Ga0395905_0696008 Ga0395905_0696008_95_880 256
507 3300037471 Ga0395905_0732475 Ga0395905_0732475_38_823 256
508 3300039438 Ga0436360_0354560 Ga0436360_0354560_494_1297 256
509 3300039447 Ga0436361_0146317 Ga0436361_0146317_49841_50623 256
510 3300042125 Ga0450923_023980 Ga0450923_023980_312_1097 256
511 3300042127 Ga0450890_006533 Ga0450890_006533_75_860 256
512 3300042138 Ga0450903_002120 Ga0450903_002120_1759_2541 256
513 3300042435 Ga0439434_0029072 Ga0439434_0029072_502_1278 256
514 3300042438 Ga0439459_0000757 Ga0439459_0000757_201_986 256
515 3300042439 Ga0439464_0004308 Ga0439464_0004308_51_833 256
516 3300042532 Ga0450893_0018804 Ga0450893_0018804_315_1091 256
517 3300042876 Ga0451577_0004032 Ga0451577_0004032_5860_6645 256
518 3300042876 Ga0451577_0444005 Ga0451577_0444005_15_797 256
519 3300044656 Ga0466969_0000005 Ga0466969_0000005_43354_44169 256
520 3300044656 Ga0466969_0026577 Ga0466969_0026577_1122_1907 256
521 3300044683 Ga0466965_0071552 Ga0466965_0071552_531_1346 256
522 3300044684 Ga0466966_0011522 Ga0466966_0011522_1173_1988 256
523 3300044684 Ga0466966_0062475 Ga0466966_0062475_1321_2127 256
524 3300044684 Ga0466966_0093572 Ga0466966_0093572_982_1767 256
525 3300044693 Ga0466961_0009600 Ga0466961_0009600_1707_2513 256
526 3300044693 Ga0466961_0070815 Ga0466961_0070815_620_1435 256
527 3300044694 Ga0466963_0053174 Ga0466963_0053174_929_1714 256
528 3300044694 Ga0466963_0076285 Ga0466963_0076285_60_845 256
529 3300045049 Ga0466959_0001619 Ga0466959_0001619_5760_6575 256
530 3300045049 Ga0466959_0009776 Ga0466959_0009776_5901_6683 256
531 3300045049 Ga0466959_0018064 Ga0466959_0018064_2033_2818 256
532 3300045049 Ga0466959_0218811 Ga0466959_0218811_307_1113 256
533 3300045836 Ga0466958_0069835 Ga0466958_0069835_1228_2013 256
534 3300045976 Ga0466967_0002962 Ga0466967_0002962_7465_8250 256
535 3300046457 Ga0495590_0006887 Ga0495590_0006887_1414_2199 256
536 3300046477 Ga0495664_0112879 Ga0495664_0112879_549_1328 256
537 3300046500 Ga0495596_0074212 Ga0495596_0074212_250_1029 256
538 3300046542 Ga0495597_0000110 Ga0495597_0000110_22931_23749 256
539 3300046665 Ga0495661_0000322 Ga0495661_0000322_34740_35588 256
540 3300046684 Ga0495669_0084114 Ga0495669_0084114_381_1160 256
541 3300046694 Ga0495649_0036940 Ga0495649_0036940_14_793 256
542 3300047317 Ga0495604_0097511 Ga0495604_0097511_1135_1914 256
543 3300047320 Ga0495672_0002954 Ga0495672_0002954_11721_12500 256
544 3300047443 Ga0495687_001030 Ga0495687_001030_21453_22232 256
545 3300047469 Ga0495673_0109506 Ga0495673_0109506_39_818 256
546 3300048913 Ga0496110_0113963 Ga0496110_0113963_1325_2134 256
547 3300048916 Ga0496113_0298006 Ga0496113_0298006_341_1126 256
548 3300048924 Ga0496121_0221004 Ga0496121_0221004_473_1261 256
549 3300048927 Ga0496124_0024529 Ga0496124_0024529_1110_1895 256
550 3300049822 Ga0501035_0023790 Ga0501035_0023790_2448_3218 256
551 3300049822 Ga0501035_0090258 Ga0501035_0090258_727_1497 256
552 3300049823 Ga0501044_0001496 Ga0501044_0001496_22868_23638 256
553 3300050493 nmdc:mga0k408_46455_c1 nmdc:mga0k408_46455_c1_1057_1842 256
554 3300050496 nmdc:mga07m45_15465_c1 nmdc:mga07m45_15465_c1_1557_2342 256
555 3300050507 nmdc:mga05p37_161633_c1 nmdc:mga05p37_161633_c1_673_1461 256
556 3300053117 Ga0500593_000152 Ga0500593_000152_9036_9818 256
557 3300053156 Ga0500622_0003419 Ga0500622_0003419_4281_5069 256
558 3300053157 Ga0500624_010983 Ga0500624_010983_481_1257 256
559 3300053161 Ga0500634_0033061 Ga0500634_0033061_665_1441 256
560 iso_pu_bacteria 2974320154 2974322536 256
561 3300001915 JGI24741J21665_1000095 JGI24741J21665_10000954 257
562 3300001979 JGI24740J21852_10000583 JGI24740J21852_100005835 257
563 3300002067 JGI24735J21928_10001284 JGI24735J21928_100012847 257
564 3300002704 JGI25155J39150_1000322 JGI25155J39150_10003224 257
565 3300002704 JGI25155J39150_1000431 JGI25155J39150_10004312 257
566 3300002705 JGI25156J39149_1001211 JGI25156J39149_100121113 257
567 3300002705 JGI25156J39149_1004182 JGI25156J39149_10041824 257
568 3300002737 JGI25162J39368_1004645 JGI25162J39368_10046452 257
569 3300002738 JGI25154J39366_1001024 JGI25154J39366_100102413 257
570 3300002738 JGI25154J39366_1001313 JGI25154J39366_10013138 257
571 3300002741 JGI25157J39369_1000382 JGI25157J39369_100038213 257
572 3300003187 JGI25151J46595_10000189 JGI25151J46595_1000018919 257
573 3300003187 JGI25151J46595_10002320 JGI25151J46595_100023205 257
574 3300003187 JGI25151J46595_10002802 JGI25151J46595_100028027 257
575 3300003187 JGI25151J46595_10019711 JGI25151J46595_100197113 257
576 3300003187 JGI25151J46595_10034624 JGI25151J46595_100346242 257
577 3300003758 Ga0055532_1000050 Ga0055532_100005013 257
578 3300003760 Ga0055527_1005104 Ga0055527_10051042 257
579 3300003771 Ga0055526_1021716 Ga0055526_10217162 257
580 3300003771 Ga0055526_1033750 Ga0055526_10337502 257
581 3300003775 Ga0055524_1001275 Ga0055524_100127513 257
582 3300003775 Ga0055524_1023019 Ga0055524_10230191 257
583 3300003781 Ga0055536_1000130 Ga0055536_100013059 257
584 3300003784 Ga0055534_1001092 Ga0055534_10010929 257
585 3300005327 Ga0070658_10022666 Ga0070658_100226665 257
586 3300005578 Ga0068854_100001923 Ga0068854_1000019232 257
587 3300005614 Ga0068856_100062243 Ga0068856_1000622433 257
588 3300005616 Ga0068852_100512165 Ga0068852_1005121652 257
589 3300006051 Ga0075364_10394477 Ga0075364_103944771 257
590 3300006051 Ga0075364_10395658 Ga0075364_103956581 257
591 3300006948 Ga0099826_10000004 Ga0099826_10000004530 257
592 3300009011 Ga0105251_10020734 Ga0105251_100207343 257
593 3300009093 Ga0105240_10003428 Ga0105240_1000342813 257
594 3300009093 Ga0105240_10007958 Ga0105240_100079588 257
595 3300009551 Ga0105238_10044050 Ga0105238_100440503 257
596 3300014497 Ga0182008_10010663 Ga0182008_100106632 257
597 3300014497 Ga0182008_10163248 Ga0182008_101632481 257
598 3300021361 Ga0213872_10016234 Ga0213872_100162344 257
599 3300021361 Ga0213872_10019688 Ga0213872_100196881 257
600 3300025206 Ga0209435_100205 Ga0209435_10020514 257
601 3300025206 Ga0209435_100316 Ga0209435_1003162 257
602 3300025229 Ga0209147_100004 Ga0209147_100004554 257
603 3300025233 Ga0209437_100053 Ga0209437_10005316 257
604 3300025242 Ga0209258_100720 Ga0209258_10072013 257
605 3300025246 Ga0209646_1000073 Ga0209646_1000073198 257
606 3300025246 Ga0209646_1000109 Ga0209646_1000109101 257
607 3300025250 Ga0209026_1000467 Ga0209026_100046714 257
608 3300025250 Ga0209026_1002391 Ga0209026_10023917 257
609 3300025256 Ga0209759_1000064 Ga0209759_1000064161 257
610 3300025256 Ga0209759_1001647 Ga0209759_10016472 257
611 3300025263 Ga0209565_1000217 Ga0209565_100021749 257
612 3300025272 Ga0209455_1012050 Ga0209455_10120502 257
613 3300025291 Ga0209675_1000125 Ga0209675_100012596 257
614 3300025291 Ga0209675_1000242 Ga0209675_100024248 257
615 3300025291 Ga0209675_1006215 Ga0209675_10062154 257
616 3300025292 Ga0209676_1000014 Ga0209676_10000145 257
617 3300025294 Ga0209025_1000027 Ga0209025_100002788 257
618 3300025294 Ga0209025_1000379 Ga0209025_100037984 257
619 3300025294 Ga0209025_1000772 Ga0209025_100077247 257
620 3300025294 Ga0209025_1000811 Ga0209025_100081135 257
621 3300025294 Ga0209025_1002088 Ga0209025_10020886 257
622 3300025295 Ga0209564_1001161 Ga0209564_10011615 257
623 3300025295 Ga0209564_1003191 Ga0209564_10031915 257
624 3300025295 Ga0209564_1003312 Ga0209564_10033124 257
625 3300025299 Ga0209256_1000726 Ga0209256_100072634 257
626 3300025299 Ga0209256_1001803 Ga0209256_10018035 257
627 3300025735 Ga0207713_1023996 Ga0207713_10239963 257
628 3300025913 Ga0207695_10002265 Ga0207695_100022652 257
629 3300025913 Ga0207695_10030679 Ga0207695_100306793 257
630 3300025949 Ga0207667_10003481 Ga0207667_1000348113 257
631 3300025949 Ga0207667_10335682 Ga0207667_103356822 257
632 3300026078 Ga0207702_10478220 Ga0207702_104782202 257
633 3300026142 Ga0207698_10617684 Ga0207698_106176842 257
634 3300027666 Ga0209282_1000015 Ga0209282_100001536 257
635 3300028653 Ga0265323_10001835 Ga0265323_100018358 257
636 3300031238 Ga0265332_10000021 Ga0265332_1000002155 257
637 3300031507 Ga0307509_10000245 Ga0307509_100002458 257
638 3300037068 Ga0373925_0410082 Ga0373925_0410082_229_1002 257
639 3300037312 Ga0395899_0000038 Ga0395899_0000038_5536_6318 257
640 3300037471 Ga0395905_0001290 Ga0395905_0001290_16844_17626 257
641 3300038443 Ga0395901_0000002 Ga0395901_0000002_754806_755588 257
642 3300039447 Ga0436361_0346541 Ga0436361_0346541_1946_2725 257
643 3300039447 Ga0436361_0380881 Ga0436361_0380881_2620_3399 257
644 3300039447 Ga0436361_0567910 Ga0436361_0567910_9946_10719 257
645 3300039447 Ga0436361_0605002 Ga0436361_0605002_61_840 257
646 3300044656 Ga0466969_0004860 Ga0466969_0004860_2549_3331 257
647 3300044658 Ga0466972_0081766 Ga0466972_0081766_670_1452 257
648 3300044683 Ga0466965_0104854 Ga0466965_0104854_400_1182 257
649 3300044684 Ga0466966_0033794 Ga0466966_0033794_1057_1839 257
650 3300044693 Ga0466961_0123823 Ga0466961_0123823_395_1177 257
651 3300044706 Ga0466964_0001584 Ga0466964_0001584_1946_2728 257
652 3300044712 Ga0453684_0001611 Ga0453684_0001611_29677_30450 257
653 3300044712 Ga0453684_0069422 Ga0453684_0069422_86_919 257
654 3300044735 Ga0466968_0001715 Ga0466968_0001715_5157_5939 257
655 3300044765 Ga0466970_0013863 Ga0466970_0013863_2959_3741 257
656 3300044842 Ga0466957_0006819 Ga0466957_0006819_5028_5810 257
657 3300044842 Ga0466957_0298534 Ga0466957_0298534_175_957 257
658 3300044901 Ga0466960_0276598 Ga0466960_0276598_50_832 257
659 3300045049 Ga0466959_0057342 Ga0466959_0057342_1053_1835 257
660 3300045051 Ga0451576_0080854 Ga0451576_0080854_2302_3075 257
661 3300045836 Ga0466958_0003451 Ga0466958_0003451_5181_5963 257
662 3300046474 Ga0495605_0002373 Ga0495605_0002373_5219_6052 257
663 3300046500 Ga0495596_0000695 Ga0495596_0000695_14392_15225 257
664 3300046501 Ga0495607_0000109 Ga0495607_0000109_53498_54274 257
665 3300046501 Ga0495607_0016193 Ga0495607_0016193_2778_3611 257
666 3300046512 Ga0495610_0008122 Ga0495610_0008122_366_1199 257
667 3300046513 Ga0495616_0010482 Ga0495616_0010482_3004_3837 257
668 3300046524 Ga0495648_0080155 Ga0495648_0080155_547_1380 257
669 3300046528 Ga0495642_0007776 Ga0495642_0007776_105_881 257
670 3300046538 Ga0495609_0002658 Ga0495609_0002658_4497_5330 257
671 3300046660 Ga0495625_0003448 Ga0495625_0003448_5470_6246 257
672 3300046665 Ga0495661_0015675 Ga0495661_0015675_3509_4342 257
673 3300046692 Ga0495671_0016990 Ga0495671_0016990_2550_3383 257
674 3300047317 Ga0495604_0115594 Ga0495604_0115594_552_1358 257
675 3300047318 Ga0495636_0023449 Ga0495636_0023449_975_1886 257
676 3300047320 Ga0495672_0058453 Ga0495672_0058453_628_1461 257
677 3300048919 Ga0496116_0006577 Ga0496116_0006577_6312_7097 257
678 3300048919 Ga0496116_0006724 Ga0496116_0006724_6796_7638 257
679 3300048919 Ga0496116_0010436 Ga0496116_0010436_3674_4507 257
680 3300048921 Ga0496118_0108183 Ga0496118_0108183_329_1105 257
681 3300048924 Ga0496121_0007101 Ga0496121_0007101_2912_3688 257
682 3300048924 Ga0496121_0013777 Ga0496121_0013777_7435_8268 257
683 3300048925 Ga0496122_0001831 Ga0496122_0001831_22208_23050 257
684 3300048925 Ga0496122_0004234 Ga0496122_0004234_13382_14215 257
685 3300048926 Ga0496123_0002340 Ga0496123_0002340_9353_10195 257
686 3300048926 Ga0496123_0006360 Ga0496123_0006360_5565_6398 257
687 3300048928 Ga0496125_0002187 Ga0496125_0002187_9435_10211 257
688 3300048928 Ga0496125_0051403 Ga0496125_0051403_1663_2505 257
689 3300049571 Ga0501034_0000588 Ga0501034_0000588_7863_8648 257
690 3300050491 nmdc:mga00v17_309052_c1 nmdc:mga00v17_309052_c1_71_844 257
691 3300050491 nmdc:mga00v17_350829_c1 nmdc:mga00v17_350829_c1_152_934 257
692 3300053161 Ga0500634_0052929 Ga0500634_0052929_980_1753 257
693 3300061719 Ga0466962_0076615 Ga0466962_0076615_250_1032 257
694 3300061719 Ga0466962_0119341 Ga0466962_0119341_311_1093 257
695 iso_pu_bacteria 2513237150 2513952980 257
696 iso_pu_bacteria 644736347 644747406 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03883

H2O2_YaaD

Peroxide stress protein YaaA

37

283

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5caj-assembly2.cif.gz_B crystal structure of e. coli yaaa, a member of the duf328/upf0246 family 0.9865 1 256
5caj-assembly2.cif.gz_B crystal structure of e. coli yaaa, a member of the duf328/upf0246 family 0.9789 1 256
7t8l-assembly1.cif.gz_B brxr from acinetobacter brex type i phage restriction system 0.6323 28 64
7ewc-assembly2.cif.gz_C mycobacterium tuberculosis higa2 (form i) 0.6244 34 62
3c0b-assembly1.cif.gz_B-2 crystal structure of the conserved archaeal protein q6m145. northeast structural genomics consortium target mrr63 0.5702 141 223
ID Description Score Start End Superfamily
6ib8C01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.628 29 67 1.10.150.20
4ds5D04 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.6263 26 69 1.10.150.20
2bkeA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.6262 28 74 1.10.150.20
af_Q2FYY3_1_68_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.617 29 62 1.10.260.40
af_Q2FZB4_1_74_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.6088 29 62 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A836ZHI6-F1-model_v4 deleted 0.999 1 126
AF-A0A5D0XQF4-F1-model_v4 Peroxide stress protein YaaA 0.9966 21 147 GO:0005829
GO:0033194
AF-A0A2N2STB7-F1-model_v4 Peroxide stress protein YaaA 0.9965 1 112 GO:0005829
GO:0033194
AF-A3RVP3-F1-model_v4 deleted 0.9962 1 257
AF-A0A259RKQ5-F1-model_v4 Peroxide stress protein YaaA 0.9952 1 93 GO:0005829
GO:0033194

Feature Viewer

pLDDT pTM Quality
97.12 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map