F475775

General Info

Members Datasets Scaffolds Average Seq Length
695 316 1390 277

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100000035|Ga0070713_10000003541
Length 320
Sequence MLPGKTEQFIHVRICRAEVNPLQSPSFQNALATMPAAPSAESHHALTDTCHLDPHAAAIELTDVSFAYDRRPVLRGITMTVPRGKIVAIMGGSGCGKTTILRLIGGQLKPNAGAIMVAGQSVPELDADALYALRRRFGMLFQFGALFTDMSVFENIAFPMREHTELSEELIRDLVLMKLHAVGLRGAAQLMPAELSGGMARRVALARAIALDPMLVMYDEPFAGLDPISLGVVGQLIRKLNDALGTTSIVVTHDVYESLKIVDYLYFVSEGRIVAEGTPDQVRASADPFVRQFVDGASDGPVPFHYPASDYRTDLFADVH

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
266 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
316 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0.86
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 1.01
Rhizosphere 96.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100000035 3300005436 Bacteria 86284
2 Ga0007417J51691_1068983 3300003544 Bacteria 1301
3 Ga0007410J51695_1062819 3300003574 Bacteria 1870
4 Ga0007409J51694_1032781 3300003575 Bacteria 1526
5 Ga0007416J51690_1027314 3300003577 Bacteria 7926
6 Ga0032354_1038350 3300003693 Bacteria 7933
7 Ga0070658_10346096 3300005327 Bacteria 1272
8 Ga0070676_10047494 3300005328 Bacteria 2507
9 Ga0070676_10320516 3300005328 Bacteria 1057
10 Ga0070690_100000085 3300005330 Bacteria 45980
11 Ga0070690_100000412 3300005330 Bacteria 21682
12 Ga0070690_100036707 3300005330 Bacteria 3082
13 Ga0070690_100308523 3300005330 Bacteria 1137
14 Ga0070670_100005445 3300005331 Bacteria 10737
15 Ga0070670_100052993 3300005331 Bacteria 3484
16 Ga0070670_100106770 3300005331 Bacteria 2413
17 Ga0070677_10035025 3300005333 Bacteria 1943
18 Ga0068869_100000367 3300005334 Bacteria 24337
19 Ga0068869_100000446 3300005334 Bacteria 22625
20 Ga0068869_100411685 3300005334 Bacteria 1114
21 Ga0070666_10109535 3300005335 Bacteria 1909
22 Ga0070680_100000888 3300005336 Bacteria 21150
23 Ga0070680_100049905 3300005336 Bacteria 3413
24 Ga0070680_100060701 3300005336 Bacteria 3094
25 Ga0070682_100003483 3300005337 Bacteria 8705
26 Ga0070682_100040706 3300005337 Bacteria 2860
27 Ga0068868_100000639 3300005338 Bacteria 23608
28 Ga0070689_100000189 3300005340 Bacteria 37342
29 Ga0070689_100033046 3300005340 Bacteria 3939
30 Ga0070689_100060122 3300005340 Bacteria 2953
31 Ga0070689_100103869 3300005340 Bacteria 2252
32 Ga0070691_10006941 3300005341 Bacteria 5184
33 Ga0070687_100000020 3300005343 Bacteria 53469
34 Ga0070692_10018481 3300005345 Bacteria 3354
35 Ga0070692_10029579 3300005345 Bacteria 2731
36 Ga0070692_10029985 3300005345 Bacteria 2716
37 Ga0070668_100025855 3300005347 Bacteria 4452
38 Ga0070668_100034848 3300005347 Bacteria 3836
39 Ga0070668_100180170 3300005347 Bacteria 1725
40 Ga0070668_100389977 3300005347 Bacteria 1187
41 Ga0070668_100495575 3300005347 Bacteria 1057
42 Ga0070669_100023612 3300005353 Bacteria 4404
43 Ga0070669_100053088 3300005353 Bacteria 2966
44 Ga0070675_100014034 3300005354 Bacteria 6309
45 Ga0070675_100015218 3300005354 Bacteria 6076
46 Ga0070675_100031039 3300005354 Bacteria 4318
47 Ga0070675_100070106 3300005354 Bacteria 2905
48 Ga0070675_100126125 3300005354 Bacteria 2178
49 Ga0070671_100003540 3300005355 Bacteria 12200
50 Ga0070671_100070826 3300005355 Bacteria 2909
51 Ga0070671_100086131 3300005355 Bacteria 2628
52 Ga0070671_100347061 3300005355 Bacteria 1267
53 Ga0070673_100011712 3300005364 Bacteria 5996
54 Ga0070673_100059080 3300005364 Bacteria 3035
55 Ga0070673_100080098 3300005364 Bacteria 2645
56 Ga0070667_100023492 3300005367 Bacteria 5115
57 Ga0070667_100204735 3300005367 Bacteria 1752
58 Ga0070714_100284185 3300005435 Bacteria 1538
59 Ga0070701_10000095 3300005438 Bacteria 24800
60 Ga0070701_10000464 3300005438 Bacteria 13857
61 Ga0070701_10295468 3300005438 Bacteria 994
62 Ga0070705_100000022 3300005440 Bacteria 83218
63 Ga0070705_100015239 3300005440 Bacteria 3969
64 Ga0070705_100043194 3300005440 Bacteria 2582
65 Ga0070705_100198440 3300005440 Bacteria 1374
66 Ga0070700_100000343 3300005441 Bacteria 23981
67 Ga0070700_100001533 3300005441 Bacteria 11513
68 Ga0070700_100041400 3300005441 Bacteria 2824
69 Ga0070700_100055356 3300005441 Bacteria 2483
70 Ga0070694_100000049 3300005444 Bacteria 54670
71 Ga0070694_100017583 3300005444 Bacteria 4521
72 Ga0070694_100021333 3300005444 Bacteria 4138
73 Ga0070694_100049694 3300005444 Bacteria 2825
74 Ga0070708_100136171 3300005445 Bacteria 2275
75 Ga0070708_100160908 3300005445 Bacteria 2092
76 Ga0070678_100003913 3300005456 Bacteria 8374
77 Ga0070678_100147953 3300005456 Bacteria 1888
78 Ga0070681_10000081 3300005458 Bacteria 71809
79 Ga0070681_10155008 3300005458 Bacteria 2216
80 Ga0068867_100000224 3300005459 Bacteria 37294
81 Ga0068867_100001285 3300005459 Bacteria 17292
82 Ga0068867_100071419 3300005459 Bacteria 2597
83 Ga0068867_100117863 3300005459 Bacteria 2047
84 Ga0068867_100205459 3300005459 Bacteria 1579
85 Ga0068867_100219304 3300005459 Bacteria 1532
86 Ga0070706_100023284 3300005467 Bacteria 5706
87 Ga0070706_100032816 3300005467 Bacteria 4790
88 Ga0070706_100101419 3300005467 Bacteria 2675
89 Ga0070707_100250044 3300005468 Bacteria 1725
90 Ga0070698_100009607 3300005471 Bacteria 10348
91 Ga0070699_100177988 3300005518 Bacteria 1886
92 Ga0070699_100196533 3300005518 Bacteria 1793
93 Ga0070699_100209041 3300005518 Bacteria 1737
94 Ga0070679_100168020 3300005530 Bacteria 2166
95 Ga0070679_100647545 3300005530 Bacteria 999
96 Ga0070684_100056754 3300005535 Bacteria 3418
97 Ga0070684_100122175 3300005535 Bacteria 2343
98 Ga0070697_100019753 3300005536 Bacteria 5323
99 Ga0070697_100058068 3300005536 Bacteria 3148
100 Ga0070697_100150760 3300005536 Bacteria 1959
101 Ga0068853_100132882 3300005539 Bacteria 2229
102 Ga0068853_100134724 3300005539 Bacteria 2213
103 Ga0070672_100003720 3300005543 Bacteria 9924
104 Ga0070672_100039257 3300005543 Bacteria 3625
105 Ga0070672_100043824 3300005543 Bacteria 3453
106 Ga0070672_100104360 3300005543 Bacteria 2303
107 Ga0070672_100419318 3300005543 Bacteria 1149
108 Ga0070686_100000448 3300005544 Bacteria 25484
109 Ga0070686_100002753 3300005544 Bacteria 9679
110 Ga0070686_100009566 3300005544 Bacteria 5449
111 Ga0070695_100000030 3300005545 Bacteria 53190
112 Ga0070695_100000641 3300005545 Bacteria 18567
113 Ga0070695_100003128 3300005545 Bacteria 9642
114 Ga0070695_100214386 3300005545 Bacteria 1384
115 Ga0070696_100000688 3300005546 Bacteria 21623
116 Ga0070696_100012162 3300005546 Bacteria 5767
117 Ga0070696_100024371 3300005546 Bacteria 4112
118 Ga0070696_100042292 3300005546 Bacteria 3151
119 Ga0070693_100000472 3300005547 Bacteria 18052
120 Ga0070693_100000709 3300005547 Bacteria 14685
121 Ga0070665_100040914 3300005548 Bacteria 4658
122 Ga0070665_100516649 3300005548 Bacteria 1206
123 Ga0070704_100000009 3300005549 Bacteria 67191
124 Ga0070704_100012387 3300005549 Bacteria 5267
125 Ga0070704_100056923 3300005549 Bacteria 2778
126 Ga0070704_100378657 3300005549 Bacteria 1202
127 Ga0068855_100000709 3300005563 Bacteria 40793
128 Ga0068854_100015452 3300005578 Bacteria 5057
129 Ga0068856_100023401 3300005614 Bacteria 6006
130 Ga0068856_100066924 3300005614 Bacteria 3550
131 Ga0070702_100000009 3300005615 Bacteria 60314
132 Ga0070702_100000034 3300005615 Bacteria 36812
133 Ga0070702_100046127 3300005615 Bacteria 2469
134 Ga0070702_100106811 3300005615 Bacteria 1727
135 Ga0068859_100000354 3300005617 Bacteria 45757
136 Ga0068859_100006342 3300005617 Bacteria 11999
137 Ga0068859_100112439 3300005617 Bacteria 2786
138 Ga0068859_100144820 3300005617 Bacteria 2450
139 Ga0068864_100000221 3300005618 Bacteria 51532
140 Ga0068864_100084363 3300005618 Bacteria 2791
141 Ga0068864_100161551 3300005618 Bacteria 2037
142 Ga0068864_100201035 3300005618 Bacteria 1830
143 Ga0068866_10000071 3300005718 Bacteria 40521
144 Ga0068866_10000182 3300005718 Bacteria 29433
145 Ga0068866_10019618 3300005718 Bacteria 3083
146 Ga0068861_100000138 3300005719 Bacteria 36853
147 Ga0068861_100000604 3300005719 Bacteria 21267
148 Ga0068861_100040011 3300005719 Bacteria 3503
149 Ga0068861_100458060 3300005719 Bacteria 1144
150 Ga0068870_10024532 3300005840 Bacteria 2984
151 Ga0068870_10040149 3300005840 Bacteria 2425
152 Ga0068863_100097583 3300005841 Bacteria 2790
153 Ga0068863_100377227 3300005841 Bacteria 1384
154 Ga0068863_100500303 3300005841 Bacteria 1197
155 Ga0068858_100001410 3300005842 Bacteria 24676
156 Ga0068858_100004301 3300005842 Bacteria 13999
157 Ga0068858_100018412 3300005842 Bacteria 6538
158 Ga0068858_100158328 3300005842 Bacteria 2132
159 Ga0068860_100000285 3300005843 Bacteria 72246
160 Ga0068860_100024230 3300005843 Bacteria 5868
161 Ga0068860_100117894 3300005843 Bacteria 2540
162 Ga0068860_100199836 3300005843 Bacteria 1937
163 Ga0068862_100000821 3300005844 Bacteria 30739
164 Ga0068862_100001545 3300005844 Bacteria 21055
165 Ga0068862_100056399 3300005844 Bacteria 3366
166 Ga0068862_100490111 3300005844 Bacteria 1165
167 Ga0081539_10007773 3300005985 Bacteria 9601
168 Ga0081539_10014045 3300005985 Bacteria 5961
169 Ga0081539_10056388 3300005985 Bacteria 2180
170 Ga0070716_100116169 3300006173 Bacteria 1667
171 Ga0070716_100133475 3300006173 Bacteria 1573
172 Ga0075366_10029314 3300006195 Bacteria 3233
173 Ga0075366_10031681 3300006195 Bacteria 3113
174 Ga0075366_10062400 3300006195 Bacteria 2215
175 Ga0097621_100000392 3300006237 Bacteria 30517
176 Ga0097621_100010121 3300006237 Bacteria 6883
177 Ga0097621_100014056 3300006237 Bacteria 5982
178 Ga0068871_100001351 3300006358 Bacteria 16425
179 Ga0068871_100002080 3300006358 Bacteria 13535
180 Ga0068871_100003496 3300006358 Bacteria 10803
181 Ga0068871_100050802 3300006358 Bacteria 3355
182 Ga0068871_100061274 3300006358 Bacteria 3072
183 Ga0068871_100255741 3300006358 Bacteria 1527
184 Ga0075428_100000808 3300006844 Bacteria 32725
185 Ga0075428_100414151 3300006844 Bacteria 1444
186 Ga0075430_100055756 3300006846 Bacteria 3323
187 Ga0075431_100000766 3300006847 Bacteria 27825
188 Ga0075431_100125544 3300006847 Bacteria 2648
189 Ga0075431_100219863 3300006847 Bacteria 1938
190 Ga0075431_100379844 3300006847 Bacteria 1417
191 Ga0075433_10000760 3300006852 Bacteria 22134
192 Ga0075434_100001640 3300006871 Bacteria 19031
193 Ga0075434_100031112 3300006871 Bacteria 5260
194 Ga0075434_100072309 3300006871 Bacteria 3441
195 Ga0075434_100083798 3300006871 Bacteria 3186
196 Ga0075434_100108511 3300006871 Bacteria 2786
197 Ga0075429_100012547 3300006880 Bacteria 7352
198 Ga0075429_100069865 3300006880 Bacteria 3057
199 Ga0075429_100494663 3300006880 Bacteria 1072
200 Ga0068865_100000052 3300006881 Bacteria 63932
201 Ga0068865_100000179 3300006881 Bacteria 35156
202 Ga0068865_100059263 3300006881 Bacteria 2677
203 Ga0068865_100248351 3300006881 Bacteria 1403
204 Ga0075436_100001167 3300006914 Bacteria 17790
205 Ga0075436_100112962 3300006914 Bacteria 1897
206 Ga0097620_100000354 3300006931 Bacteria 45757
207 Ga0097620_100006342 3300006931 Bacteria 11999
208 Ga0097620_100112441 3300006931 Bacteria 2786
209 Ga0097620_100144814 3300006931 Bacteria 2450
210 Ga0075435_100000197 3300007076 Bacteria 36483
211 Ga0075435_100019130 3300007076 Bacteria 5221
212 Ga0075435_100061660 3300007076 Bacteria 3042
213 Ga0075435_100312918 3300007076 Bacteria 1344
214 Ga0075435_100331914 3300007076 Bacteria 1302
215 Ga0111539_10002099 3300009094 Bacteria 26631
216 Ga0111539_10032915 3300009094 Bacteria 6295
217 Ga0111539_10041392 3300009094 Bacteria 5539
218 Ga0111539_10057790 3300009094 Bacteria 4605
219 Ga0111539_10182108 3300009094 Bacteria 2454
220 Ga0105245_10000086 3300009098 Bacteria 93019
221 Ga0105245_10000414 3300009098 Bacteria 39803
222 Ga0114129_10452721 3300009147 Bacteria 1683
223 Ga0114129_10574285 3300009147 Bacteria 1464
224 Ga0105243_10000212 3300009148 Bacteria 67614
225 Ga0105243_10000360 3300009148 Bacteria 48717
226 Ga0105241_10067766 3300009174 Bacteria 2763
227 Ga0105242_10000291 3300009176 Bacteria 39986
228 Ga0105242_10001022 3300009176 Bacteria 22000
229 Ga0105242_10263442 3300009176 Bacteria 1558
230 Ga0105248_10123719 3300009177 Bacteria 2917
231 Ga0105248_10186124 3300009177 Bacteria 2340
232 Ga0105237_10441302 3300009545 Bacteria 1307
233 Ga0105238_10010725 3300009551 Bacteria 9204
234 Ga0105238_10039024 3300009551 Bacteria 4818
235 Ga0105249_10019473 3300009553 Bacteria 6055
236 Ga0105249_10122002 3300009553 Bacteria 2478
237 Ga0105239_10510863 3300010375 Bacteria 1367
238 Ga0105246_10286589 3300011119 Bacteria 1324
239 Ga0157370_10008837 3300013104 Bacteria 10828
240 Ga0157369_10052937 3300013105 Bacteria 4390
241 Ga0157374_10002030 3300013296 Bacteria 16995
242 Ga0157378_10000332 3300013297 Bacteria 46615
243 Ga0157378_10001356 3300013297 Bacteria 22016
244 Ga0157378_10007884 3300013297 Bacteria 9294
245 Ga0157378_10291312 3300013297 Bacteria 1577
246 Ga0163162_10045953 3300013306 Bacteria 4377
247 Ga0163162_10054173 3300013306 Bacteria 4034
248 Ga0163162_10181997 3300013306 Bacteria 2228
249 Ga0163162_10290166 3300013306 Bacteria 1768
250 Ga0157372_10067499 3300013307 Bacteria 4018
251 Ga0157372_10393067 3300013307 Bacteria 1616
252 Ga0157375_10079352 3300013308 Bacteria 3318
253 Ga0157375_10211706 3300013308 Bacteria 2096
254 Ga0163163_10087360 3300014325 Bacteria 3128
255 Ga0157380_10015914 3300014326 Bacteria 5535
256 Ga0157380_10023122 3300014326 Bacteria 4687
257 Ga0157379_10005955 3300014968 Bacteria 10505
258 Ga0157379_10180485 3300014968 Bacteria 1907
259 Ga0157379_10286465 3300014968 Bacteria 1499
260 Ga0157376_10014757 3300014969 Bacteria 5876
261 Ga0157376_10111946 3300014969 Bacteria 2404
262 Ga0182006_1000125 3300015261 Bacteria 82143
263 Ga0182007_10000082 3300015262 Bacteria 71660
264 Ga0182005_1000047 3300015265 Bacteria 126754
265 Ga0207653_10004131 3300025885 Bacteria 4567
266 Ga0207653_10051410 3300025885 Bacteria 1372
267 Ga0207653_10060705 3300025885 Bacteria 1274
268 Ga0207682_10036076 3300025893 Bacteria 1999
269 Ga0207682_10055525 3300025893 Bacteria 1647
270 Ga0207642_10000468 3300025899 Bacteria 12355
271 Ga0207642_10001220 3300025899 Bacteria 7954
272 Ga0207642_10002880 3300025899 Bacteria 5379
273 Ga0207688_10021299 3300025901 Bacteria 3542
274 Ga0207680_10038638 3300025903 Bacteria 2764
275 Ga0207680_10338197 3300025903 Bacteria 1055
276 Ga0207645_10052253 3300025907 Bacteria 2611
277 Ga0207645_10070962 3300025907 Bacteria 2229
278 Ga0207643_10019149 3300025908 Bacteria 3750
279 Ga0207643_10045411 3300025908 Bacteria 2481
280 Ga0207643_10087467 3300025908 Bacteria 1812
281 Ga0207684_10037180 3300025910 Bacteria 4131
282 Ga0207684_10052852 3300025910 Bacteria 3448
283 Ga0207684_10187359 3300025910 Bacteria 1784
284 Ga0207654_10004678 3300025911 Bacteria 6924
285 Ga0207707_10001519 3300025912 Bacteria 21403
286 Ga0207707_10138779 3300025912 Bacteria 2126
287 Ga0207660_10001415 3300025917 Bacteria 16105
288 Ga0207660_10009613 3300025917 Bacteria 6259
289 Ga0207660_10083274 3300025917 Bacteria 2355
290 Ga0207660_10273819 3300025917 Bacteria 1338
291 Ga0207662_10000321 3300025918 Bacteria 21775
292 Ga0207652_10140875 3300025921 Bacteria 2156
293 Ga0207652_10426473 3300025921 Bacteria 1196
294 Ga0207646_10101571 3300025922 Bacteria 2578
295 Ga0207681_10074039 3300025923 Bacteria 2385
296 Ga0207681_10207370 3300025923 Bacteria 1508
297 Ga0207694_10146811 3300025924 Bacteria 1899
298 Ga0207694_10486716 3300025924 Bacteria 1032
299 Ga0207650_10002173 3300025925 Bacteria 13703
300 Ga0207650_10007990 3300025925 Bacteria 7211
301 Ga0207650_10048413 3300025925 Bacteria 3135
302 Ga0207650_10122629 3300025925 Bacteria 2025
303 Ga0207659_10008089 3300025926 Bacteria 6509
304 Ga0207659_10035105 3300025926 Bacteria 3464
305 Ga0207687_10000873 3300025927 Bacteria 20408
306 Ga0207687_10001602 3300025927 Bacteria 15584
307 Ga0207700_10000023 3300025928 Bacteria 152285
308 Ga0207644_10064518 3300025931 Bacteria 2661
309 Ga0207644_10494985 3300025931 Bacteria 1008
310 Ga0207706_10022840 3300025933 Bacteria 5613
311 Ga0207706_10035632 3300025933 Bacteria 4423
312 Ga0207686_10000270 3300025934 Bacteria 38522
313 Ga0207686_10000366 3300025934 Bacteria 31802
314 Ga0207686_10007093 3300025934 Bacteria 6030
315 Ga0207709_10001682 3300025935 Bacteria 14896
316 Ga0207709_10076206 3300025935 Bacteria 2146
317 Ga0207709_10113581 3300025935 Bacteria 1816
318 Ga0207670_10002400 3300025936 Bacteria 9816
319 Ga0207670_10006642 3300025936 Bacteria 6432
320 Ga0207670_10016210 3300025936 Bacteria 4471
321 Ga0207670_10018110 3300025936 Bacteria 4273
322 Ga0207670_10130410 3300025936 Bacteria 1841
323 Ga0207669_10064002 3300025937 Bacteria 2274
324 Ga0207669_10219104 3300025937 Bacteria 1395
325 Ga0207704_10000183 3300025938 Bacteria 32999
326 Ga0207704_10000797 3300025938 Bacteria 13935
327 Ga0207704_10289639 3300025938 Bacteria 1249
328 Ga0207665_10019521 3300025939 Bacteria 4457
329 Ga0207665_10160981 3300025939 Bacteria 1614
330 Ga0207665_10191995 3300025939 Bacteria 1484
331 Ga0207691_10026283 3300025940 Bacteria 5464
332 Ga0207691_10035123 3300025940 Bacteria 4658
333 Ga0207691_10049807 3300025940 Bacteria 3838
334 Ga0207691_10050489 3300025940 Bacteria 3807
335 Ga0207691_10098782 3300025940 Bacteria 2607
336 Ga0207691_10457747 3300025940 Bacteria 1085
337 Ga0207711_10095828 3300025941 Bacteria 2618
338 Ga0207689_10000691 3300025942 Bacteria 32302
339 Ga0207689_10001513 3300025942 Bacteria 22121
340 Ga0207661_10075380 3300025944 Bacteria 2768
341 Ga0207661_10167984 3300025944 Bacteria 1908
342 Ga0207667_10002649 3300025949 Bacteria 22123
343 Ga0207651_10042838 3300025960 Bacteria 3016
344 Ga0207651_10142150 3300025960 Bacteria 1855
345 Ga0207712_10016016 3300025961 Bacteria 4846
346 Ga0207712_10088409 3300025961 Bacteria 2275
347 Ga0207668_10014105 3300025972 Bacteria 4941
348 Ga0207668_10017170 3300025972 Bacteria 4530
349 Ga0207668_10029643 3300025972 Bacteria 3588
350 Ga0207668_10040512 3300025972 Bacteria 3144
351 Ga0207668_10406852 3300025972 Bacteria 1152
352 Ga0207640_10002042 3300025981 Bacteria 10917
353 Ga0207658_10036827 3300025986 Bacteria 3510
354 Ga0207658_10157175 3300025986 Bacteria 1859
355 Ga0207677_10006374 3300026023 Bacteria 6471
356 Ga0207703_10003629 3300026035 Bacteria 12866
357 Ga0207703_10077947 3300026035 Bacteria 2752
358 Ga0207639_10045474 3300026041 Bacteria 3307
359 Ga0207639_10148470 3300026041 Bacteria 1961
360 Ga0207639_10277509 3300026041 Bacteria 1473
361 Ga0207639_10732169 3300026041 Bacteria 919
362 Ga0207708_10000058 3300026075 Bacteria 95656
363 Ga0207708_10000182 3300026075 Bacteria 49271
364 Ga0207708_10006959 3300026075 Bacteria 8365
365 Ga0207708_10299856 3300026075 Bacteria 1307
366 Ga0207702_10007177 3300026078 Bacteria 9535
367 Ga0207702_10173918 3300026078 Bacteria 1977
368 Ga0207641_10015731 3300026088 Bacteria 6199
369 Ga0207641_10060162 3300026088 Bacteria 3237
370 Ga0207641_10066464 3300026088 Bacteria 3086
371 Ga0207641_10210621 3300026088 Bacteria 1797
372 Ga0207641_10675144 3300026088 Bacteria 1016
373 Ga0207648_10000335 3300026089 Bacteria 51594
374 Ga0207648_10000635 3300026089 Bacteria 39416
375 Ga0207648_10007959 3300026089 Bacteria 10337
376 Ga0207648_10016063 3300026089 Bacteria 6858
377 Ga0207648_10025705 3300026089 Bacteria 5242
378 Ga0207648_10094740 3300026089 Bacteria 2611
379 Ga0207648_10121862 3300026089 Bacteria 2293
380 Ga0207648_10265032 3300026089 Bacteria 1534
381 Ga0207648_10303253 3300026089 Bacteria 1433
382 Ga0207648_10496286 3300026089 Bacteria 1116
383 Ga0207676_10003875 3300026095 Bacteria 10565
384 Ga0207676_10057276 3300026095 Bacteria 3068
385 Ga0207676_10104769 3300026095 Bacteria 2353
386 Ga0207676_10148764 3300026095 Bacteria 2014
387 Ga0207674_10059819 3300026116 Bacteria 3854
388 Ga0207675_100000142 3300026118 Bacteria 61826
389 Ga0207675_100000480 3300026118 Bacteria 38807
390 Ga0207675_100043625 3300026118 Bacteria 4188
391 Ga0207675_100417082 3300026118 Bacteria 1325
392 Ga0207683_10006552 3300026121 Bacteria 9968
393 Ga0207683_10032450 3300026121 Bacteria 4536
394 Ga0207683_10129494 3300026121 Bacteria 2269
395 Ga0209969_1000383 3300027360 Bacteria 5901
396 Ga0209967_1001270 3300027364 Bacteria 3230
397 Ga0210000_1004590 3300027462 Bacteria 1992
398 Ga0210000_1013024 3300027462 Bacteria 1239
399 Ga0209971_1037711 3300027682 Bacteria 1164
400 Ga0209974_10001043 3300027876 Bacteria 9809
401 Ga0207428_10031648 3300027907 Bacteria 4362
402 Ga0207428_10049245 3300027907 Bacteria 3377
403 Ga0207428_10054842 3300027907 Bacteria 3172
404 Ga0207428_10093718 3300027907 Bacteria 2329
405 Ga0207428_10169477 3300027907 Bacteria 1654
406 Ga0268266_10246497 3300028379 Bacteria 1651
407 Ga0268265_10004647 3300028380 Bacteria 9479
408 Ga0268265_10452692 3300028380 Bacteria 1199
409 Ga0268265_10516312 3300028380 Bacteria 1128
410 Ga0268264_10000446 3300028381 Bacteria 56436
411 Ga0268264_10017480 3300028381 Bacteria 5872
412 Ga0268264_10244401 3300028381 Bacteria 1664
413 Ga0265336_10002767 3300028666 Bacteria 7083
414 Ga0265338_10138811 3300028800 Bacteria 1907
415 Ga0265324_10000023 3300029957 Bacteria 164128
416 Ga0265324_10000147 3300029957 Bacteria 54400
417 Ga0265330_10006254 3300031235 Bacteria 5886
418 Ga0265332_10001350 3300031238 Bacteria 13902
419 Ga0265328_10061855 3300031239 Bacteria 1374
420 Ga0265325_10001817 3300031241 Bacteria 14761
421 Ga0265325_10007369 3300031241 Bacteria 6590
422 Ga0265329_10001643 3300031242 Bacteria 10683
423 Ga0265331_10001285 3300031250 Bacteria 18719
424 Ga0265331_10013417 3300031250 Bacteria 4407
425 Ga0265331_10016098 3300031250 Bacteria 3933
426 Ga0265331_10109854 3300031250 Bacteria 1265
427 Ga0265327_10001001 3300031251 Bacteria 40152
428 Ga0265316_10097446 3300031344 Bacteria 2238
429 Ga0307408_100000255 3300031548 Bacteria 54496
430 Ga0316575_10000119 3300031665 Bacteria 19810
431 Ga0265314_10000451 3300031711 Bacteria 54865
432 Ga0265314_10066022 3300031711 Bacteria 2441
433 Ga0265342_10006317 3300031712 Bacteria 8838
434 Ga0265342_10166168 3300031712 Bacteria 1217
435 Ga0307405_10083322 3300031731 Bacteria 2096
436 Ga0307413_10295485 3300031824 Bacteria 1226
437 Ga0307406_10167768 3300031901 Bacteria 1585
438 Ga0307407_10031941 3300031903 Bacteria 2857
439 Ga0307409_100327694 3300031995 Bacteria 1436
440 Ga0307416_100008436 3300032002 Bacteria 6651
441 Ga0307416_100077927 3300032002 Bacteria 2786
442 Ga0307416_100183944 3300032002 Bacteria 1962
443 Ga0307416_100487681 3300032002 Bacteria 1294
444 Ga0307416_100531386 3300032002 Bacteria 1246
445 Ga0307416_100653506 3300032002 Bacteria 1136
446 Ga0307416_100684363 3300032002 Bacteria 1113
447 Ga0307414_10062185 3300032004 Bacteria 2648
448 Ga0307414_10139817 3300032004 Bacteria 1894
449 Ga0307411_10022507 3300032005 Bacteria 3712
450 Ga0307415_100009754 3300032126 Bacteria 5403
451 Ga0316583_10009481 3300032133 Bacteria 3505
452 Ga0373944_0037586 3300035089 Bacteria 1483
453 Ga0373936_0007371 3300035113 Bacteria 4139
454 Ga0373954_0000006 3300035118 Bacteria 98573
455 Ga0373943_0046789 3300035170 Bacteria 2112
456 Ga0316574_0004828 3300035398 Bacteria 7135
457 Ga0316574_0135994 3300035398 Bacteria 1583
458 Ga0373924_0100502 3300035410 Bacteria 1244
459 Ga0373931_0005958 3300035691 Bacteria 5668
460 Ga0373935_0109415 3300035692 Bacteria 1832
461 Ga0373927_0034375 3300035695 Bacteria 3297
462 Ga0373937_0000595 3300036401 Bacteria 32029
463 Ga0373937_0001313 3300036401 Bacteria 20818
464 Ga0373937_0038539 3300036401 Bacteria 4355
465 Ga0373937_0694037 3300036401 Bacteria 964
466 Ga0316582_0051923 3300036647 Bacteria 2604
467 Ga0316584_0074832 3300036712 Bacteria 2539
468 Ga0316584_0219310 3300036712 Bacteria 1398
469 Ga0373925_0534573 3300037068 Bacteria 963
470 Ga0395899_0000078 3300037312 Bacteria 174141
471 Ga0395899_0020971 3300037312 Bacteria 4955
472 Ga0395900_0355857 3300037418 Bacteria 1436
473 Ga0395905_0028150 3300037471 Bacteria 5296
474 Ga0395901_0037665 3300038443 Bacteria 5001
475 Ga0451807_2453357 3300041486 Bacteria 1420
476 Ga0450893_0014556 3300042532 Bacteria 1320
477 Ga0451577_0000013 3300042876 Bacteria 550689
478 Ga0451577_0002234 3300042876 Bacteria 23544
479 Ga0451577_0005927 3300042876 Bacteria 12320
480 Ga0451577_0011417 3300042876 Bacteria 8404
481 Ga0451577_0016377 3300042876 Bacteria 6869
482 Ga0451577_0028436 3300042876 Bacteria 5057
483 Ga0451577_0029084 3300042876 Bacteria 4996
484 Ga0451577_0037008 3300042876 Bacteria 4394
485 Ga0451577_0069590 3300042876 Bacteria 3138
486 Ga0451577_0330441 3300042876 Bacteria 1383
487 Ga0451577_0435594 3300042876 Bacteria 1190
488 Ga0451577_0515492 3300042876 Bacteria 1086
489 Ga0466969_0019480 3300044656 Bacteria 3526
490 Ga0453683_0000033 3300044673 Bacteria 241479
491 Ga0453683_0139796 3300044673 Bacteria 1528
492 Ga0453683_0224817 3300044673 Bacteria 1194
493 Ga0466965_0050119 3300044683 Bacteria 2070
494 Ga0466965_0075732 3300044683 Bacteria 1697
495 Ga0466966_0012298 3300044684 Bacteria 5671
496 Ga0466966_0301813 3300044684 Bacteria 962
497 Ga0466961_0001479 3300044693 Bacteria 14606
498 Ga0453684_0000029 3300044712 Bacteria 757969
499 Ga0453684_0000085 3300044712 Bacteria 397817
500 Ga0453684_0000566 3300044712 Bacteria 138895
501 Ga0453684_0000716 3300044712 Bacteria 117287
502 Ga0453684_0016608 3300044712 Bacteria 11488
503 Ga0453684_0027030 3300044712 Bacteria 8253
504 Ga0453684_0053042 3300044712 Bacteria 5296
505 Ga0453684_0227503 3300044712 Bacteria 2156
506 Ga0453684_0460034 3300044712 Bacteria 1415
507 Ga0466970_0184055 3300044765 Bacteria 1159
508 Ga0466959_0100117 3300045049 Bacteria 2075
509 Ga0451576_0000013 3300045051 Bacteria 665120
510 Ga0451576_0000018 3300045051 Bacteria 550689
511 Ga0451576_0000239 3300045051 Bacteria 134323
512 Ga0451576_0000304 3300045051 Bacteria 119160
513 Ga0451576_0001273 3300045051 Bacteria 44098
514 Ga0451576_0002171 3300045051 Bacteria 30352
515 Ga0451576_0007226 3300045051 Bacteria 13379
516 Ga0451576_0007845 3300045051 Bacteria 12650
517 Ga0451576_0045277 3300045051 Bacteria 4635
518 Ga0451576_0068892 3300045051 Bacteria 3682
519 Ga0451576_0069101 3300045051 Bacteria 3675
520 Ga0451576_0074732 3300045051 Bacteria 3526
521 Ga0451576_0174899 3300045051 Bacteria 2241
522 Ga0451576_0206543 3300045051 Bacteria 2051
523 Ga0495592_0060625 3300046454 Bacteria 2782
524 Ga0495603_0021451 3300046455 Bacteria 3912
525 Ga0495590_0062683 3300046457 Bacteria 1301
526 Ga0495580_0005667 3300046472 Bacteria 10272
527 Ga0495639_0009273 3300046475 Bacteria 4218
528 Ga0495662_0021375 3300046476 Bacteria 3129
529 Ga0495662_0069247 3300046476 Bacteria 1709
530 Ga0495585_0157014 3300046492 Bacteria 1182
531 Ga0495594_0057653 3300046499 Bacteria 2145
532 Ga0495618_0210793 3300046514 Bacteria 1228
533 Ga0495628_0157959 3300046516 Bacteria 1724
534 Ga0495630_0030648 3300046517 Bacteria 4003
535 Ga0495644_0010277 3300046523 Bacteria 3606
536 Ga0495654_0007358 3300046530 Bacteria 6159
537 Ga0495665_0017033 3300046531 Bacteria 3910
538 Ga0495640_0041479 3300046533 Bacteria 3216
539 Ga0495640_0047071 3300046533 Bacteria 2985
540 Ga0495586_0065890 3300046535 Bacteria 1974
541 Ga0495598_0017817 3300046537 Bacteria 1837
542 Ga0495621_0037003 3300046539 Bacteria 1696
543 Ga0495645_0323513 3300046543 Bacteria 1001
544 Ga0495633_0000217 3300046558 Bacteria 71892
545 Ga0495667_0098397 3300046559 Bacteria 1894
546 Ga0495634_0049960 3300046642 Bacteria 2810
547 Ga0495635_0100691 3300046663 Bacteria 1975
548 Ga0495588_0009412 3300046674 Bacteria 4515
549 Ga0495658_0002070 3300046683 Bacteria 10167
550 Ga0495670_0007197 3300046691 Bacteria 5475
551 Ga0495660_0034060 3300046810 Bacteria 2852
552 Ga0495581_0170906 3300047315 Bacteria 1271
553 Ga0495604_0204077 3300047317 Bacteria 1369
554 Ga0495636_0093633 3300047318 Bacteria 1307
555 Ga0495672_0000019 3300047320 Bacteria 448153
556 Ga0495676_0105778 3300047321 Bacteria 2074
557 Ga0495680_0006240 3300047322 Bacteria 11113
558 Ga0495675_0188721 3300047444 Bacteria 1259
559 Ga0495684_0059487 3300047471 Bacteria 2910
560 Ga0495626_0045230 3300048091 Bacteria 2056
561 Ga0496102_0000153 3300048905 Bacteria 94014
562 Ga0496106_0083735 3300048909 Bacteria 2453
563 Ga0496107_0199271 3300048910 Bacteria 1488
564 Ga0496111_0106341 3300048914 Bacteria 2065
565 Ga0496114_0049170 3300048917 Bacteria 3508
566 Ga0496116_0003977 3300048919 Bacteria 14348
567 Ga0496117_0000075 3300048920 Bacteria 232451
568 Ga0496118_0000055 3300048921 Bacteria 232451
569 Ga0496121_0007383 3300048924 Bacteria 13285
570 Ga0496121_0015398 3300048924 Bacteria 8015
571 Ga0496122_0003176 3300048925 Bacteria 21923
572 Ga0496123_0013248 3300048926 Bacteria 6945
573 Ga0496125_0016477 3300048928 Bacteria 7094
574 Ga0495682_0002063 3300049460 Bacteria 9826
575 Ga0501296_013143 3300049519 Bacteria 1006
576 Ga0501031_0308404 3300049568 Bacteria 1025
577 Ga0501032_0081252 3300049569 Bacteria 2157
578 Ga0501032_0152593 3300049569 Bacteria 1518
579 Ga0501033_0206738 3300049570 Bacteria 1401
580 Ga0501034_0009604 3300049571 Bacteria 10121
581 Ga0501034_0095003 3300049571 Bacteria 2978
582 Ga0501034_0220647 3300049571 Bacteria 1848
583 Ga0501036_0017457 3300049572 Bacteria 6000
584 Ga0501036_0045415 3300049572 Bacteria 3722
585 Ga0501036_0159250 3300049572 Bacteria 1904
586 Ga0501037_0108029 3300049573 Bacteria 2005
587 Ga0501038_0069601 3300049574 Bacteria 2989
588 Ga0501038_0079533 3300049574 Bacteria 2764
589 Ga0501038_0163833 3300049574 Bacteria 1805
590 Ga0501038_0272714 3300049574 Bacteria 1333
591 Ga0501039_0008574 3300049575 Bacteria 7798
592 Ga0501039_0086986 3300049575 Bacteria 2434
593 Ga0501039_0185892 3300049575 Bacteria 1634
594 Ga0501039_0216572 3300049575 Bacteria 1505
595 Ga0501040_0028188 3300049576 Bacteria 3785
596 Ga0501040_0059132 3300049576 Bacteria 2633
597 Ga0501040_0067239 3300049576 Bacteria 2470
598 Ga0501040_0237231 3300049576 Bacteria 1299
599 Ga0501041_0006157 3300049577 Bacteria 7012
600 Ga0501041_0029109 3300049577 Bacteria 3332
601 Ga0501041_0066374 3300049577 Bacteria 2211
602 Ga0501041_0137599 3300049577 Bacteria 1522
603 Ga0501042_0036271 3300049578 Bacteria 3498
604 Ga0501042_0069586 3300049578 Bacteria 2517
605 Ga0501043_0024358 3300049579 Bacteria 4750
606 Ga0501043_0354068 3300049579 Bacteria 1115
607 Ga0501046_0281359 3300049580 Bacteria 1218
608 Ga0501048_0068303 3300049582 Bacteria 2511
609 Ga0501048_0117918 3300049582 Bacteria 1875
610 Ga0501068_0173139 3300049584 Bacteria 1363
611 Ga0501071_0007935 3300049587 Bacteria 7002
612 Ga0501071_0147653 3300049587 Bacteria 1753
613 Ga0501071_0433211 3300049587 Bacteria 1005
614 Ga0501072_0003599 3300049588 Bacteria 11660
615 Ga0501072_0048231 3300049588 Bacteria 3354
616 Ga0501072_0055196 3300049588 Bacteria 3131
617 Ga0501073_0028094 3300049589 Bacteria 4019
618 Ga0501073_0047990 3300049589 Bacteria 2999
619 Ga0501074_0108535 3300049590 Bacteria 1986
620 Ga0501075_0034726 3300049591 Bacteria 3756
621 Ga0501075_0087063 3300049591 Bacteria 2367
622 Ga0501076_0025656 3300049592 Bacteria 4563
623 Ga0501076_0044858 3300049592 Bacteria 3488
624 Ga0501076_0106193 3300049592 Bacteria 2266
625 Ga0501077_0019311 3300049593 Bacteria 4311
626 Ga0501077_0030974 3300049593 Bacteria 3404
627 Ga0501229_015608 3300049706 Bacteria 986
628 Ga0501079_0003787 3300049741 Bacteria 11172
629 Ga0501079_0006139 3300049741 Bacteria 9009
630 Ga0501079_0006509 3300049741 Bacteria 8774
631 Ga0501079_0123542 3300049741 Bacteria 2013
632 Ga0501080_0003624 3300049742 Bacteria 13611
633 Ga0501080_0170680 3300049742 Bacteria 2006
634 Ga0501081_0001437 3300049743 Bacteria 14555
635 Ga0501081_0003105 3300049743 Bacteria 10552
636 Ga0501081_0005607 3300049743 Bacteria 8109
637 Ga0501081_0051549 3300049743 Bacteria 2838
638 Ga0501083_0116506 3300049744 Bacteria 1754
639 Ga0501280_005038 3300049776 Bacteria 1905
640 Ga0501044_0092683 3300049823 Bacteria 3047
641 Ga0501045_0003648 3300049824 Bacteria 10584
642 Ga0501045_0011731 3300049824 Bacteria 6158
643 nmdc:mga0k408_2747_c2 3300050493 Bacteria 5583
644 nmdc:mga0k408_77223_c1 3300050493 Bacteria 1947
645 nmdc:mga0k408_97050_c1 3300050493 Bacteria 1735
646 nmdc:mga09592_245520_c1 3300050508 Bacteria 1552
647 nmdc:mga09592_30451_c1 3300050508 Bacteria 4490
648 nmdc:mga09592_74755_c1 3300050508 Bacteria 2879
649 nmdc:mga0qj67_205079_c1 3300050509 Bacteria 1601
650 nmdc:mga0qj67_23747_c1 3300050509 Bacteria 4720
651 nmdc:mga0qj67_27513_c1 3300050509 Bacteria 4408
652 nmdc:mga06r32_18489_c1 3300050510 Bacteria 6381
653 nmdc:mga06r32_194175_c1 3300050510 Bacteria 2017
654 nmdc:mga06r32_259775_c1 3300050510 Bacteria 1724
655 nmdc:mga06r32_341350_c1 3300050510 Bacteria 1482
656 nmdc:mga08y16_11634_c1 3300050511 Bacteria 9244
657 nmdc:mga08y16_120338_c1 3300050511 Bacteria 2732
658 nmdc:mga08y16_2559_c1 3300050511 Bacteria 18707
659 nmdc:mga08y16_266245_c1 3300050511 Bacteria 1769
660 nmdc:mga08y16_45084_c1 3300050511 Bacteria 4619
661 nmdc:mga08y16_93171_c1 3300050511 Bacteria 3139
662 nmdc:mga0n895_116008_c1 3300050512 Bacteria 2696
663 nmdc:mga0n895_32773_c1 3300050512 Bacteria 4988
664 nmdc:mga0n895_6480_c1 3300050512 Bacteria 9945
665 nmdc:mga0n895_96410_c1 3300050512 Bacteria 2963
666 nmdc:mga0rr50_11221_c1 3300050513 Bacteria 5721
667 nmdc:mga0rr50_147081_c1 3300050513 Bacteria 1901
668 nmdc:mga0rr50_244317_c1 3300050513 Bacteria 1489
669 nmdc:mga0rr50_62755_c1 3300050513 Bacteria 2804
670 nmdc:mga0rr50_68783_c1 3300050513 Bacteria 2693
671 nmdc:mga0rr50_920_c1 3300050513 Bacteria 15930
672 nmdc:mga08x19_252_c1 3300050514 Bacteria 40716
673 nmdc:mga08x19_9008_c1 3300050514 Bacteria 5959
674 nmdc:mga0a205_2056_c1 3300050515 Bacteria 17593
675 nmdc:mga0a205_347720_c1 3300050515 Bacteria 1350
676 nmdc:mga0a205_41263_c1 3300050515 Bacteria 4443
677 nmdc:mga0a205_445984_c1 3300050515 Bacteria 1154
678 nmdc:mga0a205_49685_c1 3300050515 Bacteria 4049
679 Ga0495601_0183575 3300053077 Bacteria 1367
680 Ga0500636_0000097 3300053177 Bacteria 44743
681 Ga0500637_0114454 3300053178 Bacteria 1564
682 Ga0500625_089849 3300053729 Bacteria 1317
683 Ga0501084_0062462 3300054114 Bacteria 3118
684 Ga0501084_0140576 3300054114 Bacteria 2033
685 Ga0501084_0167718 3300054114 Bacteria 1853
686 Ga0587111_0020664 3300060346 Bacteria 1262
687 Ga0501082_0000750 3300060353 Bacteria 28493
688 Ga0501082_0002423 3300060353 Bacteria 16374
689 Ga0501082_0037631 3300060353 Bacteria 4172
690 Ga0466962_0104806 3300061719 Bacteria 1359
691 Ga0530510_0001760 3300061734 Bacteria 14750
692 Ga0530510_0003772 3300061734 Bacteria 10437
693 Ga0530510_0036944 3300061734 Bacteria 3520
694 2601666870 2600255292 Bacteria 6300551
695 2644027002 2643221603 Bacteria 6147767
696 Ga0070713_100000035
697 Ga0007417J51691_1068983
698 Ga0007410J51695_1062819
699 Ga0007409J51694_1032781
700 Ga0007416J51690_1027314
701 Ga0032354_1038350
702 Ga0070658_10346096
703 Ga0070676_10047494
704 Ga0070676_10320516
705 Ga0070690_100000085
706 Ga0070690_100000412
707 Ga0070690_100036707
708 Ga0070690_100308523
709 Ga0070670_100005445
710 Ga0070670_100052993
711 Ga0070670_100106770
712 Ga0070677_10035025
713 Ga0068869_100000367
714 Ga0068869_100000446
715 Ga0068869_100411685
716 Ga0070666_10109535
717 Ga0070680_100000888
718 Ga0070680_100049905
719 Ga0070680_100060701
720 Ga0070682_100003483
721 Ga0070682_100040706
722 Ga0068868_100000639
723 Ga0070689_100000189
724 Ga0070689_100033046
725 Ga0070689_100060122
726 Ga0070689_100103869
727 Ga0070691_10006941
728 Ga0070687_100000020
729 Ga0070692_10018481
730 Ga0070692_10029579
731 Ga0070692_10029985
732 Ga0070668_100025855
733 Ga0070668_100034848
734 Ga0070668_100180170
735 Ga0070668_100389977
736 Ga0070668_100495575
737 Ga0070669_100023612
738 Ga0070669_100053088
739 Ga0070675_100014034
740 Ga0070675_100015218
741 Ga0070675_100031039
742 Ga0070675_100070106
743 Ga0070675_100126125
744 Ga0070671_100003540
745 Ga0070671_100070826
746 Ga0070671_100086131
747 Ga0070671_100347061
748 Ga0070673_100011712
749 Ga0070673_100059080
750 Ga0070673_100080098
751 Ga0070667_100023492
752 Ga0070667_100204735
753 Ga0070714_100284185
754 Ga0070701_10000095
755 Ga0070701_10000464
756 Ga0070701_10295468
757 Ga0070705_100000022
758 Ga0070705_100015239
759 Ga0070705_100043194
760 Ga0070705_100198440
761 Ga0070700_100000343
762 Ga0070700_100001533
763 Ga0070700_100041400
764 Ga0070700_100055356
765 Ga0070694_100000049
766 Ga0070694_100017583
767 Ga0070694_100021333
768 Ga0070694_100049694
769 Ga0070708_100136171
770 Ga0070708_100160908
771 Ga0070678_100003913
772 Ga0070678_100147953
773 Ga0070681_10000081
774 Ga0070681_10155008
775 Ga0068867_100000224
776 Ga0068867_100001285
777 Ga0068867_100071419
778 Ga0068867_100117863
779 Ga0068867_100205459
780 Ga0068867_100219304
781 Ga0070706_100023284
782 Ga0070706_100032816
783 Ga0070706_100101419
784 Ga0070707_100250044
785 Ga0070698_100009607
786 Ga0070699_100177988
787 Ga0070699_100196533
788 Ga0070699_100209041
789 Ga0070679_100168020
790 Ga0070679_100647545
791 Ga0070684_100056754
792 Ga0070684_100122175
793 Ga0070697_100019753
794 Ga0070697_100058068
795 Ga0070697_100150760
796 Ga0068853_100132882
797 Ga0068853_100134724
798 Ga0070672_100003720
799 Ga0070672_100039257
800 Ga0070672_100043824
801 Ga0070672_100104360
802 Ga0070672_100419318
803 Ga0070686_100000448
804 Ga0070686_100002753
805 Ga0070686_100009566
806 Ga0070695_100000030
807 Ga0070695_100000641
808 Ga0070695_100003128
809 Ga0070695_100214386
810 Ga0070696_100000688
811 Ga0070696_100012162
812 Ga0070696_100024371
813 Ga0070696_100042292
814 Ga0070693_100000472
815 Ga0070693_100000709
816 Ga0070665_100040914
817 Ga0070665_100516649
818 Ga0070704_100000009
819 Ga0070704_100012387
820 Ga0070704_100056923
821 Ga0070704_100378657
822 Ga0068855_100000709
823 Ga0068854_100015452
824 Ga0068856_100023401
825 Ga0068856_100066924
826 Ga0070702_100000009
827 Ga0070702_100000034
828 Ga0070702_100046127
829 Ga0070702_100106811
830 Ga0068859_100000354
831 Ga0068859_100006342
832 Ga0068859_100112439
833 Ga0068859_100144820
834 Ga0068864_100000221
835 Ga0068864_100084363
836 Ga0068864_100161551
837 Ga0068864_100201035
838 Ga0068866_10000071
839 Ga0068866_10000182
840 Ga0068866_10019618
841 Ga0068861_100000138
842 Ga0068861_100000604
843 Ga0068861_100040011
844 Ga0068861_100458060
845 Ga0068870_10024532
846 Ga0068870_10040149
847 Ga0068863_100097583
848 Ga0068863_100377227
849 Ga0068863_100500303
850 Ga0068858_100001410
851 Ga0068858_100004301
852 Ga0068858_100018412
853 Ga0068858_100158328
854 Ga0068860_100000285
855 Ga0068860_100024230
856 Ga0068860_100117894
857 Ga0068860_100199836
858 Ga0068862_100000821
859 Ga0068862_100001545
860 Ga0068862_100056399
861 Ga0068862_100490111
862 Ga0081539_10007773
863 Ga0081539_10014045
864 Ga0081539_10056388
865 Ga0070716_100116169
866 Ga0070716_100133475
867 Ga0075366_10029314
868 Ga0075366_10031681
869 Ga0075366_10062400
870 Ga0097621_100000392
871 Ga0097621_100010121
872 Ga0097621_100014056
873 Ga0068871_100001351
874 Ga0068871_100002080
875 Ga0068871_100003496
876 Ga0068871_100050802
877 Ga0068871_100061274
878 Ga0068871_100255741
879 Ga0075428_100000808
880 Ga0075428_100414151
881 Ga0075430_100055756
882 Ga0075431_100000766
883 Ga0075431_100125544
884 Ga0075431_100219863
885 Ga0075431_100379844
886 Ga0075433_10000760
887 Ga0075434_100001640
888 Ga0075434_100031112
889 Ga0075434_100072309
890 Ga0075434_100083798
891 Ga0075434_100108511
892 Ga0075429_100012547
893 Ga0075429_100069865
894 Ga0075429_100494663
895 Ga0068865_100000052
896 Ga0068865_100000179
897 Ga0068865_100059263
898 Ga0068865_100248351
899 Ga0075436_100001167
900 Ga0075436_100112962
901 Ga0097620_100000354
902 Ga0097620_100006342
903 Ga0097620_100112441
904 Ga0097620_100144814
905 Ga0075435_100000197
906 Ga0075435_100019130
907 Ga0075435_100061660
908 Ga0075435_100312918
909 Ga0075435_100331914
910 Ga0111539_10002099
911 Ga0111539_10032915
912 Ga0111539_10041392
913 Ga0111539_10057790
914 Ga0111539_10182108
915 Ga0105245_10000086
916 Ga0105245_10000414
917 Ga0114129_10452721
918 Ga0114129_10574285
919 Ga0105243_10000212
920 Ga0105243_10000360
921 Ga0105241_10067766
922 Ga0105242_10000291
923 Ga0105242_10001022
924 Ga0105242_10263442
925 Ga0105248_10123719
926 Ga0105248_10186124
927 Ga0105237_10441302
928 Ga0105238_10010725
929 Ga0105238_10039024
930 Ga0105249_10019473
931 Ga0105249_10122002
932 Ga0105239_10510863
933 Ga0105246_10286589
934 Ga0157370_10008837
935 Ga0157369_10052937
936 Ga0157374_10002030
937 Ga0157378_10000332
938 Ga0157378_10001356
939 Ga0157378_10007884
940 Ga0157378_10291312
941 Ga0163162_10045953
942 Ga0163162_10054173
943 Ga0163162_10181997
944 Ga0163162_10290166
945 Ga0157372_10067499
946 Ga0157372_10393067
947 Ga0157375_10079352
948 Ga0157375_10211706
949 Ga0163163_10087360
950 Ga0157380_10015914
951 Ga0157380_10023122
952 Ga0157379_10005955
953 Ga0157379_10180485
954 Ga0157379_10286465
955 Ga0157376_10014757
956 Ga0157376_10111946
957 Ga0182006_1000125
958 Ga0182007_10000082
959 Ga0182005_1000047
960 Ga0207653_10004131
961 Ga0207653_10051410
962 Ga0207653_10060705
963 Ga0207682_10036076
964 Ga0207682_10055525
965 Ga0207642_10000468
966 Ga0207642_10001220
967 Ga0207642_10002880
968 Ga0207688_10021299
969 Ga0207680_10038638
970 Ga0207680_10338197
971 Ga0207645_10052253
972 Ga0207645_10070962
973 Ga0207643_10019149
974 Ga0207643_10045411
975 Ga0207643_10087467
976 Ga0207684_10037180
977 Ga0207684_10052852
978 Ga0207684_10187359
979 Ga0207654_10004678
980 Ga0207707_10001519
981 Ga0207707_10138779
982 Ga0207660_10001415
983 Ga0207660_10009613
984 Ga0207660_10083274
985 Ga0207660_10273819
986 Ga0207662_10000321
987 Ga0207652_10140875
988 Ga0207652_10426473
989 Ga0207646_10101571
990 Ga0207681_10074039
991 Ga0207681_10207370
992 Ga0207694_10146811
993 Ga0207694_10486716
994 Ga0207650_10002173
995 Ga0207650_10007990
996 Ga0207650_10048413
997 Ga0207650_10122629
998 Ga0207659_10008089
999 Ga0207659_10035105
1000 Ga0207687_10000873
1001 Ga0207687_10001602
1002 Ga0207700_10000023
1003 Ga0207644_10064518
1004 Ga0207644_10494985
1005 Ga0207706_10022840
1006 Ga0207706_10035632
1007 Ga0207686_10000270
1008 Ga0207686_10000366
1009 Ga0207686_10007093
1010 Ga0207709_10001682
1011 Ga0207709_10076206
1012 Ga0207709_10113581
1013 Ga0207670_10002400
1014 Ga0207670_10006642
1015 Ga0207670_10016210
1016 Ga0207670_10018110
1017 Ga0207670_10130410
1018 Ga0207669_10064002
1019 Ga0207669_10219104
1020 Ga0207704_10000183
1021 Ga0207704_10000797
1022 Ga0207704_10289639
1023 Ga0207665_10019521
1024 Ga0207665_10160981
1025 Ga0207665_10191995
1026 Ga0207691_10026283
1027 Ga0207691_10035123
1028 Ga0207691_10049807
1029 Ga0207691_10050489
1030 Ga0207691_10098782
1031 Ga0207691_10457747
1032 Ga0207711_10095828
1033 Ga0207689_10000691
1034 Ga0207689_10001513
1035 Ga0207661_10075380
1036 Ga0207661_10167984
1037 Ga0207667_10002649
1038 Ga0207651_10042838
1039 Ga0207651_10142150
1040 Ga0207712_10016016
1041 Ga0207712_10088409
1042 Ga0207668_10014105
1043 Ga0207668_10017170
1044 Ga0207668_10029643
1045 Ga0207668_10040512
1046 Ga0207668_10406852
1047 Ga0207640_10002042
1048 Ga0207658_10036827
1049 Ga0207658_10157175
1050 Ga0207677_10006374
1051 Ga0207703_10003629
1052 Ga0207703_10077947
1053 Ga0207639_10045474
1054 Ga0207639_10148470
1055 Ga0207639_10277509
1056 Ga0207639_10732169
1057 Ga0207708_10000058
1058 Ga0207708_10000182
1059 Ga0207708_10006959
1060 Ga0207708_10299856
1061 Ga0207702_10007177
1062 Ga0207702_10173918
1063 Ga0207641_10015731
1064 Ga0207641_10060162
1065 Ga0207641_10066464
1066 Ga0207641_10210621
1067 Ga0207641_10675144
1068 Ga0207648_10000335
1069 Ga0207648_10000635
1070 Ga0207648_10007959
1071 Ga0207648_10016063
1072 Ga0207648_10025705
1073 Ga0207648_10094740
1074 Ga0207648_10121862
1075 Ga0207648_10265032
1076 Ga0207648_10303253
1077 Ga0207648_10496286
1078 Ga0207676_10003875
1079 Ga0207676_10057276
1080 Ga0207676_10104769
1081 Ga0207676_10148764
1082 Ga0207674_10059819
1083 Ga0207675_100000142
1084 Ga0207675_100000480
1085 Ga0207675_100043625
1086 Ga0207675_100417082
1087 Ga0207683_10006552
1088 Ga0207683_10032450
1089 Ga0207683_10129494
1090 Ga0209969_1000383
1091 Ga0209967_1001270
1092 Ga0210000_1004590
1093 Ga0210000_1013024
1094 Ga0209971_1037711
1095 Ga0209974_10001043
1096 Ga0207428_10031648
1097 Ga0207428_10049245
1098 Ga0207428_10054842
1099 Ga0207428_10093718
1100 Ga0207428_10169477
1101 Ga0268266_10246497
1102 Ga0268265_10004647
1103 Ga0268265_10452692
1104 Ga0268265_10516312
1105 Ga0268264_10000446
1106 Ga0268264_10017480
1107 Ga0268264_10244401
1108 Ga0265336_10002767
1109 Ga0265338_10138811
1110 Ga0265324_10000023
1111 Ga0265324_10000147
1112 Ga0265330_10006254
1113 Ga0265332_10001350
1114 Ga0265328_10061855
1115 Ga0265325_10001817
1116 Ga0265325_10007369
1117 Ga0265329_10001643
1118 Ga0265331_10001285
1119 Ga0265331_10013417
1120 Ga0265331_10016098
1121 Ga0265331_10109854
1122 Ga0265327_10001001
1123 Ga0265316_10097446
1124 Ga0307408_100000255
1125 Ga0316575_10000119
1126 Ga0265314_10000451
1127 Ga0265314_10066022
1128 Ga0265342_10006317
1129 Ga0265342_10166168
1130 Ga0307405_10083322
1131 Ga0307413_10295485
1132 Ga0307406_10167768
1133 Ga0307407_10031941
1134 Ga0307409_100327694
1135 Ga0307416_100008436
1136 Ga0307416_100077927
1137 Ga0307416_100183944
1138 Ga0307416_100487681
1139 Ga0307416_100531386
1140 Ga0307416_100653506
1141 Ga0307416_100684363
1142 Ga0307414_10062185
1143 Ga0307414_10139817
1144 Ga0307411_10022507
1145 Ga0307415_100009754
1146 Ga0316583_10009481
1147 Ga0373944_0037586
1148 Ga0373936_0007371
1149 Ga0373954_0000006
1150 Ga0373943_0046789
1151 Ga0316574_0004828
1152 Ga0316574_0135994
1153 Ga0373924_0100502
1154 Ga0373931_0005958
1155 Ga0373935_0109415
1156 Ga0373927_0034375
1157 Ga0373937_0000595
1158 Ga0373937_0001313
1159 Ga0373937_0038539
1160 Ga0373937_0694037
1161 Ga0316582_0051923
1162 Ga0316584_0074832
1163 Ga0316584_0219310
1164 Ga0373925_0534573
1165 Ga0395899_0000078
1166 Ga0395899_0020971
1167 Ga0395900_0355857
1168 Ga0395905_0028150
1169 Ga0395901_0037665
1170 Ga0451807_2453357
1171 Ga0450893_0014556
1172 Ga0451577_0000013
1173 Ga0451577_0002234
1174 Ga0451577_0005927
1175 Ga0451577_0011417
1176 Ga0451577_0016377
1177 Ga0451577_0028436
1178 Ga0451577_0029084
1179 Ga0451577_0037008
1180 Ga0451577_0069590
1181 Ga0451577_0330441
1182 Ga0451577_0435594
1183 Ga0451577_0515492
1184 Ga0466969_0019480
1185 Ga0453683_0000033
1186 Ga0453683_0139796
1187 Ga0453683_0224817
1188 Ga0466965_0050119
1189 Ga0466965_0075732
1190 Ga0466966_0012298
1191 Ga0466966_0301813
1192 Ga0466961_0001479
1193 Ga0453684_0000029
1194 Ga0453684_0000085
1195 Ga0453684_0000566
1196 Ga0453684_0000716
1197 Ga0453684_0016608
1198 Ga0453684_0027030
1199 Ga0453684_0053042
1200 Ga0453684_0227503
1201 Ga0453684_0460034
1202 Ga0466970_0184055
1203 Ga0466959_0100117
1204 Ga0451576_0000013
1205 Ga0451576_0000018
1206 Ga0451576_0000239
1207 Ga0451576_0000304
1208 Ga0451576_0001273
1209 Ga0451576_0002171
1210 Ga0451576_0007226
1211 Ga0451576_0007845
1212 Ga0451576_0045277
1213 Ga0451576_0068892
1214 Ga0451576_0069101
1215 Ga0451576_0074732
1216 Ga0451576_0174899
1217 Ga0451576_0206543
1218 Ga0495592_0060625
1219 Ga0495603_0021451
1220 Ga0495590_0062683
1221 Ga0495580_0005667
1222 Ga0495639_0009273
1223 Ga0495662_0021375
1224 Ga0495662_0069247
1225 Ga0495585_0157014
1226 Ga0495594_0057653
1227 Ga0495618_0210793
1228 Ga0495628_0157959
1229 Ga0495630_0030648
1230 Ga0495644_0010277
1231 Ga0495654_0007358
1232 Ga0495665_0017033
1233 Ga0495640_0041479
1234 Ga0495640_0047071
1235 Ga0495586_0065890
1236 Ga0495598_0017817
1237 Ga0495621_0037003
1238 Ga0495645_0323513
1239 Ga0495633_0000217
1240 Ga0495667_0098397
1241 Ga0495634_0049960
1242 Ga0495635_0100691
1243 Ga0495588_0009412
1244 Ga0495658_0002070
1245 Ga0495670_0007197
1246 Ga0495660_0034060
1247 Ga0495581_0170906
1248 Ga0495604_0204077
1249 Ga0495636_0093633
1250 Ga0495672_0000019
1251 Ga0495676_0105778
1252 Ga0495680_0006240
1253 Ga0495675_0188721
1254 Ga0495684_0059487
1255 Ga0495626_0045230
1256 Ga0496102_0000153
1257 Ga0496106_0083735
1258 Ga0496107_0199271
1259 Ga0496111_0106341
1260 Ga0496114_0049170
1261 Ga0496116_0003977
1262 Ga0496117_0000075
1263 Ga0496118_0000055
1264 Ga0496121_0007383
1265 Ga0496121_0015398
1266 Ga0496122_0003176
1267 Ga0496123_0013248
1268 Ga0496125_0016477
1269 Ga0495682_0002063
1270 Ga0501296_013143
1271 Ga0501031_0308404
1272 Ga0501032_0081252
1273 Ga0501032_0152593
1274 Ga0501033_0206738
1275 Ga0501034_0009604
1276 Ga0501034_0095003
1277 Ga0501034_0220647
1278 Ga0501036_0017457
1279 Ga0501036_0045415
1280 Ga0501036_0159250
1281 Ga0501037_0108029
1282 Ga0501038_0069601
1283 Ga0501038_0079533
1284 Ga0501038_0163833
1285 Ga0501038_0272714
1286 Ga0501039_0008574
1287 Ga0501039_0086986
1288 Ga0501039_0185892
1289 Ga0501039_0216572
1290 Ga0501040_0028188
1291 Ga0501040_0059132
1292 Ga0501040_0067239
1293 Ga0501040_0237231
1294 Ga0501041_0006157
1295 Ga0501041_0029109
1296 Ga0501041_0066374
1297 Ga0501041_0137599
1298 Ga0501042_0036271
1299 Ga0501042_0069586
1300 Ga0501043_0024358
1301 Ga0501043_0354068
1302 Ga0501046_0281359
1303 Ga0501048_0068303
1304 Ga0501048_0117918
1305 Ga0501068_0173139
1306 Ga0501071_0007935
1307 Ga0501071_0147653
1308 Ga0501071_0433211
1309 Ga0501072_0003599
1310 Ga0501072_0048231
1311 Ga0501072_0055196
1312 Ga0501073_0028094
1313 Ga0501073_0047990
1314 Ga0501074_0108535
1315 Ga0501075_0034726
1316 Ga0501075_0087063
1317 Ga0501076_0025656
1318 Ga0501076_0044858
1319 Ga0501076_0106193
1320 Ga0501077_0019311
1321 Ga0501077_0030974
1322 Ga0501229_015608
1323 Ga0501079_0003787
1324 Ga0501079_0006139
1325 Ga0501079_0006509
1326 Ga0501079_0123542
1327 Ga0501080_0003624
1328 Ga0501080_0170680
1329 Ga0501081_0001437
1330 Ga0501081_0003105
1331 Ga0501081_0005607
1332 Ga0501081_0051549
1333 Ga0501083_0116506
1334 Ga0501280_005038
1335 Ga0501044_0092683
1336 Ga0501045_0003648
1337 Ga0501045_0011731
1338 nmdc:mga0k408_2747_c2
1339 nmdc:mga0k408_77223_c1
1340 nmdc:mga0k408_97050_c1
1341 nmdc:mga09592_245520_c1
1342 nmdc:mga09592_30451_c1
1343 nmdc:mga09592_74755_c1
1344 nmdc:mga0qj67_205079_c1
1345 nmdc:mga0qj67_23747_c1
1346 nmdc:mga0qj67_27513_c1
1347 nmdc:mga06r32_18489_c1
1348 nmdc:mga06r32_194175_c1
1349 nmdc:mga06r32_259775_c1
1350 nmdc:mga06r32_341350_c1
1351 nmdc:mga08y16_11634_c1
1352 nmdc:mga08y16_120338_c1
1353 nmdc:mga08y16_2559_c1
1354 nmdc:mga08y16_266245_c1
1355 nmdc:mga08y16_45084_c1
1356 nmdc:mga08y16_93171_c1
1357 nmdc:mga0n895_116008_c1
1358 nmdc:mga0n895_32773_c1
1359 nmdc:mga0n895_6480_c1
1360 nmdc:mga0n895_96410_c1
1361 nmdc:mga0rr50_11221_c1
1362 nmdc:mga0rr50_147081_c1
1363 nmdc:mga0rr50_244317_c1
1364 nmdc:mga0rr50_62755_c1
1365 nmdc:mga0rr50_68783_c1
1366 nmdc:mga0rr50_920_c1
1367 nmdc:mga08x19_252_c1
1368 nmdc:mga08x19_9008_c1
1369 nmdc:mga0a205_2056_c1
1370 nmdc:mga0a205_347720_c1
1371 nmdc:mga0a205_41263_c1
1372 nmdc:mga0a205_445984_c1
1373 nmdc:mga0a205_49685_c1
1374 Ga0495601_0183575
1375 Ga0500636_0000097
1376 Ga0500637_0114454
1377 Ga0500625_089849
1378 Ga0501084_0062462
1379 Ga0501084_0140576
1380 Ga0501084_0167718
1381 Ga0587111_0020664
1382 Ga0501082_0000750
1383 Ga0501082_0002423
1384 Ga0501082_0037631
1385 Ga0466962_0104806
1386 Ga0530510_0001760
1387 Ga0530510_0003772
1388 Ga0530510_0036944
1389 2601666870
1390 2644027002

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

74

223

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9449 3 225
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9412 4 242
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.941 3 242
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9403 3 242
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9401 5 250
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9739 1 247 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.97 1 247 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9594 4 225 3.40.50.300
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.955 3 218 3.40.50.300
af_P16678_3_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9487 3 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A136NR57-F1-model_v4 ABC transporter-like protein 0.9715 22 242 GO:0005524
GO:0016887
AF-A0A7X5JAR2-F1-model_v4 ATP-binding cassette domain-containing protein 0.9672 42 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A4V2YIE4-F1-model_v4 ATP-binding cassette domain-containing protein 0.965 3 229 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A248LAI4-F1-model_v4 Cell division ATP-binding protein FtsE 0.963 5 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A6G9YJ44-F1-model_v4 ATP-binding cassette domain-containing protein 0.9628 3 229 GO:0005524
GO:0012505
GO:0016887
GO:0043215
GO:0046677
GO:1900753

Map