F475683

General Info

Members Datasets Scaffolds Average Seq Length
693 347 1386 144

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_6642_c1|nmdc:mga08x19_6642_c1_4071_4556
Length 161
Sequence MLQLSDGDLSMKRTYSPKLAEIEHRWFVVDAAVVPLGRLSTLVAHLLMGKHKPTWAPHIDVGDFVIVVNAEKAVLTGRKEDQKMYHRHSGYPGGLKSVTAGQMRQRRPTKLVEEAVRGMLPKSKLGRQLARKLKVYAGPEHPHQAQQPTPLNPADAAQASA

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
191 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
221 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
222 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
223 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
229 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
329 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
344 2643221553 Microbacterium sp. Root553 Isolate Unclassified
345 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
346 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
347 2773857933 Frankia sp. BMG5.30 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.5
Metatranscriptomes 6.93
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0.14
Rhizoplane 3.03
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_6642_c1 3300050514 Bacteria 6862
2 JGI24034J26672_10081659 3300002239 Bacteria 591
3 rootH2_10021145 3300003320 Bacteria 6684
4 rootH2_10080382 3300003320 Bacteria 1106
5 rootL2_10015203 3300003322 Bacteria 2099
6 Ga0058858_1410928 3300004785 Bacteria 760
7 Ga0058859_11553821 3300004798 Bacteria 868
8 Ga0058863_11594059 3300004799 Bacteria 792
9 Ga0058861_11268347 3300004800 Bacteria 754
10 Ga0058862_12433139 3300004803 Bacteria 881
11 Ga0058862_12851463 3300004803 Bacteria 1474
12 Ga0065714_10138911 3300005288 Bacteria 1187
13 Ga0065704_10308306 3300005289 Unclassified 873
14 Ga0065707_10215047 3300005295 Bacteria 1248
15 Ga0070658_10000006 3300005327 Bacteria 374835
16 Ga0070658_10007225 3300005327 Bacteria 8964
17 Ga0070658_10038379 3300005327 Bacteria 3862
18 Ga0070658_10039592 3300005327 Bacteria 3802
19 Ga0070658_10134911 3300005327 Bacteria 2058
20 Ga0070658_10137527 3300005327 Bacteria 2039
21 Ga0070658_10232851 3300005327 Bacteria 1560
22 Ga0070658_10398281 3300005327 Bacteria 1182
23 Ga0070683_100009432 3300005329 Bacteria 8347
24 Ga0070683_100288005 3300005329 Bacteria 1562
25 Ga0070690_100365598 3300005330 Bacteria 1051
26 Ga0070670_100334747 3300005331 Bacteria 1328
27 Ga0070666_10030165 3300005335 Bacteria 3571
28 Ga0070666_10127318 3300005335 Bacteria 1768
29 Ga0070680_100108365 3300005336 Bacteria 2311
30 Ga0070680_100651889 3300005336 Bacteria 905
31 Ga0070682_100373030 3300005337 Bacteria 1071
32 Ga0068868_100825760 3300005338 Bacteria 838
33 Ga0070660_100002152 3300005339 Bacteria 13591
34 Ga0070660_100013713 3300005339 Bacteria 5826
35 Ga0070660_100028144 3300005339 Bacteria 4203
36 Ga0070660_100087764 3300005339 Bacteria 2448
37 Ga0070660_100134075 3300005339 Bacteria 1984
38 Ga0070689_100144210 3300005340 Bacteria 1917
39 Ga0070691_10170258 3300005341 Bacteria 1128
40 Ga0070687_100555500 3300005343 Bacteria 782
41 Ga0070661_100116121 3300005344 Bacteria 2002
42 Ga0070661_100222700 3300005344 Bacteria 1448
43 Ga0070669_100000164 3300005353 Bacteria 58203
44 Ga0070675_100383110 3300005354 Bacteria 1252
45 Ga0070675_100672476 3300005354 Bacteria 942
46 Ga0070671_100001020 3300005355 Bacteria 20592
47 Ga0070673_100020375 3300005364 Bacteria 4783
48 Ga0070673_100223203 3300005364 Bacteria 1632
49 Ga0070673_102027871 3300005364 Bacteria 546
50 Ga0070688_100061220 3300005365 Bacteria 2379
51 Ga0070688_100350705 3300005365 Bacteria 1080
52 Ga0070659_100010337 3300005366 Bacteria 6864
53 Ga0070659_100292248 3300005366 Bacteria 1357
54 Ga0070659_101142249 3300005366 Bacteria 687
55 Ga0070667_100874256 3300005367 Bacteria 836
56 Ga0070709_10272640 3300005434 Bacteria 1227
57 Ga0070709_10281533 3300005434 Bacteria 1209
58 Ga0070714_100270392 3300005435 Bacteria 1576
59 Ga0070713_101251718 3300005436 Bacteria 719
60 Ga0070713_101268654 3300005436 Bacteria 714
61 Ga0070710_10232429 3300005437 Bacteria 1178
62 Ga0070701_10292922 3300005438 Bacteria 998
63 Ga0070705_100252361 3300005440 Bacteria 1239
64 Ga0070705_100793432 3300005440 Bacteria 753
65 Ga0070700_100170164 3300005441 Bacteria 1508
66 Ga0070694_100155421 3300005444 Bacteria 1674
67 Ga0070663_100013088 3300005455 Bacteria 5272
68 Ga0070663_100046729 3300005455 Bacteria 3064
69 Ga0070663_100079185 3300005455 Bacteria 2410
70 Ga0070663_100179349 3300005455 Bacteria 1642
71 Ga0070663_100318968 3300005455 Bacteria 1249
72 Ga0070681_10093860 3300005458 Bacteria 2950
73 Ga0070681_10198698 3300005458 Bacteria 1924
74 Ga0070681_10334243 3300005458 Bacteria 1424
75 Ga0070681_10399810 3300005458 Bacteria 1285
76 Ga0070681_10826020 3300005458 Bacteria 844
77 Ga0068867_100791107 3300005459 Bacteria 845
78 Ga0068867_101786507 3300005459 Bacteria 578
79 Ga0070698_100551473 3300005471 Bacteria 1092
80 Ga0070679_100000607 3300005530 Bacteria 30473
81 Ga0070679_100006064 3300005530 Bacteria 11247
82 Ga0070679_100024592 3300005530 Bacteria 5905
83 Ga0070679_100059401 3300005530 Bacteria 3811
84 Ga0070684_100005900 3300005535 Bacteria 9431
85 Ga0070684_100110235 3300005535 Bacteria 2467
86 Ga0070684_100591579 3300005535 Bacteria 1031
87 Ga0068853_100000174 3300005539 Bacteria 44771
88 Ga0068853_100044099 3300005539 Bacteria 3818
89 Ga0068853_100058163 3300005539 Bacteria 3337
90 Ga0068853_100841656 3300005539 Bacteria 880
91 Ga0068853_102204399 3300005539 Bacteria 534
92 Ga0070672_100240086 3300005543 Bacteria 1524
93 Ga0070672_100727709 3300005543 Bacteria 870
94 Ga0070686_100078006 3300005544 Bacteria 2186
95 Ga0070686_100313514 3300005544 Bacteria 1167
96 Ga0070665_100000280 3300005548 Bacteria 83526
97 Ga0070665_100004995 3300005548 Bacteria 13757
98 Ga0070704_100023634 3300005549 Bacteria 4020
99 Ga0070704_100578349 3300005549 Bacteria 985
100 Ga0068855_100007178 3300005563 Bacteria 13520
101 Ga0068855_100154131 3300005563 Bacteria 2611
102 Ga0068855_100174182 3300005563 Bacteria 2435
103 Ga0068855_100291926 3300005563 Bacteria 1807
104 Ga0068855_100301722 3300005563 Bacteria 1773
105 Ga0070664_100057304 3300005564 Bacteria 3312
106 Ga0070664_100299054 3300005564 Bacteria 1454
107 Ga0070664_100748375 3300005564 Bacteria 912
108 Ga0068857_100017675 3300005577 Bacteria 6254
109 Ga0068857_100052519 3300005577 Bacteria 3616
110 Ga0068854_100000186 3300005578 Bacteria 41742
111 Ga0068854_100218723 3300005578 Bacteria 1506
112 Ga0068854_100473915 3300005578 Bacteria 1050
113 Ga0068854_101619604 3300005578 Bacteria 590
114 Ga0068856_100013051 3300005614 Bacteria 8047
115 Ga0068856_100850196 3300005614 Bacteria 932
116 Ga0068852_100042793 3300005616 Bacteria 3836
117 Ga0068852_100064951 3300005616 Bacteria 3183
118 Ga0068852_100128851 3300005616 Bacteria 2327
119 Ga0068859_100018092 3300005617 Bacteria 7082
120 Ga0068864_100009360 3300005618 Bacteria 8083
121 Ga0068864_100090822 3300005618 Bacteria 2693
122 Ga0068861_100326568 3300005719 Bacteria 1338
123 Ga0068870_10501858 3300005840 Bacteria 809
124 Ga0068863_100004076 3300005841 Bacteria 14431
125 Ga0068858_100570505 3300005842 Bacteria 1096
126 Ga0068860_100481533 3300005843 Bacteria 1237
127 Ga0068860_101084191 3300005843 Bacteria 820
128 Ga0070717_10001558 3300006028 Bacteria 15887
129 Ga0070717_10404308 3300006028 Bacteria 1227
130 Ga0075368_10012903 3300006042 Bacteria 3061
131 Ga0075364_10128675 3300006051 Bacteria 1699
132 Ga0070715_10404038 3300006163 Bacteria 760
133 Ga0070715_10432069 3300006163 Bacteria 739
134 Ga0075367_10110568 3300006178 Bacteria 1686
135 Ga0075369_10004944 3300006186 Bacteria 4958
136 Ga0097621_100000066 3300006237 Bacteria 54619
137 Ga0097621_100662576 3300006237 Bacteria 958
138 Ga0068871_100000170 3300006358 Bacteria 43522
139 Ga0068871_100346660 3300006358 Bacteria 1313
140 Ga0075428_100025549 3300006844 Bacteria 6539
141 Ga0075428_100188315 3300006844 Bacteria 2232
142 Ga0075433_10006367 3300006852 Bacteria 9334
143 Ga0075433_10076442 3300006852 Bacteria 2948
144 Ga0075434_100000005 3300006871 Bacteria 104425
145 Ga0075434_100051793 3300006871 Bacteria 4079
146 Ga0075434_100110513 3300006871 Bacteria 2759
147 Ga0075434_100134374 3300006871 Bacteria 2493
148 Ga0075434_100287013 3300006871 Bacteria 1665
149 Ga0075429_100013415 3300006880 Bacteria 7106
150 Ga0068865_100316941 3300006881 Bacteria 1253
151 Ga0075436_100007285 3300006914 Bacteria 7566
152 Ga0075436_100019506 3300006914 Bacteria 4647
153 Ga0097620_100018092 3300006931 Bacteria 7082
154 Ga0075435_100024980 3300007076 Bacteria 4645
155 Ga0075435_100032075 3300007076 Bacteria 4147
156 Ga0075435_100286507 3300007076 Bacteria 1407
157 Ga0105244_10053379 3300009036 Bacteria 2054
158 Ga0105240_10000001 3300009093 Bacteria 2887840
159 Ga0105240_10018617 3300009093 Bacteria 9311
160 Ga0105240_10094503 3300009093 Bacteria 3646
161 Ga0105240_10108808 3300009093 Bacteria 3357
162 Ga0105240_10152842 3300009093 Bacteria 2747
163 Ga0105240_10411545 3300009093 Bacteria 1521
164 Ga0105240_10483312 3300009093 Bacteria 1380
165 Ga0105240_11213535 3300009093 Bacteria 798
166 Ga0111539_10102893 3300009094 Bacteria 3352
167 Ga0111539_10949297 3300009094 Bacteria 1000
168 Ga0105245_10006935 3300009098 Bacteria 9931
169 Ga0105247_10207684 3300009101 Bacteria 1319
170 Ga0114129_10104725 3300009147 Bacteria 3910
171 Ga0114129_10271377 3300009147 Bacteria 2269
172 Ga0114129_10331348 3300009147 Bacteria 2021
173 Ga0105241_10316100 3300009174 Bacteria 1345
174 Ga0105248_10256222 3300009177 Bacteria 1970
175 Ga0105248_10347645 3300009177 Bacteria 1669
176 Ga0105248_10604239 3300009177 Bacteria 1238
177 Ga0105237_10068357 3300009545 Bacteria 3546
178 Ga0105237_10328505 3300009545 Bacteria 1533
179 Ga0105237_11438114 3300009545 Bacteria 696
180 Ga0105238_10005301 3300009551 Bacteria 12738
181 Ga0105238_10122060 3300009551 Bacteria 2585
182 Ga0105238_10320094 3300009551 Bacteria 1537
183 Ga0105249_10100341 3300009553 Bacteria 2722
184 Ga0105249_10163025 3300009553 Bacteria 2156
185 Ga0105249_11136780 3300009553 Bacteria 851
186 Ga0105239_10669784 3300010375 Bacteria 1185
187 Ga0157373_10454492 3300013100 Bacteria 922
188 Ga0157371_10007064 3300013102 Bacteria 9136
189 Ga0157371_10135608 3300013102 Bacteria 1753
190 Ga0157371_10174405 3300013102 Bacteria 1537
191 Ga0157371_10301745 3300013102 Bacteria 1159
192 Ga0157370_10012273 3300013104 Bacteria 8893
193 Ga0157370_10051672 3300013104 Bacteria 3926
194 Ga0157370_10103328 3300013104 Bacteria 2667
195 Ga0157370_10113995 3300013104 Bacteria 2526
196 Ga0157370_10188281 3300013104 Bacteria 1916
197 Ga0157370_10391993 3300013104 Bacteria 1279
198 Ga0157370_10758244 3300013104 Bacteria 884
199 Ga0157370_11074699 3300013104 Bacteria 727
200 Ga0157370_11457419 3300013104 Bacteria 616
201 Ga0157369_10013690 3300013105 Bacteria 9170
202 Ga0157369_10036291 3300013105 Bacteria 5402
203 Ga0157369_10068261 3300013105 Bacteria 3819
204 Ga0157369_10075191 3300013105 Bacteria 3622
205 Ga0157369_10116262 3300013105 Bacteria 2840
206 Ga0157369_10228469 3300013105 Bacteria 1946
207 Ga0157369_10359774 3300013105 Bacteria 1511
208 Ga0157369_10469038 3300013105 Bacteria 1303
209 Ga0157369_10510624 3300013105 Bacteria 1243
210 Ga0157369_10793528 3300013105 Unclassified 973
211 Ga0157369_11710280 3300013105 Bacteria 639
212 Ga0157374_10088179 3300013296 Bacteria 2955
213 Ga0157374_10104913 3300013296 Bacteria 2714
214 Ga0157374_10168865 3300013296 Bacteria 2133
215 Ga0157374_10271103 3300013296 Bacteria 1673
216 Ga0157374_11177568 3300013296 Bacteria 788
217 Ga0157378_10358353 3300013297 Bacteria 1427
218 Ga0157378_10961232 3300013297 Bacteria 887
219 Ga0163162_10007900 3300013306 Bacteria 10367
220 Ga0163162_10876899 3300013306 Bacteria 1011
221 Ga0157372_10005308 3300013307 Bacteria 13687
222 Ga0157372_10040606 3300013307 Bacteria 5139
223 Ga0157372_10096540 3300013307 Bacteria 3369
224 Ga0157372_10096633 3300013307 Bacteria 3367
225 Ga0157372_10169742 3300013307 Bacteria 2524
226 Ga0157372_10273045 3300013307 Bacteria 1965
227 Ga0157372_10691043 3300013307 Bacteria 1187
228 Ga0157372_11497160 3300013307 Bacteria 777
229 Ga0157375_10059475 3300013308 Bacteria 3786
230 Ga0157375_11577136 3300013308 Bacteria 776
231 Ga0163163_10003334 3300014325 Bacteria 13627
232 Ga0163163_10762424 3300014325 Bacteria 1031
233 Ga0157380_10004468 3300014326 Bacteria 9690
234 Ga0157380_10435330 3300014326 Bacteria 1255
235 Ga0157377_10646896 3300014745 Bacteria 760
236 Ga0157379_10094694 3300014968 Bacteria 2680
237 Ga0157379_10182718 3300014968 Bacteria 1895
238 Ga0157379_11921050 3300014968 Bacteria 584
239 Ga0157376_10156139 3300014969 Bacteria 2063
240 Ga0157376_10199452 3300014969 Bacteria 1840
241 Ga0157376_10519561 3300014969 Bacteria 1173
242 Ga0184595_107919 3300019166 Bacteria 769
243 Ga0184595_123911 3300019166 Bacteria 533
244 Ga0197907_10738779 3300020069 Bacteria 679
245 Ga0197907_11223624 3300020069 Bacteria 1765
246 Ga0206356_11110856 3300020070 Bacteria 2257
247 Ga0206356_11659320 3300020070 Bacteria 815
248 Ga0206349_1877071 3300020075 Bacteria 923
249 Ga0206355_1388814 3300020076 Bacteria 2191
250 Ga0206355_1537879 3300020076 Bacteria 647
251 Ga0206355_1618829 3300020076 Bacteria 1504
252 Ga0206351_10677131 3300020077 Bacteria 1293
253 Ga0206352_10308703 3300020078 Bacteria 1181
254 Ga0206352_10599768 3300020078 Bacteria 1047
255 Ga0206352_11016995 3300020078 Bacteria 1759
256 Ga0206350_11323274 3300020080 Bacteria 2180
257 Ga0206354_11100117 3300020081 Bacteria 910
258 Ga0206354_11456630 3300020081 Bacteria 1594
259 Ga0206353_11159178 3300020082 Bacteria 1439
260 Ga0154015_1134506 3300020610 Bacteria 1841
261 Ga0224712_10029435 3300022467 Bacteria 1972
262 Ga0224712_10172953 3300022467 Unclassified 969
263 Ga0224712_10195201 3300022467 Bacteria 918
264 Ga0247553_100730 3300023672 Bacteria 1267
265 Ga0207692_10212724 3300025898 Bacteria 1142
266 Ga0207680_10414009 3300025903 Bacteria 954
267 Ga0207647_10032975 3300025904 Bacteria 3321
268 Ga0207647_10177104 3300025904 Bacteria 1240
269 Ga0207699_10228473 3300025906 Bacteria 1274
270 Ga0207645_10013115 3300025907 Bacteria 5599
271 Ga0207643_10285319 3300025908 Bacteria 1024
272 Ga0207705_10000012 3300025909 Bacteria 472336
273 Ga0207705_10001912 3300025909 Bacteria 16281
274 Ga0207705_10002156 3300025909 Bacteria 15252
275 Ga0207705_10010724 3300025909 Bacteria 6653
276 Ga0207705_10019852 3300025909 Bacteria 4807
277 Ga0207705_10076147 3300025909 Bacteria 2439
278 Ga0207705_10146373 3300025909 Bacteria 1768
279 Ga0207705_10151788 3300025909 Bacteria 1736
280 Ga0207705_10186418 3300025909 Bacteria 1567
281 Ga0207654_10273656 3300025911 Bacteria 1140
282 Ga0207707_10023728 3300025912 Bacteria 5365
283 Ga0207707_10065953 3300025912 Bacteria 3152
284 Ga0207707_10068125 3300025912 Bacteria 3100
285 Ga0207695_10000001 3300025913 Bacteria 2888630
286 Ga0207695_10008216 3300025913 Bacteria 13110
287 Ga0207695_10084834 3300025913 Bacteria 3197
288 Ga0207695_10129252 3300025913 Bacteria 2485
289 Ga0207695_10192236 3300025913 Bacteria 1958
290 Ga0207695_10234786 3300025913 Bacteria 1737
291 Ga0207695_10542425 3300025913 Bacteria 1044
292 Ga0207671_11494245 3300025914 Bacteria 522
293 Ga0207693_10252561 3300025915 Bacteria 1383
294 Ga0207660_10015830 3300025917 Bacteria 4984
295 Ga0207662_10555980 3300025918 Bacteria 795
296 Ga0207657_10001507 3300025919 Bacteria 24916
297 Ga0207657_10008653 3300025919 Bacteria 10304
298 Ga0207657_10017115 3300025919 Bacteria 6967
299 Ga0207657_10026932 3300025919 Bacteria 5272
300 Ga0207657_10194237 3300025919 Bacteria 1636
301 Ga0207657_10394359 3300025919 Bacteria 1089
302 Ga0207649_10037830 3300025920 Bacteria 2917
303 Ga0207649_10112141 3300025920 Bacteria 1824
304 Ga0207649_11410316 3300025920 Bacteria 551
305 Ga0207652_10011368 3300025921 Bacteria 7173
306 Ga0207652_10105438 3300025921 Bacteria 2494
307 Ga0207652_10127248 3300025921 Bacteria 2270
308 Ga0207681_10000056 3300025923 Bacteria 106145
309 Ga0207681_10289314 3300025923 Bacteria 1293
310 Ga0207694_10007162 3300025924 Bacteria 8474
311 Ga0207694_10177219 3300025924 Bacteria 1727
312 Ga0207694_10183553 3300025924 Bacteria 1697
313 Ga0207650_10030159 3300025925 Bacteria 3904
314 Ga0207687_10391695 3300025927 Bacteria 1141
315 Ga0207700_10295694 3300025928 Bacteria 1397
316 Ga0207700_10736688 3300025928 Bacteria 881
317 Ga0207664_10256876 3300025929 Bacteria 1527
318 Ga0207664_10260763 3300025929 Bacteria 1516
319 Ga0207644_10030504 3300025931 Bacteria 3750
320 Ga0207690_10002265 3300025932 Bacteria 11729
321 Ga0207690_10030551 3300025932 Bacteria 3438
322 Ga0207690_10119581 3300025932 Bacteria 1911
323 Ga0207706_10064861 3300025933 Bacteria 3216
324 Ga0207686_11015805 3300025934 Bacteria 673
325 Ga0207670_10033206 3300025936 Bacteria 3324
326 Ga0207704_11529824 3300025938 Bacteria 573
327 Ga0207711_10062364 3300025941 Bacteria 3216
328 Ga0207711_10077219 3300025941 Bacteria 2902
329 Ga0207711_10165572 3300025941 Bacteria 2004
330 Ga0207711_10290489 3300025941 Bacteria 1507
331 Ga0207689_10061204 3300025942 Bacteria 3095
332 Ga0207661_10207245 3300025944 Bacteria 1726
333 Ga0207679_10015483 3300025945 Bacteria 5041
334 Ga0207679_10683648 3300025945 Bacteria 930
335 Ga0207667_10009317 3300025949 Bacteria 11579
336 Ga0207667_10016157 3300025949 Bacteria 8440
337 Ga0207667_10032870 3300025949 Bacteria 5584
338 Ga0207667_10050332 3300025949 Bacteria 4396
339 Ga0207667_10088266 3300025949 Bacteria 3207
340 Ga0207667_10281503 3300025949 Bacteria 1699
341 Ga0207667_10579575 3300025949 Bacteria 1133
342 Ga0207667_11381590 3300025949 Bacteria 678
343 Ga0207651_10006568 3300025960 Bacteria 6109
344 Ga0207651_10191582 3300025960 Bacteria 1631
345 Ga0207712_10146032 3300025961 Bacteria 1821
346 Ga0207640_10000034 3300025981 Bacteria 112705
347 Ga0207658_10388602 3300025986 Bacteria 1224
348 Ga0207703_10291778 3300026035 Bacteria 1485
349 Ga0207703_10494871 3300026035 Bacteria 1147
350 Ga0207639_10000115 3300026041 Bacteria 62079
351 Ga0207639_10148947 3300026041 Bacteria 1958
352 Ga0207639_10203754 3300026041 Bacteria 1699
353 Ga0207639_11272835 3300026041 Bacteria 690
354 Ga0207678_10003556 3300026067 Bacteria 14017
355 Ga0207678_10014956 3300026067 Bacteria 6828
356 Ga0207678_10021612 3300026067 Bacteria 5642
357 Ga0207678_10324846 3300026067 Bacteria 1324
358 Ga0207678_11091962 3300026067 Bacteria 706
359 Ga0207708_10176959 3300026075 Bacteria 1692
360 Ga0207708_10676469 3300026075 Bacteria 880
361 Ga0207702_11261545 3300026078 Bacteria 733
362 Ga0207641_10175274 3300026088 Bacteria 1960
363 Ga0207648_11406470 3300026089 Bacteria 656
364 Ga0207676_10154705 3300026095 Bacteria 1979
365 Ga0207676_10160989 3300026095 Bacteria 1944
366 Ga0207674_10005050 3300026116 Bacteria 15749
367 Ga0207674_10352580 3300026116 Bacteria 1422
368 Ga0207674_10398592 3300026116 Bacteria 1330
369 Ga0207674_10398721 3300026116 Bacteria 1330
370 Ga0207675_100095349 3300026118 Bacteria 2799
371 Ga0207675_100640564 3300026118 Bacteria 1068
372 Ga0207683_10375192 3300026121 Bacteria 1307
373 Ga0207698_10114764 3300026142 Bacteria 2266
374 Ga0207698_10128602 3300026142 Bacteria 2160
375 Ga0207698_10961420 3300026142 Bacteria 863
376 Ga0207428_10022079 3300027907 Bacteria 5375
377 Ga0268266_10001178 3300028379 Bacteria 32300
378 Ga0265334_10236899 3300028573 Bacteria 630
379 Ga0265318_10182820 3300028577 Bacteria 768
380 Ga0265338_10001506 3300028800 Bacteria 37692
381 Ga0265338_10114840 3300028800 Bacteria 2160
382 Ga0265338_10176577 3300028800 Bacteria 1632
383 Ga0265338_10364403 3300028800 Bacteria 1036
384 Ga0265338_10763906 3300028800 Bacteria 664
385 Ga0265766_1009802 3300030863 Bacteria 675
386 Ga0265770_1029075 3300030878 Bacteria 916
387 Ga0265776_113917 3300030880 Bacteria 503
388 Ga0265761_103554 3300030889 Bacteria 769
389 Ga0265773_1015382 3300031018 Bacteria 704
390 Ga0265760_10048872 3300031090 Bacteria 1271
391 Ga0265330_10000495 3300031235 Bacteria 26302
392 Ga0265330_10018712 3300031235 Bacteria 3178
393 Ga0265330_10043868 3300031235 Bacteria 1977
394 Ga0265330_10060824 3300031235 Bacteria 1643
395 Ga0265332_10015779 3300031238 Bacteria 3335
396 Ga0265328_10029018 3300031239 Bacteria 2068
397 Ga0265328_10127024 3300031239 Bacteria 953
398 Ga0265325_10000217 3300031241 Bacteria 40450
399 Ga0265325_10056567 3300031241 Bacteria 2003
400 Ga0265340_10084518 3300031247 Bacteria 1490
401 Ga0265340_10355290 3300031247 Bacteria 647
402 Ga0265339_10000162 3300031249 Bacteria 55877
403 Ga0265339_10025263 3300031249 Bacteria 3411
404 Ga0265339_10036580 3300031249 Bacteria 2747
405 Ga0265339_10048735 3300031249 Bacteria 2322
406 Ga0265316_10000473 3300031344 Bacteria 45865
407 Ga0265316_10006109 3300031344 Bacteria 11553
408 Ga0265316_10013958 3300031344 Bacteria 7104
409 Ga0265316_10019813 3300031344 Bacteria 5745
410 Ga0265316_10192589 3300031344 Bacteria 1514
411 Ga0265316_10206774 3300031344 Bacteria 1453
412 Ga0265316_10279296 3300031344 Bacteria 1220
413 Ga0265313_10006715 3300031595 Bacteria 8055
414 Ga0265313_10133138 3300031595 Bacteria 1075
415 Ga0307508_10057810 3300031616 Bacteria 3432
416 Ga0316575_10172676 3300031665 Unclassified 896
417 Ga0316579_10142788 3300031691 Bacteria 1154
418 Ga0265314_10008015 3300031711 Bacteria 9109
419 Ga0265314_10081677 3300031711 Bacteria 2129
420 Ga0265314_10310105 3300031711 Bacteria 882
421 Ga0265342_10001956 3300031712 Bacteria 18426
422 Ga0265342_10006040 3300031712 Bacteria 9091
423 Ga0265342_10013479 3300031712 Bacteria 5480
424 Ga0265342_10041032 3300031712 Bacteria 2804
425 Ga0316577_10003396 3300031733 Bacteria 8034
426 Ga0307413_10124163 3300031824 Bacteria 1754
427 Ga0307413_10963183 3300031824 Unclassified 729
428 Ga0307410_10007104 3300031852 Bacteria 6107
429 Ga0307412_10004388 3300031911 Bacteria 7864
430 Ga0307409_100284493 3300031995 Bacteria 1530
431 Ga0307416_101899730 3300032002 Bacteria 699
432 Ga0307411_10378352 3300032005 Bacteria 1164
433 Ga0307411_11637534 3300032005 Bacteria 594
434 Ga0316053_100943 3300032120 Bacteria 1447
435 Ga0316053_103404 3300032120 Bacteria 942
436 Ga0307415_100010404 3300032126 Bacteria 5269
437 Ga0316593_10219597 3300032168 Unclassified 706
438 Ga0373932_0350526 3300035112 Unclassified 561
439 Ga0373939_0206732 3300035114 Unclassified 745
440 Ga0373953_0208508 3300035117 Unclassified 846
441 Ga0373957_0147103 3300035120 Bacteria 966
442 Ga0373961_0000560 3300035241 Bacteria 14051
443 Ga0316574_0001659 3300035398 Bacteria 10721
444 Ga0373935_0002837 3300035692 Bacteria 9969
445 Ga0373933_0813238 3300035724 Bacteria 615
446 Ga0373937_0296828 3300036401 Bacteria 1527
447 Ga0373937_1041203 3300036401 Bacteria 767
448 Ga0265778_001154 3300036457 Bacteria 2333
449 Ga0265778_043637 3300036457 Bacteria 602
450 Ga0316582_0125491 3300036647 Bacteria 1720
451 Ga0316584_0030324 3300036712 Bacteria 3995
452 Ga0395900_0158442 3300037418 Bacteria 2311
453 Ga0316581_0253637 3300037588 Bacteria 540
454 Ga0436364_0422759 3300037853 Bacteria 1306
455 Ga0436363_0738180 3300039450 Bacteria 1152
456 Ga0451790_48433 3300041444 Bacteria 561
457 Ga0451798_0883000 3300041458 Bacteria 818
458 Ga0451804_0024815 3300041463 Bacteria 633
459 Ga0451804_1096986 3300041463 Bacteria 808
460 Ga0451807_0879487 3300041486 Bacteria 909
461 Ga0451839_1488214 3300041496 Bacteria 911
462 Ga0451843_1648800 3300041509 Bacteria 1202
463 Ga0439448_0013651 3300042005 Bacteria 2443
464 Ga0439449_0158714 3300042007 Bacteria 844
465 Ga0439435_0007548 3300042436 Bacteria 2493
466 Ga0439435_0044540 3300042436 Unclassified 1251
467 Ga0439460_0059828 3300042461 Bacteria 1161
468 Ga0451577_0056839 3300042876 Bacteria 3490
469 Ga0466972_0304243 3300044658 Bacteria 745
470 Ga0466961_0262955 3300044693 Bacteria 1058
471 Ga0466963_0305858 3300044694 Bacteria 1118
472 Ga0466963_0555421 3300044694 Bacteria 811
473 Ga0453684_0029003 3300044712 Bacteria 7874
474 Ga0453684_0101505 3300044712 Bacteria 3520
475 Ga0453684_0236687 3300044712 Bacteria 2105
476 Ga0453684_0319714 3300044712 Bacteria 1758
477 Ga0453684_0531820 3300044712 Bacteria 1297
478 Ga0466970_0209447 3300044765 Bacteria 1086
479 Ga0466959_0077224 3300045049 Bacteria 2404
480 Ga0451576_0721965 3300045051 Unclassified 1047
481 Ga0466958_0084898 3300045836 Bacteria 1953
482 Ga0466967_0359443 3300045976 Unclassified 1411
483 Ga0495617_016219 3300046452 Bacteria 2519
484 Ga0495592_0097621 3300046454 Bacteria 2098
485 Ga0495603_0137902 3300046455 Bacteria 1419
486 Ga0495629_0426401 3300046459 Bacteria 900
487 Ga0495650_0000038 3300046471 Bacteria 377530
488 Ga0495580_0036966 3300046472 Bacteria 3505
489 Ga0495580_0169549 3300046472 Bacteria 1509
490 Ga0495584_0123430 3300046491 Bacteria 1312
491 Ga0495585_0050871 3300046492 Bacteria 2297
492 Ga0495594_0007770 3300046499 Bacteria 5515
493 Ga0495596_0058708 3300046500 Bacteria 1500
494 Ga0495583_0022127 3300046506 Bacteria 3252
495 Ga0495606_0021082 3300046507 Bacteria 4781
496 Ga0495608_0433230 3300046511 Bacteria 801
497 Ga0495644_0000044 3300046523 Bacteria 60246
498 Ga0495663_0084669 3300046525 Bacteria 1026
499 Ga0495654_0014677 3300046530 Bacteria 4166
500 Ga0495586_0220041 3300046535 Bacteria 1079
501 Ga0495609_0002185 3300046538 Bacteria 12297
502 Ga0495668_0015530 3300046616 Bacteria 4443
503 Ga0495611_0016130 3300046648 Bacteria 3194
504 Ga0495625_0000580 3300046660 Bacteria 53177
505 Ga0495625_0020612 3300046660 Bacteria 5086
506 Ga0495625_0538152 3300046660 Bacteria 709
507 Ga0495659_0137665 3300046664 Bacteria 972
508 Ga0495588_0096100 3300046674 Bacteria 1554
509 Ga0495623_0203974 3300046679 Bacteria 1135
510 Ga0495658_0201900 3300046683 Bacteria 1239
511 Ga0495658_0349385 3300046683 Bacteria 940
512 Ga0495669_0003780 3300046684 Bacteria 6222
513 Ga0495670_0027481 3300046691 Bacteria 2819
514 Ga0495649_0208212 3300046694 Bacteria 1014
515 Ga0495604_0016650 3300047317 Bacteria 5879
516 Ga0495636_0105372 3300047318 Bacteria 1236
517 Ga0495672_0001831 3300047320 Bacteria 20338
518 Ga0495672_0451019 3300047320 Bacteria 580
519 Ga0495683_0089671 3300047323 Bacteria 1491
520 Ga0495677_0088244 3300047445 Bacteria 1167
521 Ga0495685_043165 3300047447 Bacteria 1539
522 Ga0495684_0620968 3300047471 Bacteria 727
523 Ga0495686_0038629 3300047472 Bacteria 3052
524 Ga0495686_0068800 3300047472 Bacteria 2184
525 Ga0495686_0314621 3300047472 Bacteria 860
526 Ga0495686_0351057 3300047472 Bacteria 802
527 Ga0495615_0041972 3300048090 Bacteria 1145
528 Ga0496100_1342214 3300048903 Bacteria 564
529 Ga0496100_1610996 3300048903 Bacteria 513
530 Ga0496102_0382754 3300048905 Bacteria 1324
531 Ga0496102_1448066 3300048905 Bacteria 606
532 Ga0496104_0247612 3300048907 Bacteria 1695
533 Ga0496104_0445350 3300048907 Bacteria 1207
534 Ga0496104_0607879 3300048907 Bacteria 1003
535 Ga0496104_1286548 3300048907 Bacteria 634
536 Ga0496105_0377580 3300048908 Bacteria 1128
537 Ga0496105_0541996 3300048908 Bacteria 909
538 Ga0496105_1370255 3300048908 Bacteria 513
539 Ga0496107_0466959 3300048910 Bacteria 937
540 Ga0496112_1215692 3300048915 Bacteria 670
541 Ga0496113_1309957 3300048916 Bacteria 563
542 Ga0496114_0000036 3300048917 Bacteria 155622
543 Ga0496114_0032760 3300048917 Bacteria 4280
544 Ga0496118_0311920 3300048921 Bacteria 858
545 Ga0495682_0031856 3300049460 Bacteria 1948
546 Ga0495682_0061520 3300049460 Bacteria 1355
547 Ga0501031_0019586 3300049568 Bacteria 4408
548 Ga0501031_0019878 3300049568 Bacteria 4377
549 Ga0501031_0115005 3300049568 Bacteria 1757
550 Ga0501032_0002284 3300049569 Bacteria 15059
551 Ga0501032_0004677 3300049569 Bacteria 10272
552 Ga0501032_0104806 3300049569 Bacteria 1873
553 Ga0501033_0000659 3300049570 Bacteria 31942
554 Ga0501033_0068252 3300049570 Bacteria 2614
555 Ga0501033_0250407 3300049570 Bacteria 1255
556 Ga0501034_0001806 3300049571 Bacteria 27246
557 Ga0501034_0007673 3300049571 Bacteria 11480
558 Ga0501034_0040371 3300049571 Bacteria 4723
559 Ga0501034_0109776 3300049571 Bacteria 2749
560 Ga0501036_0004803 3300049572 Bacteria 10922
561 Ga0501036_0010731 3300049572 Bacteria 7573
562 Ga0501036_0013962 3300049572 Bacteria 6678
563 Ga0501036_0057492 3300049572 Bacteria 3294
564 Ga0501037_0003317 3300049573 Bacteria 11700
565 Ga0501037_0012094 3300049573 Bacteria 6356
566 Ga0501037_0020889 3300049573 Bacteria 4834
567 Ga0501037_0050021 3300049573 Bacteria 3060
568 Ga0501037_0248386 3300049573 Bacteria 1245
569 Ga0501038_0011623 3300049574 Bacteria 8031
570 Ga0501038_0018000 3300049574 Bacteria 6382
571 Ga0501038_0052727 3300049574 Bacteria 3505
572 Ga0501038_0725129 3300049574 Bacteria 743
573 Ga0501039_0005483 3300049575 Bacteria 9599
574 Ga0501039_0017020 3300049575 Bacteria 5573
575 Ga0501039_0108274 3300049575 Bacteria 2172
576 Ga0501040_0092565 3300049576 Bacteria 2102
577 Ga0501042_0004587 3300049578 Bacteria 8819
578 Ga0501042_0054879 3300049578 Bacteria 2842
579 Ga0501042_0103572 3300049578 Bacteria 2048
580 Ga0501043_0002589 3300049579 Bacteria 15289
581 Ga0501043_0006527 3300049579 Bacteria 9357
582 Ga0501043_0044248 3300049579 Bacteria 3500
583 Ga0501046_0000056 3300049580 Bacteria 129342
584 Ga0501046_0000732 3300049580 Bacteria 31713
585 Ga0501046_0010248 3300049580 Bacteria 8065
586 Ga0501046_0108015 3300049580 Bacteria 2128
587 Ga0501047_0007941 3300049581 Bacteria 10007
588 Ga0501047_0051099 3300049581 Bacteria 3992
589 Ga0501047_0061918 3300049581 Bacteria 3610
590 Ga0501047_0107267 3300049581 Bacteria 2674
591 Ga0501047_0484092 3300049581 Bacteria 1065
592 Ga0501048_0001491 3300049582 Bacteria 17769
593 Ga0501048_0001532 3300049582 Bacteria 17526
594 Ga0501067_0000553 3300049583 Bacteria 20247
595 Ga0501067_0002308 3300049583 Bacteria 10547
596 Ga0501067_0024525 3300049583 Bacteria 3345
597 Ga0501068_0001954 3300049584 Bacteria 10960
598 Ga0501068_0038437 3300049584 Bacteria 2867
599 Ga0501068_0065117 3300049584 Bacteria 2218
600 Ga0501068_0488041 3300049584 Bacteria 798
601 Ga0501069_0000625 3300049585 Bacteria 16324
602 Ga0501069_0006050 3300049585 Bacteria 6318
603 Ga0501069_0103712 3300049585 Bacteria 1616
604 Ga0501070_0005371 3300049586 Bacteria 10926
605 Ga0501070_0112578 3300049586 Bacteria 2249
606 Ga0501070_0195892 3300049586 Bacteria 1659
607 Ga0501070_1005278 3300049586 Bacteria 646
608 Ga0501071_0005838 3300049587 Bacteria 7953
609 Ga0501071_0128080 3300049587 Bacteria 1885
610 Ga0501072_0127765 3300049588 Bacteria 2025
611 Ga0501073_0010311 3300049589 Bacteria 6859
612 Ga0501073_0019909 3300049589 Bacteria 4841
613 Ga0501073_0022416 3300049589 Bacteria 4547
614 Ga0501073_0112914 3300049589 Bacteria 1884
615 Ga0501073_0175163 3300049589 Bacteria 1484
616 Ga0501074_0001905 3300049590 Bacteria 14330
617 Ga0501074_0028739 3300049590 Bacteria 4028
618 Ga0501074_0112224 3300049590 Bacteria 1950
619 Ga0501074_0245205 3300049590 Bacteria 1274
620 Ga0501075_0000962 3300049591 Bacteria 18337
621 Ga0501076_0219371 3300049592 Bacteria 1554
622 Ga0501076_1475592 3300049592 Bacteria 558
623 Ga0501077_0002393 3300049593 Bacteria 11251
624 Ga0501079_0004720 3300049741 Bacteria 10088
625 Ga0501079_0202748 3300049741 Bacteria 1549
626 Ga0501079_0785596 3300049741 Bacteria 749
627 Ga0501079_1253839 3300049741 Unclassified 584
628 Ga0501080_0008888 3300049742 Bacteria 9136
629 Ga0501080_0027279 3300049742 Bacteria 5311
630 Ga0501080_0033309 3300049742 Bacteria 4808
631 Ga0501080_0096169 3300049742 Bacteria 2749
632 Ga0501080_0566707 3300049742 Bacteria 1010
633 Ga0501080_0635639 3300049742 Bacteria 945
634 Ga0501081_0304195 3300049743 Bacteria 1170
635 Ga0501083_0002132 3300049744 Bacteria 13574
636 Ga0501083_0027266 3300049744 Bacteria 3942
637 Ga0501035_0001253 3300049822 Bacteria 26374
638 Ga0501035_0010497 3300049822 Bacteria 8583
639 Ga0501035_0490204 3300049822 Bacteria 1012
640 Ga0501044_0007868 3300049823 Bacteria 11719
641 Ga0501044_0008765 3300049823 Bacteria 11062
642 Ga0501044_0054308 3300049823 Bacteria 4118
643 Ga0501044_0520600 3300049823 Bacteria 1089
644 Ga0501044_1098714 3300049823 Bacteria 664
645 Ga0501045_0058325 3300049824 Bacteria 2826
646 nmdc:mga05p37_553621_c1 3300050507 Bacteria 1309
647 nmdc:mga05p37_58091_c1 3300050507 Bacteria 4764
648 nmdc:mga05p37_85593_c1 3300050507 Bacteria 3885
649 nmdc:mga09592_14369_c1 3300050508 Bacteria 6463
650 nmdc:mga0qj67_1398_c1 3300050509 Bacteria 16934
651 nmdc:mga0qj67_8727_c1 3300050509 Bacteria 7529
652 nmdc:mga06r32_196081_c1 3300050510 Bacteria 2007
653 nmdc:mga08y16_587749_c1 3300050511 Bacteria 1123
654 nmdc:mga08y16_93645_c1 3300050511 Bacteria 3130
655 nmdc:mga0n895_1245337_c1 3300050512 Bacteria 717
656 nmdc:mga0n895_246885_c1 3300050512 Bacteria 1812
657 nmdc:mga0n895_31_c1 3300050512 Bacteria 81579
658 nmdc:mga0n895_5693_c1 3300050512 Bacteria 10448
659 nmdc:mga0rr50_1416_c1 3300050513 Bacteria 13144
660 nmdc:mga0rr50_1489417_c1 3300050513 Bacteria 572
661 nmdc:mga0rr50_43944_c1 3300050513 Bacteria 3273
662 nmdc:mga0rr50_62289_c1 3300050513 Bacteria 2813
663 nmdc:mga08x19_243258_c1 3300050514 Bacteria 1241
664 nmdc:mga08x19_5358_c1 3300050514 Bacteria 7584
665 nmdc:mga0a205_174267_c1 3300050515 Bacteria 2047
666 nmdc:mga0a205_259_c1 3300050515 Bacteria 38100
667 nmdc:mga0a205_562_c1 3300050515 Bacteria 29493
668 Ga0495655_0063826 3300053083 Bacteria 1012
669 Ga0495619_0352274 3300053085 Bacteria 1018
670 Ga0500643_053056 3300053087 Bacteria 1154
671 Ga0500595_045224 3300053119 Bacteria 1391
672 Ga0501084_0022457 3300054114 Bacteria 5264
673 Ga0501084_0046984 3300054114 Bacteria 3615
674 Ga0590071_000580 3300059421 Bacteria 10531
675 Ga0590075_000837 3300059424 Bacteria 8088
676 Ga0590077_000903 3300059426 Bacteria 7581
677 Ga0587090_034126 3300059510 Bacteria 866
678 Ga0587091_059626 3300059511 Bacteria 807
679 Ga0587125_009220 3300059607 Bacteria 995
680 Ga0587101_013343 3300059623 Bacteria 1081
681 Ga0587124_009761 3300059660 Bacteria 846
682 Ga0587071_040397 3300060344 Bacteria 933
683 Ga0587111_0112654 3300060346 Bacteria 691
684 Ga0501082_0000072 3300060353 Bacteria 73322
685 Ga0501082_0005002 3300060353 Bacteria 11568
686 Ga0501082_0061915 3300060353 Bacteria 3221
687 Ga0501082_0133648 3300060353 Bacteria 2152
688 Ga0501082_0626769 3300060353 Bacteria 941
689 Ga0530510_1484692 3300061734 Bacteria 520
690 2643783564 2643221553 Bacteria 3544260
691 2644679191 2643221724 Bacteria 3593515
692 2730228694 2728369380 Bacteria 3620317
693 2774902874 2773857933 Bacteria 5818019
694 nmdc:mga08x19_6642_c1
695 JGI24034J26672_10081659
696 rootH2_10021145
697 rootH2_10080382
698 rootL2_10015203
699 Ga0058858_1410928
700 Ga0058859_11553821
701 Ga0058863_11594059
702 Ga0058861_11268347
703 Ga0058862_12433139
704 Ga0058862_12851463
705 Ga0065714_10138911
706 Ga0065704_10308306
707 Ga0065707_10215047
708 Ga0070658_10000006
709 Ga0070658_10007225
710 Ga0070658_10038379
711 Ga0070658_10039592
712 Ga0070658_10134911
713 Ga0070658_10137527
714 Ga0070658_10232851
715 Ga0070658_10398281
716 Ga0070683_100009432
717 Ga0070683_100288005
718 Ga0070690_100365598
719 Ga0070670_100334747
720 Ga0070666_10030165
721 Ga0070666_10127318
722 Ga0070680_100108365
723 Ga0070680_100651889
724 Ga0070682_100373030
725 Ga0068868_100825760
726 Ga0070660_100002152
727 Ga0070660_100013713
728 Ga0070660_100028144
729 Ga0070660_100087764
730 Ga0070660_100134075
731 Ga0070689_100144210
732 Ga0070691_10170258
733 Ga0070687_100555500
734 Ga0070661_100116121
735 Ga0070661_100222700
736 Ga0070669_100000164
737 Ga0070675_100383110
738 Ga0070675_100672476
739 Ga0070671_100001020
740 Ga0070673_100020375
741 Ga0070673_100223203
742 Ga0070673_102027871
743 Ga0070688_100061220
744 Ga0070688_100350705
745 Ga0070659_100010337
746 Ga0070659_100292248
747 Ga0070659_101142249
748 Ga0070667_100874256
749 Ga0070709_10272640
750 Ga0070709_10281533
751 Ga0070714_100270392
752 Ga0070713_101251718
753 Ga0070713_101268654
754 Ga0070710_10232429
755 Ga0070701_10292922
756 Ga0070705_100252361
757 Ga0070705_100793432
758 Ga0070700_100170164
759 Ga0070694_100155421
760 Ga0070663_100013088
761 Ga0070663_100046729
762 Ga0070663_100079185
763 Ga0070663_100179349
764 Ga0070663_100318968
765 Ga0070681_10093860
766 Ga0070681_10198698
767 Ga0070681_10334243
768 Ga0070681_10399810
769 Ga0070681_10826020
770 Ga0068867_100791107
771 Ga0068867_101786507
772 Ga0070698_100551473
773 Ga0070679_100000607
774 Ga0070679_100006064
775 Ga0070679_100024592
776 Ga0070679_100059401
777 Ga0070684_100005900
778 Ga0070684_100110235
779 Ga0070684_100591579
780 Ga0068853_100000174
781 Ga0068853_100044099
782 Ga0068853_100058163
783 Ga0068853_100841656
784 Ga0068853_102204399
785 Ga0070672_100240086
786 Ga0070672_100727709
787 Ga0070686_100078006
788 Ga0070686_100313514
789 Ga0070665_100000280
790 Ga0070665_100004995
791 Ga0070704_100023634
792 Ga0070704_100578349
793 Ga0068855_100007178
794 Ga0068855_100154131
795 Ga0068855_100174182
796 Ga0068855_100291926
797 Ga0068855_100301722
798 Ga0070664_100057304
799 Ga0070664_100299054
800 Ga0070664_100748375
801 Ga0068857_100017675
802 Ga0068857_100052519
803 Ga0068854_100000186
804 Ga0068854_100218723
805 Ga0068854_100473915
806 Ga0068854_101619604
807 Ga0068856_100013051
808 Ga0068856_100850196
809 Ga0068852_100042793
810 Ga0068852_100064951
811 Ga0068852_100128851
812 Ga0068859_100018092
813 Ga0068864_100009360
814 Ga0068864_100090822
815 Ga0068861_100326568
816 Ga0068870_10501858
817 Ga0068863_100004076
818 Ga0068858_100570505
819 Ga0068860_100481533
820 Ga0068860_101084191
821 Ga0070717_10001558
822 Ga0070717_10404308
823 Ga0075368_10012903
824 Ga0075364_10128675
825 Ga0070715_10404038
826 Ga0070715_10432069
827 Ga0075367_10110568
828 Ga0075369_10004944
829 Ga0097621_100000066
830 Ga0097621_100662576
831 Ga0068871_100000170
832 Ga0068871_100346660
833 Ga0075428_100025549
834 Ga0075428_100188315
835 Ga0075433_10006367
836 Ga0075433_10076442
837 Ga0075434_100000005
838 Ga0075434_100051793
839 Ga0075434_100110513
840 Ga0075434_100134374
841 Ga0075434_100287013
842 Ga0075429_100013415
843 Ga0068865_100316941
844 Ga0075436_100007285
845 Ga0075436_100019506
846 Ga0097620_100018092
847 Ga0075435_100024980
848 Ga0075435_100032075
849 Ga0075435_100286507
850 Ga0105244_10053379
851 Ga0105240_10000001
852 Ga0105240_10018617
853 Ga0105240_10094503
854 Ga0105240_10108808
855 Ga0105240_10152842
856 Ga0105240_10411545
857 Ga0105240_10483312
858 Ga0105240_11213535
859 Ga0111539_10102893
860 Ga0111539_10949297
861 Ga0105245_10006935
862 Ga0105247_10207684
863 Ga0114129_10104725
864 Ga0114129_10271377
865 Ga0114129_10331348
866 Ga0105241_10316100
867 Ga0105248_10256222
868 Ga0105248_10347645
869 Ga0105248_10604239
870 Ga0105237_10068357
871 Ga0105237_10328505
872 Ga0105237_11438114
873 Ga0105238_10005301
874 Ga0105238_10122060
875 Ga0105238_10320094
876 Ga0105249_10100341
877 Ga0105249_10163025
878 Ga0105249_11136780
879 Ga0105239_10669784
880 Ga0157373_10454492
881 Ga0157371_10007064
882 Ga0157371_10135608
883 Ga0157371_10174405
884 Ga0157371_10301745
885 Ga0157370_10012273
886 Ga0157370_10051672
887 Ga0157370_10103328
888 Ga0157370_10113995
889 Ga0157370_10188281
890 Ga0157370_10391993
891 Ga0157370_10758244
892 Ga0157370_11074699
893 Ga0157370_11457419
894 Ga0157369_10013690
895 Ga0157369_10036291
896 Ga0157369_10068261
897 Ga0157369_10075191
898 Ga0157369_10116262
899 Ga0157369_10228469
900 Ga0157369_10359774
901 Ga0157369_10469038
902 Ga0157369_10510624
903 Ga0157369_10793528
904 Ga0157369_11710280
905 Ga0157374_10088179
906 Ga0157374_10104913
907 Ga0157374_10168865
908 Ga0157374_10271103
909 Ga0157374_11177568
910 Ga0157378_10358353
911 Ga0157378_10961232
912 Ga0163162_10007900
913 Ga0163162_10876899
914 Ga0157372_10005308
915 Ga0157372_10040606
916 Ga0157372_10096540
917 Ga0157372_10096633
918 Ga0157372_10169742
919 Ga0157372_10273045
920 Ga0157372_10691043
921 Ga0157372_11497160
922 Ga0157375_10059475
923 Ga0157375_11577136
924 Ga0163163_10003334
925 Ga0163163_10762424
926 Ga0157380_10004468
927 Ga0157380_10435330
928 Ga0157377_10646896
929 Ga0157379_10094694
930 Ga0157379_10182718
931 Ga0157379_11921050
932 Ga0157376_10156139
933 Ga0157376_10199452
934 Ga0157376_10519561
935 Ga0184595_107919
936 Ga0184595_123911
937 Ga0197907_10738779
938 Ga0197907_11223624
939 Ga0206356_11110856
940 Ga0206356_11659320
941 Ga0206349_1877071
942 Ga0206355_1388814
943 Ga0206355_1537879
944 Ga0206355_1618829
945 Ga0206351_10677131
946 Ga0206352_10308703
947 Ga0206352_10599768
948 Ga0206352_11016995
949 Ga0206350_11323274
950 Ga0206354_11100117
951 Ga0206354_11456630
952 Ga0206353_11159178
953 Ga0154015_1134506
954 Ga0224712_10029435
955 Ga0224712_10172953
956 Ga0224712_10195201
957 Ga0247553_100730
958 Ga0207692_10212724
959 Ga0207680_10414009
960 Ga0207647_10032975
961 Ga0207647_10177104
962 Ga0207699_10228473
963 Ga0207645_10013115
964 Ga0207643_10285319
965 Ga0207705_10000012
966 Ga0207705_10001912
967 Ga0207705_10002156
968 Ga0207705_10010724
969 Ga0207705_10019852
970 Ga0207705_10076147
971 Ga0207705_10146373
972 Ga0207705_10151788
973 Ga0207705_10186418
974 Ga0207654_10273656
975 Ga0207707_10023728
976 Ga0207707_10065953
977 Ga0207707_10068125
978 Ga0207695_10000001
979 Ga0207695_10008216
980 Ga0207695_10084834
981 Ga0207695_10129252
982 Ga0207695_10192236
983 Ga0207695_10234786
984 Ga0207695_10542425
985 Ga0207671_11494245
986 Ga0207693_10252561
987 Ga0207660_10015830
988 Ga0207662_10555980
989 Ga0207657_10001507
990 Ga0207657_10008653
991 Ga0207657_10017115
992 Ga0207657_10026932
993 Ga0207657_10194237
994 Ga0207657_10394359
995 Ga0207649_10037830
996 Ga0207649_10112141
997 Ga0207649_11410316
998 Ga0207652_10011368
999 Ga0207652_10105438
1000 Ga0207652_10127248
1001 Ga0207681_10000056
1002 Ga0207681_10289314
1003 Ga0207694_10007162
1004 Ga0207694_10177219
1005 Ga0207694_10183553
1006 Ga0207650_10030159
1007 Ga0207687_10391695
1008 Ga0207700_10295694
1009 Ga0207700_10736688
1010 Ga0207664_10256876
1011 Ga0207664_10260763
1012 Ga0207644_10030504
1013 Ga0207690_10002265
1014 Ga0207690_10030551
1015 Ga0207690_10119581
1016 Ga0207706_10064861
1017 Ga0207686_11015805
1018 Ga0207670_10033206
1019 Ga0207704_11529824
1020 Ga0207711_10062364
1021 Ga0207711_10077219
1022 Ga0207711_10165572
1023 Ga0207711_10290489
1024 Ga0207689_10061204
1025 Ga0207661_10207245
1026 Ga0207679_10015483
1027 Ga0207679_10683648
1028 Ga0207667_10009317
1029 Ga0207667_10016157
1030 Ga0207667_10032870
1031 Ga0207667_10050332
1032 Ga0207667_10088266
1033 Ga0207667_10281503
1034 Ga0207667_10579575
1035 Ga0207667_11381590
1036 Ga0207651_10006568
1037 Ga0207651_10191582
1038 Ga0207712_10146032
1039 Ga0207640_10000034
1040 Ga0207658_10388602
1041 Ga0207703_10291778
1042 Ga0207703_10494871
1043 Ga0207639_10000115
1044 Ga0207639_10148947
1045 Ga0207639_10203754
1046 Ga0207639_11272835
1047 Ga0207678_10003556
1048 Ga0207678_10014956
1049 Ga0207678_10021612
1050 Ga0207678_10324846
1051 Ga0207678_11091962
1052 Ga0207708_10176959
1053 Ga0207708_10676469
1054 Ga0207702_11261545
1055 Ga0207641_10175274
1056 Ga0207648_11406470
1057 Ga0207676_10154705
1058 Ga0207676_10160989
1059 Ga0207674_10005050
1060 Ga0207674_10352580
1061 Ga0207674_10398592
1062 Ga0207674_10398721
1063 Ga0207675_100095349
1064 Ga0207675_100640564
1065 Ga0207683_10375192
1066 Ga0207698_10114764
1067 Ga0207698_10128602
1068 Ga0207698_10961420
1069 Ga0207428_10022079
1070 Ga0268266_10001178
1071 Ga0265334_10236899
1072 Ga0265318_10182820
1073 Ga0265338_10001506
1074 Ga0265338_10114840
1075 Ga0265338_10176577
1076 Ga0265338_10364403
1077 Ga0265338_10763906
1078 Ga0265766_1009802
1079 Ga0265770_1029075
1080 Ga0265776_113917
1081 Ga0265761_103554
1082 Ga0265773_1015382
1083 Ga0265760_10048872
1084 Ga0265330_10000495
1085 Ga0265330_10018712
1086 Ga0265330_10043868
1087 Ga0265330_10060824
1088 Ga0265332_10015779
1089 Ga0265328_10029018
1090 Ga0265328_10127024
1091 Ga0265325_10000217
1092 Ga0265325_10056567
1093 Ga0265340_10084518
1094 Ga0265340_10355290
1095 Ga0265339_10000162
1096 Ga0265339_10025263
1097 Ga0265339_10036580
1098 Ga0265339_10048735
1099 Ga0265316_10000473
1100 Ga0265316_10006109
1101 Ga0265316_10013958
1102 Ga0265316_10019813
1103 Ga0265316_10192589
1104 Ga0265316_10206774
1105 Ga0265316_10279296
1106 Ga0265313_10006715
1107 Ga0265313_10133138
1108 Ga0307508_10057810
1109 Ga0316575_10172676
1110 Ga0316579_10142788
1111 Ga0265314_10008015
1112 Ga0265314_10081677
1113 Ga0265314_10310105
1114 Ga0265342_10001956
1115 Ga0265342_10006040
1116 Ga0265342_10013479
1117 Ga0265342_10041032
1118 Ga0316577_10003396
1119 Ga0307413_10124163
1120 Ga0307413_10963183
1121 Ga0307410_10007104
1122 Ga0307412_10004388
1123 Ga0307409_100284493
1124 Ga0307416_101899730
1125 Ga0307411_10378352
1126 Ga0307411_11637534
1127 Ga0316053_100943
1128 Ga0316053_103404
1129 Ga0307415_100010404
1130 Ga0316593_10219597
1131 Ga0373932_0350526
1132 Ga0373939_0206732
1133 Ga0373953_0208508
1134 Ga0373957_0147103
1135 Ga0373961_0000560
1136 Ga0316574_0001659
1137 Ga0373935_0002837
1138 Ga0373933_0813238
1139 Ga0373937_0296828
1140 Ga0373937_1041203
1141 Ga0265778_001154
1142 Ga0265778_043637
1143 Ga0316582_0125491
1144 Ga0316584_0030324
1145 Ga0395900_0158442
1146 Ga0316581_0253637
1147 Ga0436364_0422759
1148 Ga0436363_0738180
1149 Ga0451790_48433
1150 Ga0451798_0883000
1151 Ga0451804_0024815
1152 Ga0451804_1096986
1153 Ga0451807_0879487
1154 Ga0451839_1488214
1155 Ga0451843_1648800
1156 Ga0439448_0013651
1157 Ga0439449_0158714
1158 Ga0439435_0007548
1159 Ga0439435_0044540
1160 Ga0439460_0059828
1161 Ga0451577_0056839
1162 Ga0466972_0304243
1163 Ga0466961_0262955
1164 Ga0466963_0305858
1165 Ga0466963_0555421
1166 Ga0453684_0029003
1167 Ga0453684_0101505
1168 Ga0453684_0236687
1169 Ga0453684_0319714
1170 Ga0453684_0531820
1171 Ga0466970_0209447
1172 Ga0466959_0077224
1173 Ga0451576_0721965
1174 Ga0466958_0084898
1175 Ga0466967_0359443
1176 Ga0495617_016219
1177 Ga0495592_0097621
1178 Ga0495603_0137902
1179 Ga0495629_0426401
1180 Ga0495650_0000038
1181 Ga0495580_0036966
1182 Ga0495580_0169549
1183 Ga0495584_0123430
1184 Ga0495585_0050871
1185 Ga0495594_0007770
1186 Ga0495596_0058708
1187 Ga0495583_0022127
1188 Ga0495606_0021082
1189 Ga0495608_0433230
1190 Ga0495644_0000044
1191 Ga0495663_0084669
1192 Ga0495654_0014677
1193 Ga0495586_0220041
1194 Ga0495609_0002185
1195 Ga0495668_0015530
1196 Ga0495611_0016130
1197 Ga0495625_0000580
1198 Ga0495625_0020612
1199 Ga0495625_0538152
1200 Ga0495659_0137665
1201 Ga0495588_0096100
1202 Ga0495623_0203974
1203 Ga0495658_0201900
1204 Ga0495658_0349385
1205 Ga0495669_0003780
1206 Ga0495670_0027481
1207 Ga0495649_0208212
1208 Ga0495604_0016650
1209 Ga0495636_0105372
1210 Ga0495672_0001831
1211 Ga0495672_0451019
1212 Ga0495683_0089671
1213 Ga0495677_0088244
1214 Ga0495685_043165
1215 Ga0495684_0620968
1216 Ga0495686_0038629
1217 Ga0495686_0068800
1218 Ga0495686_0314621
1219 Ga0495686_0351057
1220 Ga0495615_0041972
1221 Ga0496100_1342214
1222 Ga0496100_1610996
1223 Ga0496102_0382754
1224 Ga0496102_1448066
1225 Ga0496104_0247612
1226 Ga0496104_0445350
1227 Ga0496104_0607879
1228 Ga0496104_1286548
1229 Ga0496105_0377580
1230 Ga0496105_0541996
1231 Ga0496105_1370255
1232 Ga0496107_0466959
1233 Ga0496112_1215692
1234 Ga0496113_1309957
1235 Ga0496114_0000036
1236 Ga0496114_0032760
1237 Ga0496118_0311920
1238 Ga0495682_0031856
1239 Ga0495682_0061520
1240 Ga0501031_0019586
1241 Ga0501031_0019878
1242 Ga0501031_0115005
1243 Ga0501032_0002284
1244 Ga0501032_0004677
1245 Ga0501032_0104806
1246 Ga0501033_0000659
1247 Ga0501033_0068252
1248 Ga0501033_0250407
1249 Ga0501034_0001806
1250 Ga0501034_0007673
1251 Ga0501034_0040371
1252 Ga0501034_0109776
1253 Ga0501036_0004803
1254 Ga0501036_0010731
1255 Ga0501036_0013962
1256 Ga0501036_0057492
1257 Ga0501037_0003317
1258 Ga0501037_0012094
1259 Ga0501037_0020889
1260 Ga0501037_0050021
1261 Ga0501037_0248386
1262 Ga0501038_0011623
1263 Ga0501038_0018000
1264 Ga0501038_0052727
1265 Ga0501038_0725129
1266 Ga0501039_0005483
1267 Ga0501039_0017020
1268 Ga0501039_0108274
1269 Ga0501040_0092565
1270 Ga0501042_0004587
1271 Ga0501042_0054879
1272 Ga0501042_0103572
1273 Ga0501043_0002589
1274 Ga0501043_0006527
1275 Ga0501043_0044248
1276 Ga0501046_0000056
1277 Ga0501046_0000732
1278 Ga0501046_0010248
1279 Ga0501046_0108015
1280 Ga0501047_0007941
1281 Ga0501047_0051099
1282 Ga0501047_0061918
1283 Ga0501047_0107267
1284 Ga0501047_0484092
1285 Ga0501048_0001491
1286 Ga0501048_0001532
1287 Ga0501067_0000553
1288 Ga0501067_0002308
1289 Ga0501067_0024525
1290 Ga0501068_0001954
1291 Ga0501068_0038437
1292 Ga0501068_0065117
1293 Ga0501068_0488041
1294 Ga0501069_0000625
1295 Ga0501069_0006050
1296 Ga0501069_0103712
1297 Ga0501070_0005371
1298 Ga0501070_0112578
1299 Ga0501070_0195892
1300 Ga0501070_1005278
1301 Ga0501071_0005838
1302 Ga0501071_0128080
1303 Ga0501072_0127765
1304 Ga0501073_0010311
1305 Ga0501073_0019909
1306 Ga0501073_0022416
1307 Ga0501073_0112914
1308 Ga0501073_0175163
1309 Ga0501074_0001905
1310 Ga0501074_0028739
1311 Ga0501074_0112224
1312 Ga0501074_0245205
1313 Ga0501075_0000962
1314 Ga0501076_0219371
1315 Ga0501076_1475592
1316 Ga0501077_0002393
1317 Ga0501079_0004720
1318 Ga0501079_0202748
1319 Ga0501079_0785596
1320 Ga0501079_1253839
1321 Ga0501080_0008888
1322 Ga0501080_0027279
1323 Ga0501080_0033309
1324 Ga0501080_0096169
1325 Ga0501080_0566707
1326 Ga0501080_0635639
1327 Ga0501081_0304195
1328 Ga0501083_0002132
1329 Ga0501083_0027266
1330 Ga0501035_0001253
1331 Ga0501035_0010497
1332 Ga0501035_0490204
1333 Ga0501044_0007868
1334 Ga0501044_0008765
1335 Ga0501044_0054308
1336 Ga0501044_0520600
1337 Ga0501044_1098714
1338 Ga0501045_0058325
1339 nmdc:mga05p37_553621_c1
1340 nmdc:mga05p37_58091_c1
1341 nmdc:mga05p37_85593_c1
1342 nmdc:mga09592_14369_c1
1343 nmdc:mga0qj67_1398_c1
1344 nmdc:mga0qj67_8727_c1
1345 nmdc:mga06r32_196081_c1
1346 nmdc:mga08y16_587749_c1
1347 nmdc:mga08y16_93645_c1
1348 nmdc:mga0n895_1245337_c1
1349 nmdc:mga0n895_246885_c1
1350 nmdc:mga0n895_31_c1
1351 nmdc:mga0n895_5693_c1
1352 nmdc:mga0rr50_1416_c1
1353 nmdc:mga0rr50_1489417_c1
1354 nmdc:mga0rr50_43944_c1
1355 nmdc:mga0rr50_62289_c1
1356 nmdc:mga08x19_243258_c1
1357 nmdc:mga08x19_5358_c1
1358 nmdc:mga0a205_174267_c1
1359 nmdc:mga0a205_259_c1
1360 nmdc:mga0a205_562_c1
1361 Ga0495655_0063826
1362 Ga0495619_0352274
1363 Ga0500643_053056
1364 Ga0500595_045224
1365 Ga0501084_0022457
1366 Ga0501084_0046984
1367 Ga0590071_000580
1368 Ga0590075_000837
1369 Ga0590077_000903
1370 Ga0587090_034126
1371 Ga0587091_059626
1372 Ga0587125_009220
1373 Ga0587101_013343
1374 Ga0587124_009761
1375 Ga0587071_040397
1376 Ga0587111_0112654
1377 Ga0501082_0000072
1378 Ga0501082_0005002
1379 Ga0501082_0061915
1380 Ga0501082_0133648
1381 Ga0501082_0626769
1382 Ga0530510_1484692
1383 2643783564
1384 2644679191
1385 2730228694
1386 2774902874

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

24

142

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4w-assembly1.cif.gz_I a. baumannii ribosome-eravacycline complex: empty 70s 0.9637 8 142
6ysi-assembly1.cif.gz_F acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9635 8 142
7jql-assembly2.cif.gz_2N crystal structure of the thermus thermophilus 70s ribosome in complex with bac7-001, mrna, and deacylated p-site trna at 3.00a resolution 0.9593 12 142
7nhn-assembly1.cif.gz_M vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9575 11 141
7asn-assembly1.cif.gz_H staphylococcus aureus 50s after 30 minutes incubation a 37c 0.9573 11 141
ID Description Score Start End Superfamily
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9606 12 141 3.90.1180.10
af_C6SWN9_25_183_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9604 14 144 3.90.1180.10
af_A0A0R0E7H3_25_163_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9579 14 144 3.90.1180.10
af_Q554U7_3_170_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9508 13 136 3.90.1180.10
af_O96222_56_212_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.9397 11 141 3.90.1180.10
ID Description Score Start End GO Terms
AF-A0A6A5L5J7-F1-model_v4 deleted 0.9857 8 141
AF-A0A7C2HIC1-F1-model_v4 Large ribosomal subunit protein uL13 0.9809 8 143 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A7W0YEG7-F1-model_v4 Large ribosomal subunit protein uL13 0.9788 12 143 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A101F7L1-F1-model_v4 Large ribosomal subunit protein uL13 0.9776 8 144 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A3B4X4E0-F1-model_v4 50S ribosomal protein L13 0.9773 14 141 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Map