F475680
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 693 | 289 | 687 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0029266|Ga0501075_0029266_1441_2739 |
| Length | 432 |
| Sequence | MSNPRLAIGLDSPEQVGRRASGVNDRGGDIDQDEIAEIDTSRVRAPRRDVRTLHGGLCMSVRGRILITGGAGFIGSHLADELLEHGYAVRALDNLSEQVHGLGAQRPSYLHPDVELVRGDVRDRAAVRAALADVDAVFHFAAMVGVGQSMYEIARYTDVNNLGTAVLLEALAERPVGRLVVASSMSIYGEGLYRDRRGDLAAGVERDREQLKARDWEVRDSDGEPLTPVPTPESKTPTLSSVYALSKYDQERMCLMVGKAYNIPTVALRFFNVYGTRQALSNPYTGVLAIFASRLLNGRPPLIFEDGRQMRDFVHVSDIARACRLALTVPEAAGQVFNIGSGRQATVREIADALADVLDRKDLEPEITGKYRVGDIRHCFADITLARRVLGYEPQMPLARGLLELSSWLADQVADDRVAQGHAELTARGLTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 2 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 101 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 161 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 175 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 176 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 189 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 190 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 191 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 192 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 193 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 196 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 197 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 220 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 221 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 248 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 249 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 254 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 267 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 268 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 269 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 270 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 286 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 287 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 288 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 289 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.22 |
| Metatranscriptomes | 5.92 |
| Isolates | 0.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 1.15 |
| Rhizosphere | 95.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10007917 | 3300001991 | Bacteria | 1854 |
| 2 | Ga0007416J51690_1041533 | 3300003577 | Bacteria | 1467 |
| 3 | Ga0032354_1020727 | 3300003693 | Bacteria | 1443 |
| 4 | Ga0032354_1021065 | 3300003693 | Bacteria | 3577 |
| 5 | Ga0058692_1000006 | 3300003856 | Bacteria | 398109 |
| 6 | Ga0058863_11748332 | 3300004799 | Bacteria | 3099 |
| 7 | Ga0058862_12292174 | 3300004803 | Bacteria | 4690 |
| 8 | Ga0058862_12842061 | 3300004803 | Bacteria | 2324 |
| 9 | Ga0065714_10073034 | 3300005288 | Bacteria | 3256 |
| 10 | Ga0065712_10003968 | 3300005290 | Bacteria | 8902 |
| 11 | Ga0065715_10001568 | 3300005293 | Bacteria | 9435 |
| 12 | Ga0070658_10000345 | 3300005327 | Bacteria | 40226 |
| 13 | Ga0070658_10000650 | 3300005327 | Bacteria | 30049 |
| 14 | Ga0070658_10002428 | 3300005327 | Bacteria | 15598 |
| 15 | Ga0070658_10010486 | 3300005327 | Bacteria | 7432 |
| 16 | Ga0070658_10045618 | 3300005327 | Bacteria | 3544 |
| 17 | Ga0070658_10046302 | 3300005327 | Bacteria | 3520 |
| 18 | Ga0070658_10145001 | 3300005327 | Bacteria | 1985 |
| 19 | Ga0070658_10150341 | 3300005327 | Bacteria | 1949 |
| 20 | Ga0070658_10348271 | 3300005327 | Unclassified | 1268 |
| 21 | Ga0070676_10048169 | 3300005328 | Bacteria | 2491 |
| 22 | Ga0070683_100003153 | 3300005329 | Bacteria | 13286 |
| 23 | Ga0070683_100039535 | 3300005329 | Bacteria | 4331 |
| 24 | Ga0070683_100070223 | 3300005329 | Bacteria | 3267 |
| 25 | Ga0070683_100083384 | 3300005329 | Bacteria | 2994 |
| 26 | Ga0070683_100204148 | 3300005329 | Bacteria | 1877 |
| 27 | Ga0070690_100046425 | 3300005330 | Bacteria | 2761 |
| 28 | Ga0070670_100001140 | 3300005331 | Bacteria | 21113 |
| 29 | Ga0068869_100003119 | 3300005334 | Bacteria | 10109 |
| 30 | Ga0070666_10017705 | 3300005335 | Bacteria | 4571 |
| 31 | Ga0070666_10052546 | 3300005335 | Bacteria | 2746 |
| 32 | Ga0070666_10071574 | 3300005335 | Bacteria | 2360 |
| 33 | Ga0070680_100000072 | 3300005336 | Bacteria | 53846 |
| 34 | Ga0070680_100006987 | 3300005336 | Bacteria | 8603 |
| 35 | Ga0070680_100007450 | 3300005336 | Bacteria | 8349 |
| 36 | Ga0070680_100300850 | 3300005336 | Bacteria | 1360 |
| 37 | Ga0068868_100000110 | 3300005338 | Bacteria | 51175 |
| 38 | Ga0068868_100122053 | 3300005338 | Bacteria | 2126 |
| 39 | Ga0070660_100014526 | 3300005339 | Bacteria | 5676 |
| 40 | Ga0070660_100032650 | 3300005339 | Bacteria | 3919 |
| 41 | Ga0070660_100033615 | 3300005339 | Bacteria | 3867 |
| 42 | Ga0070660_100174821 | 3300005339 | Unclassified | 1736 |
| 43 | Ga0070689_100016114 | 3300005340 | Bacteria | 5467 |
| 44 | Ga0070689_100016821 | 3300005340 | Bacteria | 5360 |
| 45 | Ga0070661_100003285 | 3300005344 | Bacteria | 11166 |
| 46 | Ga0070661_100013818 | 3300005344 | Bacteria | 5674 |
| 47 | Ga0070661_100035295 | 3300005344 | Bacteria | 3630 |
| 48 | Ga0070661_100042894 | 3300005344 | Bacteria | 3303 |
| 49 | Ga0070661_100050703 | 3300005344 | Bacteria | 3037 |
| 50 | Ga0070661_100061373 | 3300005344 | Bacteria | 2759 |
| 51 | Ga0070661_100186822 | 3300005344 | Bacteria | 1579 |
| 52 | Ga0070668_100067406 | 3300005347 | Bacteria | 2780 |
| 53 | Ga0070675_100008863 | 3300005354 | Bacteria | 7822 |
| 54 | Ga0070671_100001247 | 3300005355 | Bacteria | 19073 |
| 55 | Ga0070671_100012945 | 3300005355 | Bacteria | 6721 |
| 56 | Ga0070671_100017289 | 3300005355 | Bacteria | 5840 |
| 57 | Ga0070671_100094714 | 3300005355 | Bacteria | 2503 |
| 58 | Ga0070673_100004217 | 3300005364 | Bacteria | 9071 |
| 59 | Ga0070688_100001831 | 3300005365 | Bacteria | 10678 |
| 60 | Ga0070659_100037292 | 3300005366 | Bacteria | 3789 |
| 61 | Ga0070659_100093424 | 3300005366 | Bacteria | 2414 |
| 62 | Ga0070659_100145440 | 3300005366 | Bacteria | 1931 |
| 63 | Ga0070667_100000289 | 3300005367 | Bacteria | 56919 |
| 64 | Ga0070667_100035813 | 3300005367 | Bacteria | 4159 |
| 65 | Ga0070667_100201079 | 3300005367 | Bacteria | 1768 |
| 66 | Ga0070714_100085991 | 3300005435 | Bacteria | 2747 |
| 67 | Ga0070714_100134707 | 3300005435 | Bacteria | 2211 |
| 68 | Ga0070713_100096966 | 3300005436 | Bacteria | 2547 |
| 69 | Ga0070710_10028098 | 3300005437 | Bacteria | 3006 |
| 70 | Ga0070710_10066564 | 3300005437 | Bacteria | 2066 |
| 71 | Ga0070701_10153135 | 3300005438 | Bacteria | 1329 |
| 72 | Ga0070711_100074515 | 3300005439 | Bacteria | 2400 |
| 73 | Ga0070711_100227387 | 3300005439 | Bacteria | 1453 |
| 74 | Ga0070700_100154870 | 3300005441 | Bacteria | 1571 |
| 75 | Ga0070663_100185036 | 3300005455 | Bacteria | 1618 |
| 76 | Ga0070678_100094099 | 3300005456 | Bacteria | 2306 |
| 77 | Ga0070662_100163584 | 3300005457 | Unclassified | 1742 |
| 78 | Ga0070681_10001597 | 3300005458 | Bacteria | 20162 |
| 79 | Ga0070681_10048941 | 3300005458 | Bacteria | 4222 |
| 80 | Ga0070681_10090672 | 3300005458 | Bacteria | 3007 |
| 81 | Ga0070681_10090714 | 3300005458 | Bacteria | 3006 |
| 82 | Ga0070681_10109455 | 3300005458 | Bacteria | 2703 |
| 83 | Ga0070685_10003418 | 3300005466 | Bacteria | 8076 |
| 84 | Ga0070679_100000854 | 3300005530 | Bacteria | 26529 |
| 85 | Ga0070679_100002644 | 3300005530 | Bacteria | 16299 |
| 86 | Ga0070679_100104512 | 3300005530 | Bacteria | 2819 |
| 87 | Ga0070679_100139692 | 3300005530 | Bacteria | 2403 |
| 88 | Ga0070679_100204288 | 3300005530 | Bacteria | 1940 |
| 89 | Ga0070684_100000822 | 3300005535 | Bacteria | 21733 |
| 90 | Ga0070684_100063457 | 3300005535 | Bacteria | 3238 |
| 91 | Ga0070684_100077072 | 3300005535 | Bacteria | 2944 |
| 92 | Ga0068853_100000645 | 3300005539 | Bacteria | 23916 |
| 93 | Ga0068853_100021631 | 3300005539 | Bacteria | 5365 |
| 94 | Ga0068853_100049991 | 3300005539 | Bacteria | 3595 |
| 95 | Ga0068853_100054589 | 3300005539 | Bacteria | 3443 |
| 96 | Ga0068853_100080059 | 3300005539 | Bacteria | 2858 |
| 97 | Ga0068853_100342974 | 3300005539 | Bacteria | 1388 |
| 98 | Ga0070672_100133354 | 3300005543 | Unclassified | 2043 |
| 99 | Ga0070672_100176438 | 3300005543 | Bacteria | 1779 |
| 100 | Ga0070686_100025434 | 3300005544 | Bacteria | 3563 |
| 101 | Ga0070665_100000134 | 3300005548 | Bacteria | 139586 |
| 102 | Ga0070665_100024237 | 3300005548 | Bacteria | 6110 |
| 103 | Ga0070665_100108672 | 3300005548 | Bacteria | 2776 |
| 104 | Ga0068855_100003388 | 3300005563 | Bacteria | 19510 |
| 105 | Ga0068855_100003472 | 3300005563 | Bacteria | 19296 |
| 106 | Ga0068855_100004985 | 3300005563 | Bacteria | 16204 |
| 107 | Ga0068855_100005586 | 3300005563 | Bacteria | 15344 |
| 108 | Ga0068855_100017874 | 3300005563 | Bacteria | 8521 |
| 109 | Ga0068855_100022663 | 3300005563 | Bacteria | 7524 |
| 110 | Ga0068855_100026188 | 3300005563 | Bacteria | 6977 |
| 111 | Ga0068855_100032978 | 3300005563 | Bacteria | 6183 |
| 112 | Ga0068855_100037620 | 3300005563 | Bacteria | 5753 |
| 113 | Ga0068855_100045621 | 3300005563 | Bacteria | 5183 |
| 114 | Ga0068855_100058558 | 3300005563 | Bacteria | 4511 |
| 115 | Ga0068855_100072754 | 3300005563 | Bacteria | 3995 |
| 116 | Ga0068855_100175664 | 3300005563 | Bacteria | 2424 |
| 117 | Ga0068855_100291181 | 3300005563 | Bacteria | 1810 |
| 118 | Ga0068857_100002939 | 3300005577 | Bacteria | 14044 |
| 119 | Ga0068857_100003860 | 3300005577 | Bacteria | 12613 |
| 120 | Ga0068857_100007995 | 3300005577 | Bacteria | 9127 |
| 121 | Ga0068854_100007202 | 3300005578 | Bacteria | 7101 |
| 122 | Ga0068854_100027922 | 3300005578 | Bacteria | 3894 |
| 123 | Ga0068856_100002433 | 3300005614 | Bacteria | 19150 |
| 124 | Ga0068856_100011197 | 3300005614 | Bacteria | 8705 |
| 125 | Ga0068856_100023721 | 3300005614 | Bacteria | 5966 |
| 126 | Ga0068856_100049532 | 3300005614 | Bacteria | 4140 |
| 127 | Ga0068856_100059555 | 3300005614 | Bacteria | 3772 |
| 128 | Ga0068856_100115561 | 3300005614 | Bacteria | 2683 |
| 129 | Ga0068856_100150059 | 3300005614 | Bacteria | 2340 |
| 130 | Ga0068852_100000027 | 3300005616 | Bacteria | 113819 |
| 131 | Ga0068852_100001442 | 3300005616 | Bacteria | 16042 |
| 132 | Ga0068852_100029057 | 3300005616 | Unclassified | 4535 |
| 133 | Ga0068852_100060214 | 3300005616 | Bacteria | 3296 |
| 134 | Ga0068859_100003668 | 3300005617 | Bacteria | 15638 |
| 135 | Ga0068864_100001232 | 3300005618 | Bacteria | 21282 |
| 136 | Ga0068851_10006679 | 3300005834 | Bacteria | 5278 |
| 137 | Ga0068851_10017700 | 3300005834 | Bacteria | 3426 |
| 138 | Ga0068851_10024026 | 3300005834 | Bacteria | 2982 |
| 139 | Ga0068851_10043919 | 3300005834 | Bacteria | 2254 |
| 140 | Ga0068863_100002128 | 3300005841 | Bacteria | 19652 |
| 141 | Ga0068863_100054324 | 3300005841 | Bacteria | 3795 |
| 142 | Ga0068858_100015131 | 3300005842 | Bacteria | 7256 |
| 143 | Ga0068860_100083152 | 3300005843 | Bacteria | 3044 |
| 144 | Ga0068862_100240410 | 3300005844 | Bacteria | 1646 |
| 145 | Ga0081455_10026466 | 3300005937 | Bacteria | 5333 |
| 146 | Ga0081455_10028271 | 3300005937 | Bacteria | 5125 |
| 147 | Ga0081538_10017318 | 3300005981 | Bacteria | 5475 |
| 148 | Ga0081539_10000639 | 3300005985 | Bacteria | 70847 |
| 149 | Ga0070717_10003134 | 3300006028 | Bacteria | 11812 |
| 150 | Ga0070717_10020816 | 3300006028 | Bacteria | 5163 |
| 151 | Ga0070716_100024703 | 3300006173 | Bacteria | 3201 |
| 152 | Ga0070712_100157935 | 3300006175 | Bacteria | 1748 |
| 153 | Ga0097621_100005059 | 3300006237 | Bacteria | 9265 |
| 154 | Ga0068871_100000321 | 3300006358 | Bacteria | 33368 |
| 155 | Ga0075433_10039695 | 3300006852 | Bacteria | 4072 |
| 156 | Ga0075434_100000641 | 3300006871 | Bacteria | 27050 |
| 157 | Ga0075436_100000256 | 3300006914 | Bacteria | 33232 |
| 158 | Ga0075436_100049922 | 3300006914 | Bacteria | 2887 |
| 159 | Ga0097620_100003668 | 3300006931 | Bacteria | 15638 |
| 160 | Ga0105240_10000002 | 3300009093 | Bacteria | 1924170 |
| 161 | Ga0105240_10000130 | 3300009093 | Bacteria | 154390 |
| 162 | Ga0105240_10000222 | 3300009093 | Bacteria | 113825 |
| 163 | Ga0105240_10005666 | 3300009093 | Bacteria | 18538 |
| 164 | Ga0105240_10006104 | 3300009093 | Bacteria | 17778 |
| 165 | Ga0105240_10012189 | 3300009093 | Bacteria | 11895 |
| 166 | Ga0105240_10015500 | 3300009093 | Bacteria | 10361 |
| 167 | Ga0105240_10027417 | 3300009093 | Bacteria | 7456 |
| 168 | Ga0105240_10080777 | 3300009093 | Bacteria | 3997 |
| 169 | Ga0105240_10086151 | 3300009093 | Bacteria | 3847 |
| 170 | Ga0105240_10172550 | 3300009093 | Unclassified | 2559 |
| 171 | Ga0111539_10043418 | 3300009094 | Bacteria | 5389 |
| 172 | Ga0105245_10000169 | 3300009098 | Bacteria | 61835 |
| 173 | Ga0105245_10067425 | 3300009098 | Bacteria | 3241 |
| 174 | Ga0105247_10035139 | 3300009101 | Bacteria | 3054 |
| 175 | Ga0114129_10432061 | 3300009147 | Bacteria | 1730 |
| 176 | Ga0105241_10000074 | 3300009174 | Bacteria | 75523 |
| 177 | Ga0105241_10002755 | 3300009174 | Bacteria | 13168 |
| 178 | Ga0105241_10004865 | 3300009174 | Bacteria | 9907 |
| 179 | Ga0105241_10096571 | 3300009174 | Bacteria | 2341 |
| 180 | Ga0105241_10115283 | 3300009174 | Bacteria | 2156 |
| 181 | Ga0105248_10006190 | 3300009177 | Bacteria | 13115 |
| 182 | Ga0105237_10004817 | 3300009545 | Bacteria | 15502 |
| 183 | Ga0105237_10015269 | 3300009545 | Bacteria | 8000 |
| 184 | Ga0105237_10083831 | 3300009545 | Bacteria | 3178 |
| 185 | Ga0105237_10107264 | 3300009545 | Bacteria | 2785 |
| 186 | Ga0105237_10134046 | 3300009545 | Bacteria | 2472 |
| 187 | Ga0105238_10000516 | 3300009551 | Bacteria | 40563 |
| 188 | Ga0105238_10001890 | 3300009551 | Bacteria | 21028 |
| 189 | Ga0105238_10003327 | 3300009551 | Bacteria | 16042 |
| 190 | Ga0105238_10010605 | 3300009551 | Bacteria | 9252 |
| 191 | Ga0105238_10028496 | 3300009551 | Bacteria | 5690 |
| 192 | Ga0105238_10032609 | 3300009551 | Bacteria | 5300 |
| 193 | Ga0105238_10044053 | 3300009551 | Bacteria | 4513 |
| 194 | Ga0105238_10075818 | 3300009551 | Bacteria | 3355 |
| 195 | Ga0105249_10019112 | 3300009553 | Bacteria | 6111 |
| 196 | Ga0105239_10003064 | 3300010375 | Bacteria | 20772 |
| 197 | Ga0105239_10026650 | 3300010375 | Bacteria | 6362 |
| 198 | Ga0105239_10036104 | 3300010375 | Bacteria | 5427 |
| 199 | Ga0105239_10092589 | 3300010375 | Bacteria | 3337 |
| 200 | Ga0105239_10114770 | 3300010375 | Bacteria | 2987 |
| 201 | Ga0105239_10179478 | 3300010375 | Unclassified | 2369 |
| 202 | Ga0105246_10004915 | 3300011119 | Bacteria | 8145 |
| 203 | Ga0157371_10009561 | 3300013102 | Bacteria | 7625 |
| 204 | Ga0157371_10027541 | 3300013102 | Bacteria | 4122 |
| 205 | Ga0157371_10131433 | 3300013102 | Bacteria | 1781 |
| 206 | Ga0157370_10001610 | 3300013104 | Bacteria | 27915 |
| 207 | Ga0157370_10003900 | 3300013104 | Bacteria | 17380 |
| 208 | Ga0157370_10030259 | 3300013104 | Bacteria | 5305 |
| 209 | Ga0157370_10067695 | 3300013104 | Bacteria | 3375 |
| 210 | Ga0157370_10190990 | 3300013104 | Bacteria | 1901 |
| 211 | Ga0157370_10284123 | 3300013104 | Unclassified | 1529 |
| 212 | Ga0157370_10368755 | 3300013104 | Bacteria | 1323 |
| 213 | Ga0157369_10000112 | 3300013105 | Bacteria | 114309 |
| 214 | Ga0157369_10005663 | 3300013105 | Bacteria | 14513 |
| 215 | Ga0157369_10006503 | 3300013105 | Bacteria | 13544 |
| 216 | Ga0157369_10011061 | 3300013105 | Bacteria | 10267 |
| 217 | Ga0157369_10019713 | 3300013105 | Bacteria | 7547 |
| 218 | Ga0157369_10021141 | 3300013105 | Bacteria | 7276 |
| 219 | Ga0157369_10028434 | 3300013105 | Bacteria | 6187 |
| 220 | Ga0157369_10034889 | 3300013105 | Bacteria | 5518 |
| 221 | Ga0157369_10041174 | 3300013105 | Bacteria | 5043 |
| 222 | Ga0157369_10053709 | 3300013105 | Bacteria | 4353 |
| 223 | Ga0157369_10103974 | 3300013105 | Bacteria | 3025 |
| 224 | Ga0157369_10109224 | 3300013105 | Bacteria | 2941 |
| 225 | Ga0157369_10123221 | 3300013105 | Bacteria | 2750 |
| 226 | Ga0157369_10201586 | 3300013105 | Bacteria | 2088 |
| 227 | Ga0157369_10317042 | 3300013105 | Unclassified | 1621 |
| 228 | Ga0157374_10003684 | 3300013296 | Bacteria | 12877 |
| 229 | Ga0157374_10040228 | 3300013296 | Bacteria | 4304 |
| 230 | Ga0157374_10212079 | 3300013296 | Bacteria | 1899 |
| 231 | Ga0157378_10013535 | 3300013297 | Bacteria | 7136 |
| 232 | Ga0157378_10068696 | 3300013297 | Bacteria | 3178 |
| 233 | Ga0163162_10007637 | 3300013306 | Bacteria | 10534 |
| 234 | Ga0157372_10000422 | 3300013307 | Bacteria | 46497 |
| 235 | Ga0157372_10001211 | 3300013307 | Bacteria | 27915 |
| 236 | Ga0157372_10001505 | 3300013307 | Bacteria | 25337 |
| 237 | Ga0157372_10002780 | 3300013307 | Bacteria | 18917 |
| 238 | Ga0157372_10005419 | 3300013307 | Bacteria | 13559 |
| 239 | Ga0157372_10010205 | 3300013307 | Bacteria | 9974 |
| 240 | Ga0157372_10014537 | 3300013307 | Bacteria | 8423 |
| 241 | Ga0157372_10029940 | 3300013307 | Bacteria | 5949 |
| 242 | Ga0157372_10077669 | 3300013307 | Bacteria | 3751 |
| 243 | Ga0157372_10114709 | 3300013307 | Bacteria | 3088 |
| 244 | Ga0157372_10118093 | 3300013307 | Bacteria | 3043 |
| 245 | Ga0157372_10159313 | 3300013307 | Bacteria | 2608 |
| 246 | Ga0157372_10188412 | 3300013307 | Bacteria | 2389 |
| 247 | Ga0157372_10489690 | 3300013307 | Bacteria | 1434 |
| 248 | Ga0157372_10540176 | 3300013307 | Unclassified | 1359 |
| 249 | Ga0157375_10009640 | 3300013308 | Bacteria | 8486 |
| 250 | Ga0157375_10013056 | 3300013308 | Bacteria | 7381 |
| 251 | Ga0163163_10000679 | 3300014325 | Bacteria | 29109 |
| 252 | Ga0182008_10092460 | 3300014497 | Bacteria | 1492 |
| 253 | Ga0182008_10112226 | 3300014497 | Bacteria | 1351 |
| 254 | Ga0157379_10000499 | 3300014968 | Bacteria | 31901 |
| 255 | Ga0157376_10006836 | 3300014969 | Bacteria | 8078 |
| 256 | Ga0157376_10049393 | 3300014969 | Bacteria | 3484 |
| 257 | Ga0182006_1013694 | 3300015261 | Bacteria | 3510 |
| 258 | Ga0197907_10413395 | 3300020069 | Bacteria | 2942 |
| 259 | Ga0206356_11119816 | 3300020070 | Bacteria | 5138 |
| 260 | Ga0206356_11224057 | 3300020070 | Bacteria | 4947 |
| 261 | Ga0206356_11259921 | 3300020070 | Bacteria | 3450 |
| 262 | Ga0206349_1887837 | 3300020075 | Bacteria | 2680 |
| 263 | Ga0206355_1317415 | 3300020076 | Unclassified | 3094 |
| 264 | Ga0206351_10173209 | 3300020077 | Bacteria | 2527 |
| 265 | Ga0206351_10279165 | 3300020077 | Unclassified | 1310 |
| 266 | Ga0206351_10397847 | 3300020077 | Bacteria | 4136 |
| 267 | Ga0206351_10501227 | 3300020077 | Bacteria | 1756 |
| 268 | Ga0206350_10152871 | 3300020080 | Bacteria | 2367 |
| 269 | Ga0206350_10326591 | 3300020080 | Bacteria | 3374 |
| 270 | Ga0206350_10331461 | 3300020080 | Bacteria | 6054 |
| 271 | Ga0206350_10856568 | 3300020080 | Bacteria | 5702 |
| 272 | Ga0206350_11147263 | 3300020080 | Bacteria | 5416 |
| 273 | Ga0206353_10373932 | 3300020082 | Bacteria | 2776 |
| 274 | Ga0206353_11873519 | 3300020082 | Bacteria | 1592 |
| 275 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 276 | Ga0213872_10021296 | 3300021361 | Bacteria | 2986 |
| 277 | Ga0213872_10038149 | 3300021361 | Bacteria | 2193 |
| 278 | Ga0213872_10074906 | 3300021361 | Bacteria | 1523 |
| 279 | Ga0213876_10000002 | 3300021384 | Bacteria | 1168769 |
| 280 | Ga0213875_10000022 | 3300021388 | Bacteria | 215075 |
| 281 | Ga0213875_10000098 | 3300021388 | Bacteria | 98684 |
| 282 | Ga0213875_10001132 | 3300021388 | Bacteria | 18346 |
| 283 | Ga0213875_10001220 | 3300021388 | Bacteria | 17409 |
| 284 | Ga0213875_10012047 | 3300021388 | Bacteria | 4283 |
| 285 | Ga0224712_10000481 | 3300022467 | Bacteria | 8011 |
| 286 | Ga0224712_10000924 | 3300022467 | Bacteria | 6318 |
| 287 | Ga0224712_10003449 | 3300022467 | Bacteria | 4109 |
| 288 | Ga0224712_10042673 | 3300022467 | Bacteria | 1720 |
| 289 | Ga0207666_1000203 | 3300025271 | Bacteria | 8848 |
| 290 | Ga0207697_10001245 | 3300025315 | Bacteria | 13958 |
| 291 | Ga0207697_10002753 | 3300025315 | Bacteria | 8971 |
| 292 | Ga0207656_10012886 | 3300025321 | Bacteria | 3185 |
| 293 | Ga0207656_10016389 | 3300025321 | Bacteria | 2884 |
| 294 | Ga0207656_10022804 | 3300025321 | Bacteria | 2515 |
| 295 | Ga0207692_10068186 | 3300025898 | Bacteria | 1864 |
| 296 | Ga0207692_10098504 | 3300025898 | Bacteria | 1600 |
| 297 | Ga0207710_10018498 | 3300025900 | Bacteria | 2964 |
| 298 | Ga0207705_10003383 | 3300025909 | Bacteria | 12130 |
| 299 | Ga0207705_10009770 | 3300025909 | Bacteria | 6983 |
| 300 | Ga0207705_10013790 | 3300025909 | Bacteria | 5827 |
| 301 | Ga0207705_10021455 | 3300025909 | Bacteria | 4609 |
| 302 | Ga0207705_10224550 | 3300025909 | Bacteria | 1427 |
| 303 | Ga0207654_10000380 | 3300025911 | Bacteria | 25850 |
| 304 | Ga0207654_10001262 | 3300025911 | Bacteria | 13476 |
| 305 | Ga0207654_10075093 | 3300025911 | Bacteria | 2019 |
| 306 | Ga0207707_10000481 | 3300025912 | Bacteria | 41355 |
| 307 | Ga0207707_10001382 | 3300025912 | Bacteria | 22527 |
| 308 | Ga0207707_10040309 | 3300025912 | Bacteria | 4079 |
| 309 | Ga0207695_10000002 | 3300025913 | Bacteria | 2188391 |
| 310 | Ga0207695_10000028 | 3300025913 | Bacteria | 551835 |
| 311 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 312 | Ga0207695_10000177 | 3300025913 | Bacteria | 185955 |
| 313 | Ga0207695_10000292 | 3300025913 | Bacteria | 123721 |
| 314 | Ga0207695_10003411 | 3300025913 | Bacteria | 22444 |
| 315 | Ga0207695_10013379 | 3300025913 | Bacteria | 9790 |
| 316 | Ga0207695_10018270 | 3300025913 | Bacteria | 8114 |
| 317 | Ga0207695_10029477 | 3300025913 | Bacteria | 6062 |
| 318 | Ga0207695_10031688 | 3300025913 | Bacteria | 5794 |
| 319 | Ga0207671_10000487 | 3300025914 | Bacteria | 53821 |
| 320 | Ga0207671_10003647 | 3300025914 | Bacteria | 15208 |
| 321 | Ga0207693_10040100 | 3300025915 | Bacteria | 3687 |
| 322 | Ga0207663_10124525 | 3300025916 | Unclassified | 1771 |
| 323 | Ga0207660_10000419 | 3300025917 | Bacteria | 28025 |
| 324 | Ga0207660_10006095 | 3300025917 | Bacteria | 7826 |
| 325 | Ga0207660_10023320 | 3300025917 | Bacteria | 4178 |
| 326 | Ga0207660_10120254 | 3300025917 | Bacteria | 1988 |
| 327 | Ga0207657_10002127 | 3300025919 | Bacteria | 21449 |
| 328 | Ga0207657_10041017 | 3300025919 | Bacteria | 4096 |
| 329 | Ga0207657_10060529 | 3300025919 | Bacteria | 3249 |
| 330 | Ga0207657_10128475 | 3300025919 | Bacteria | 2079 |
| 331 | Ga0207657_10176205 | 3300025919 | Unclassified | 1730 |
| 332 | Ga0207657_10234294 | 3300025919 | Bacteria | 1467 |
| 333 | Ga0207649_10001021 | 3300025920 | Bacteria | 17258 |
| 334 | Ga0207649_10036626 | 3300025920 | Bacteria | 2957 |
| 335 | Ga0207649_10047500 | 3300025920 | Bacteria | 2642 |
| 336 | Ga0207652_10000148 | 3300025921 | Bacteria | 75801 |
| 337 | Ga0207652_10002522 | 3300025921 | Bacteria | 15385 |
| 338 | Ga0207652_10054285 | 3300025921 | Bacteria | 3444 |
| 339 | Ga0207652_10171045 | 3300025921 | Bacteria | 1949 |
| 340 | Ga0207694_10000160 | 3300025924 | Bacteria | 68770 |
| 341 | Ga0207694_10001418 | 3300025924 | Bacteria | 20539 |
| 342 | Ga0207694_10003078 | 3300025924 | Bacteria | 13349 |
| 343 | Ga0207694_10016365 | 3300025924 | Bacteria | 5599 |
| 344 | Ga0207694_10034558 | 3300025924 | Bacteria | 3877 |
| 345 | Ga0207694_10073706 | 3300025924 | Bacteria | 2671 |
| 346 | Ga0207694_10195322 | 3300025924 | Unclassified | 1645 |
| 347 | Ga0207650_10006218 | 3300025925 | Bacteria | 8135 |
| 348 | Ga0207687_10000471 | 3300025927 | Bacteria | 27489 |
| 349 | Ga0207700_10013750 | 3300025928 | Bacteria | 5280 |
| 350 | Ga0207700_10085582 | 3300025928 | Bacteria | 2475 |
| 351 | Ga0207664_10058997 | 3300025929 | Bacteria | 3055 |
| 352 | Ga0207664_10385871 | 3300025929 | Bacteria | 1244 |
| 353 | Ga0207644_10018310 | 3300025931 | Bacteria | 4736 |
| 354 | Ga0207644_10027025 | 3300025931 | Bacteria | 3962 |
| 355 | Ga0207644_10029497 | 3300025931 | Bacteria | 3807 |
| 356 | Ga0207644_10073260 | 3300025931 | Bacteria | 2511 |
| 357 | Ga0207690_10095942 | 3300025932 | Bacteria | 2107 |
| 358 | Ga0207690_10101045 | 3300025932 | Bacteria | 2059 |
| 359 | Ga0207670_10010318 | 3300025936 | Bacteria | 5373 |
| 360 | Ga0207670_10055887 | 3300025936 | Bacteria | 2669 |
| 361 | Ga0207665_10023774 | 3300025939 | Bacteria | 4036 |
| 362 | Ga0207691_10104014 | 3300025940 | Bacteria | 2531 |
| 363 | Ga0207711_10024254 | 3300025941 | Bacteria | 5078 |
| 364 | Ga0207689_10006228 | 3300025942 | Bacteria | 10567 |
| 365 | Ga0207661_10020713 | 3300025944 | Bacteria | 4920 |
| 366 | Ga0207661_10026617 | 3300025944 | Bacteria | 4410 |
| 367 | Ga0207661_10041851 | 3300025944 | Bacteria | 3609 |
| 368 | Ga0207661_10089413 | 3300025944 | Bacteria | 2562 |
| 369 | Ga0207661_10163589 | 3300025944 | Bacteria | 1932 |
| 370 | Ga0207661_10215437 | 3300025944 | Bacteria | 1695 |
| 371 | Ga0207679_10052719 | 3300025945 | Bacteria | 2985 |
| 372 | Ga0207667_10000056 | 3300025949 | Bacteria | 206107 |
| 373 | Ga0207667_10002192 | 3300025949 | Bacteria | 24516 |
| 374 | Ga0207667_10003095 | 3300025949 | Bacteria | 20587 |
| 375 | Ga0207667_10014779 | 3300025949 | Bacteria | 8882 |
| 376 | Ga0207667_10014961 | 3300025949 | Bacteria | 8824 |
| 377 | Ga0207667_10044718 | 3300025949 | Bacteria | 4691 |
| 378 | Ga0207667_10060830 | 3300025949 | Bacteria | 3953 |
| 379 | Ga0207667_10156868 | 3300025949 | Bacteria | 2341 |
| 380 | Ga0207667_10188096 | 3300025949 | Bacteria | 2119 |
| 381 | Ga0207667_10206587 | 3300025949 | Bacteria | 2013 |
| 382 | Ga0207667_10242541 | 3300025949 | Bacteria | 1844 |
| 383 | Ga0207668_10074567 | 3300025972 | Bacteria | 2436 |
| 384 | Ga0207640_10004197 | 3300025981 | Bacteria | 7793 |
| 385 | Ga0207640_10070567 | 3300025981 | Bacteria | 2350 |
| 386 | Ga0207658_10000549 | 3300025986 | Bacteria | 34004 |
| 387 | Ga0207658_10041337 | 3300025986 | Bacteria | 3338 |
| 388 | Ga0207677_10000055 | 3300026023 | Bacteria | 98214 |
| 389 | Ga0207677_10099141 | 3300026023 | Bacteria | 2139 |
| 390 | Ga0207703_10072517 | 3300026035 | Bacteria | 2847 |
| 391 | Ga0207639_10000145 | 3300026041 | Bacteria | 53212 |
| 392 | Ga0207639_10000460 | 3300026041 | Bacteria | 28135 |
| 393 | Ga0207639_10016832 | 3300026041 | Bacteria | 5179 |
| 394 | Ga0207639_10027069 | 3300026041 | Bacteria | 4173 |
| 395 | Ga0207639_10154624 | 3300026041 | Bacteria | 1925 |
| 396 | Ga0207678_10011955 | 3300026067 | Bacteria | 7622 |
| 397 | Ga0207678_10045845 | 3300026067 | Bacteria | 3780 |
| 398 | Ga0207708_10195103 | 3300026075 | Bacteria | 1613 |
| 399 | Ga0207702_10001122 | 3300026078 | Bacteria | 27348 |
| 400 | Ga0207702_10035114 | 3300026078 | Bacteria | 4192 |
| 401 | Ga0207702_10067512 | 3300026078 | Bacteria | 3069 |
| 402 | Ga0207702_10224718 | 3300026078 | Bacteria | 1751 |
| 403 | Ga0207702_10259265 | 3300026078 | Bacteria | 1636 |
| 404 | Ga0207641_10000596 | 3300026088 | Bacteria | 39785 |
| 405 | Ga0207641_10203712 | 3300026088 | Bacteria | 1826 |
| 406 | Ga0207676_10002442 | 3300026095 | Bacteria | 13241 |
| 407 | Ga0207674_10001250 | 3300026116 | Bacteria | 33196 |
| 408 | Ga0207674_10002359 | 3300026116 | Bacteria | 23871 |
| 409 | Ga0207674_10020466 | 3300026116 | Bacteria | 7147 |
| 410 | Ga0207698_10000021 | 3300026142 | Bacteria | 133280 |
| 411 | Ga0207698_10061251 | 3300026142 | Bacteria | 2932 |
| 412 | Ga0207698_10066020 | 3300026142 | Bacteria | 2846 |
| 413 | Ga0207698_10191627 | 3300026142 | Unclassified | 1822 |
| 414 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 415 | Ga0268266_10000637 | 3300028379 | Bacteria | 47708 |
| 416 | Ga0268266_10148142 | 3300028379 | Bacteria | 2112 |
| 417 | Ga0268265_10075316 | 3300028380 | Bacteria | 2643 |
| 418 | Ga0268264_10000433 | 3300028381 | Bacteria | 57744 |
| 419 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 420 | Ga0265327_10027096 | 3300031251 | Bacteria | 3304 |
| 421 | Ga0307408_100019720 | 3300031548 | Bacteria | 4543 |
| 422 | Ga0307408_100085860 | 3300031548 | Bacteria | 2364 |
| 423 | Ga0307408_100119750 | 3300031548 | Bacteria | 2037 |
| 424 | Ga0307408_100157716 | 3300031548 | Bacteria | 1799 |
| 425 | Ga0316576_10007137 | 3300031727 | Bacteria | 7005 |
| 426 | Ga0316578_10000808 | 3300031728 | Bacteria | 11611 |
| 427 | Ga0307516_10007406 | 3300031730 | Bacteria | 12625 |
| 428 | Ga0307405_10026664 | 3300031731 | Bacteria | 3337 |
| 429 | Ga0307405_10051826 | 3300031731 | Bacteria | 2548 |
| 430 | Ga0307405_10056826 | 3300031731 | Bacteria | 2455 |
| 431 | Ga0307405_10163311 | 3300031731 | Bacteria | 1580 |
| 432 | Ga0307413_10004354 | 3300031824 | Bacteria | 6149 |
| 433 | Ga0307413_10035950 | 3300031824 | Bacteria | 2847 |
| 434 | Ga0307413_10063501 | 3300031824 | Bacteria | 2290 |
| 435 | Ga0307410_10000012 | 3300031852 | Bacteria | 79112 |
| 436 | Ga0307410_10073607 | 3300031852 | Bacteria | 2376 |
| 437 | Ga0307406_10000429 | 3300031901 | Bacteria | 24463 |
| 438 | Ga0307406_10128122 | 3300031901 | Bacteria | 1777 |
| 439 | Ga0307407_10000809 | 3300031903 | Bacteria | 10369 |
| 440 | Ga0307407_10003796 | 3300031903 | Bacteria | 6287 |
| 441 | Ga0307407_10004745 | 3300031903 | Bacteria | 5813 |
| 442 | Ga0307407_10038198 | 3300031903 | Bacteria | 2659 |
| 443 | Ga0307407_10057291 | 3300031903 | Bacteria | 2260 |
| 444 | Ga0307407_10057996 | 3300031903 | Bacteria | 2249 |
| 445 | Ga0307407_10094190 | 3300031903 | Bacteria | 1843 |
| 446 | Ga0307412_10020065 | 3300031911 | Bacteria | 4061 |
| 447 | Ga0307412_10027125 | 3300031911 | Bacteria | 3568 |
| 448 | Ga0307412_10078647 | 3300031911 | Bacteria | 2273 |
| 449 | Ga0307412_10081163 | 3300031911 | Bacteria | 2242 |
| 450 | Ga0307412_10091642 | 3300031911 | Bacteria | 2128 |
| 451 | Ga0307412_10095834 | 3300031911 | Bacteria | 2087 |
| 452 | Ga0307412_10192740 | 3300031911 | Bacteria | 1542 |
| 453 | Ga0307412_10205765 | 3300031911 | Bacteria | 1498 |
| 454 | Ga0307409_100000202 | 3300031995 | Bacteria | 23457 |
| 455 | Ga0307409_100000776 | 3300031995 | Bacteria | 14462 |
| 456 | Ga0307409_100008829 | 3300031995 | Bacteria | 6147 |
| 457 | Ga0307409_100016125 | 3300031995 | Bacteria | 4933 |
| 458 | Ga0307409_100019725 | 3300031995 | Bacteria | 4574 |
| 459 | Ga0307409_100028392 | 3300031995 | Bacteria | 3985 |
| 460 | Ga0307416_100002055 | 3300032002 | Bacteria | 11334 |
| 461 | Ga0307416_100004513 | 3300032002 | Bacteria | 8405 |
| 462 | Ga0307416_100004568 | 3300032002 | Bacteria | 8366 |
| 463 | Ga0307416_100008103 | 3300032002 | Bacteria | 6744 |
| 464 | Ga0307416_100012459 | 3300032002 | Bacteria | 5730 |
| 465 | Ga0307416_100104559 | 3300032002 | Bacteria | 2476 |
| 466 | Ga0307416_100141337 | 3300032002 | Bacteria | 2188 |
| 467 | Ga0307416_100216193 | 3300032002 | Bacteria | 1834 |
| 468 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 469 | Ga0307414_10000187 | 3300032004 | Bacteria | 42062 |
| 470 | Ga0307414_10028651 | 3300032004 | Bacteria | 3615 |
| 471 | Ga0307414_10032764 | 3300032004 | Bacteria | 3426 |
| 472 | Ga0307414_10035984 | 3300032004 | Bacteria | 3300 |
| 473 | Ga0307414_10054596 | 3300032004 | Bacteria | 2793 |
| 474 | Ga0307411_10000001 | 3300032005 | Bacteria | 931810 |
| 475 | Ga0307411_10010072 | 3300032005 | Bacteria | 5017 |
| 476 | Ga0307411_10025703 | 3300032005 | Bacteria | 3533 |
| 477 | Ga0307411_10149928 | 3300032005 | Bacteria | 1731 |
| 478 | Ga0307411_10151253 | 3300032005 | Bacteria | 1725 |
| 479 | Ga0307415_100006483 | 3300032126 | Bacteria | 6320 |
| 480 | Ga0307415_100091304 | 3300032126 | Bacteria | 2205 |
| 481 | Ga0307415_100153009 | 3300032126 | Bacteria | 1778 |
| 482 | Ga0307415_100167392 | 3300032126 | Bacteria | 1710 |
| 483 | Ga0307415_100284513 | 3300032126 | Bacteria | 1361 |
| 484 | Ga0316580_10003585 | 3300032139 | Bacteria | 4420 |
| 485 | Ga0373926_0009750 | 3300035083 | Bacteria | 3209 |
| 486 | Ga0373953_0007522 | 3300035117 | Bacteria | 3653 |
| 487 | Ga0373954_0022354 | 3300035118 | Bacteria | 2868 |
| 488 | Ga0373956_0037041 | 3300035119 | Bacteria | 2155 |
| 489 | Ga0373933_0005010 | 3300035724 | Bacteria | 7225 |
| 490 | Ga0373937_0008999 | 3300036401 | Bacteria | 8668 |
| 491 | Ga0316584_0004516 | 3300036712 | Bacteria | 9213 |
| 492 | Ga0316584_0037359 | 3300036712 | Bacteria | 3608 |
| 493 | Ga0373925_0282298 | 3300037068 | Bacteria | 1337 |
| 494 | Ga0395900_0108357 | 3300037418 | Bacteria | 2854 |
| 495 | Ga0395898_0019877 | 3300037466 | Bacteria | 6830 |
| 496 | Ga0395898_0223176 | 3300037466 | Bacteria | 1797 |
| 497 | Ga0395905_0046822 | 3300037471 | Bacteria | 4055 |
| 498 | Ga0395905_0407569 | 3300037471 | Bacteria | 1255 |
| 499 | Ga0436364_0530951 | 3300037853 | Bacteria | 215117 |
| 500 | Ga0436364_0558108 | 3300037853 | Bacteria | 39499 |
| 501 | Ga0436364_0566500 | 3300037853 | Bacteria | 56428 |
| 502 | Ga0436364_0927813 | 3300037853 | Unclassified | 2114 |
| 503 | Ga0436364_1325276 | 3300037853 | Bacteria | 58128 |
| 504 | Ga0436364_1390920 | 3300037853 | Bacteria | 113944 |
| 505 | Ga0436365_0190860 | 3300039437 | Bacteria | 42582 |
| 506 | Ga0436365_0281631 | 3300039437 | Bacteria | 1899 |
| 507 | Ga0436365_0813146 | 3300039437 | Unclassified | 1253 |
| 508 | Ga0436365_1528146 | 3300039437 | Bacteria | 1868 |
| 509 | Ga0436360_0034025 | 3300039438 | Unclassified | 2176 |
| 510 | Ga0436360_0129245 | 3300039438 | Bacteria | 1989 |
| 511 | Ga0436360_0247545 | 3300039438 | Bacteria | 8033 |
| 512 | Ga0436360_0257927 | 3300039438 | Bacteria | 6020 |
| 513 | Ga0436360_0373346 | 3300039438 | Bacteria | 2525 |
| 514 | Ga0436361_0221137 | 3300039447 | Bacteria | 5102 |
| 515 | Ga0436361_0323325 | 3300039447 | Bacteria | 1831 |
| 516 | Ga0436361_0523980 | 3300039447 | Unclassified | 4960 |
| 517 | Ga0436361_0765221 | 3300039447 | Bacteria | 9171 |
| 518 | Ga0436361_0941399 | 3300039447 | Bacteria | 1217 |
| 519 | Ga0436361_0997213 | 3300039447 | Bacteria | 24500 |
| 520 | Ga0436363_0834601 | 3300039450 | Bacteria | 6944 |
| 521 | Ga0436362_0429742 | 3300039453 | Bacteria | 1569 |
| 522 | Ga0436362_0649416 | 3300039453 | Bacteria | 210038 |
| 523 | Ga0439445_0035105 | 3300042004 | Bacteria | 1316 |
| 524 | Ga0439448_0017508 | 3300042005 | Bacteria | 2189 |
| 525 | Ga0451577_0301872 | 3300042876 | Bacteria | 1451 |
| 526 | Ga0453683_0000194 | 3300044673 | Bacteria | 83328 |
| 527 | Ga0453683_0000655 | 3300044673 | Bacteria | 37122 |
| 528 | Ga0453683_0009023 | 3300044673 | Bacteria | 6660 |
| 529 | Ga0466966_0146274 | 3300044684 | Bacteria | 1442 |
| 530 | Ga0466961_0099692 | 3300044693 | Bacteria | 1831 |
| 531 | Ga0466963_0022152 | 3300044694 | Bacteria | 4021 |
| 532 | Ga0466963_0097910 | 3300044694 | Bacteria | 2005 |
| 533 | Ga0453684_0001086 | 3300044712 | Bacteria | 86208 |
| 534 | Ga0453684_0001215 | 3300044712 | Bacteria | 79022 |
| 535 | Ga0453684_0001854 | 3300044712 | Bacteria | 55179 |
| 536 | Ga0453684_0045814 | 3300044712 | Bacteria | 5828 |
| 537 | Ga0453684_0095925 | 3300044712 | Bacteria | 3644 |
| 538 | Ga0453684_0124438 | 3300044712 | Bacteria | 3106 |
| 539 | Ga0453684_0283778 | 3300044712 | Bacteria | 1887 |
| 540 | Ga0466971_0000020 | 3300044719 | Bacteria | 78865 |
| 541 | Ga0466970_0002918 | 3300044765 | Bacteria | 8287 |
| 542 | Ga0466957_0009810 | 3300044842 | Bacteria | 5474 |
| 543 | Ga0466957_0041836 | 3300044842 | Bacteria | 2771 |
| 544 | Ga0466957_0080447 | 3300044842 | Bacteria | 2028 |
| 545 | Ga0466959_0071712 | 3300045049 | Bacteria | 2508 |
| 546 | Ga0466959_0222703 | 3300045049 | Bacteria | 1308 |
| 547 | Ga0451576_0000135 | 3300045051 | Bacteria | 186763 |
| 548 | Ga0451576_0005678 | 3300045051 | Bacteria | 15571 |
| 549 | Ga0466958_0038998 | 3300045836 | Bacteria | 2852 |
| 550 | Ga0466958_0084694 | 3300045836 | Bacteria | 1955 |
| 551 | Ga0466967_0002127 | 3300045976 | Bacteria | 12138 |
| 552 | Ga0466967_0019542 | 3300045976 | Bacteria | 5450 |
| 553 | Ga0466967_0024454 | 3300045976 | Unclassified | 4966 |
| 554 | Ga0466967_0034868 | 3300045976 | Bacteria | 4276 |
| 555 | Ga0466967_0044823 | 3300045976 | Bacteria | 3839 |
| 556 | Ga0466967_0062381 | 3300045976 | Bacteria | 3308 |
| 557 | Ga0495580_0044422 | 3300046472 | Bacteria | 3160 |
| 558 | Ga0495610_0000741 | 3300046512 | Bacteria | 30987 |
| 559 | Ga0495620_0001937 | 3300046515 | Bacteria | 12117 |
| 560 | Ga0495620_0026522 | 3300046515 | Bacteria | 2724 |
| 561 | Ga0495632_0019430 | 3300046519 | Bacteria | 3702 |
| 562 | Ga0495642_0055178 | 3300046528 | Bacteria | 1640 |
| 563 | Ga0495645_0023850 | 3300046543 | Bacteria | 4435 |
| 564 | Ga0495625_0012365 | 3300046660 | Bacteria | 6918 |
| 565 | Ga0495686_0007303 | 3300047472 | Bacteria | 8303 |
| 566 | Ga0495686_0011196 | 3300047472 | Bacteria | 6328 |
| 567 | Ga0496102_0153433 | 3300048905 | Bacteria | 2165 |
| 568 | Ga0496104_0014966 | 3300048907 | Bacteria | 7017 |
| 569 | Ga0496108_0308875 | 3300048911 | Bacteria | 1378 |
| 570 | Ga0496109_0109004 | 3300048912 | Bacteria | 2574 |
| 571 | Ga0496112_0003611 | 3300048915 | Bacteria | 12880 |
| 572 | Ga0496112_0038502 | 3300048915 | Unclassified | 4669 |
| 573 | Ga0496112_0284605 | 3300048915 | Bacteria | 1600 |
| 574 | Ga0496113_0017282 | 3300048916 | Bacteria | 5003 |
| 575 | Ga0501323_004310 | 3300049539 | Unclassified | 1499 |
| 576 | Ga0501031_0014975 | 3300049568 | Bacteria | 5037 |
| 577 | Ga0501031_0039359 | 3300049568 | Bacteria | 3085 |
| 578 | Ga0501033_0019236 | 3300049570 | Bacteria | 5162 |
| 579 | Ga0501034_0142646 | 3300049571 | Bacteria | 2374 |
| 580 | Ga0501034_0239515 | 3300049571 | Bacteria | 1761 |
| 581 | Ga0501036_0024337 | 3300049572 | Bacteria | 5104 |
| 582 | Ga0501036_0030940 | 3300049572 | Bacteria | 4523 |
| 583 | Ga0501037_0000240 | 3300049573 | Bacteria | 47068 |
| 584 | Ga0501038_0030585 | 3300049574 | Bacteria | 4762 |
| 585 | Ga0501038_0036575 | 3300049574 | Bacteria | 4308 |
| 586 | Ga0501039_0049676 | 3300049575 | Bacteria | 3243 |
| 587 | Ga0501039_0145499 | 3300049575 | Bacteria | 1862 |
| 588 | Ga0501040_0001682 | 3300049576 | Bacteria | 14164 |
| 589 | Ga0501040_0069168 | 3300049576 | Bacteria | 2435 |
| 590 | Ga0501041_0003044 | 3300049577 | Bacteria | 9618 |
| 591 | Ga0501042_0000935 | 3300049578 | Bacteria | 16467 |
| 592 | Ga0501042_0005151 | 3300049578 | Bacteria | 8391 |
| 593 | Ga0501043_0049989 | 3300049579 | Bacteria | 3287 |
| 594 | Ga0501046_0007013 | 3300049580 | Bacteria | 9926 |
| 595 | Ga0501046_0087707 | 3300049580 | Bacteria | 2397 |
| 596 | Ga0501047_0235683 | 3300049581 | Bacteria | 1682 |
| 597 | Ga0501048_0034730 | 3300049582 | Bacteria | 3635 |
| 598 | Ga0501048_0039381 | 3300049582 | Bacteria | 3391 |
| 599 | Ga0501067_0000849 | 3300049583 | Bacteria | 16474 |
| 600 | Ga0501067_0049823 | 3300049583 | Bacteria | 2321 |
| 601 | Ga0501067_0064111 | 3300049583 | Bacteria | 2035 |
| 602 | Ga0501068_0009520 | 3300049584 | Bacteria | 5440 |
| 603 | Ga0501069_0081649 | 3300049585 | Bacteria | 1821 |
| 604 | Ga0501070_0019217 | 3300049586 | Bacteria | 5730 |
| 605 | Ga0501070_0040158 | 3300049586 | Bacteria | 3902 |
| 606 | Ga0501071_0005144 | 3300049587 | Bacteria | 8380 |
| 607 | Ga0501071_0014009 | 3300049587 | Bacteria | 5479 |
| 608 | Ga0501071_0103433 | 3300049587 | Bacteria | 2101 |
| 609 | Ga0501072_0026890 | 3300049588 | Bacteria | 4489 |
| 610 | Ga0501072_0183338 | 3300049588 | Bacteria | 1670 |
| 611 | Ga0501073_0005253 | 3300049589 | Bacteria | 9709 |
| 612 | Ga0501073_0135221 | 3300049589 | Bacteria | 1709 |
| 613 | Ga0501073_0228257 | 3300049589 | Bacteria | 1286 |
| 614 | Ga0501074_0051307 | 3300049590 | Bacteria | 2977 |
| 615 | Ga0501075_0029266 | 3300049591 | Bacteria | 4072 |
| 616 | Ga0501075_0058535 | 3300049591 | Bacteria | 2902 |
| 617 | Ga0501075_0238847 | 3300049591 | Bacteria | 1385 |
| 618 | Ga0501076_0005738 | 3300049592 | Bacteria | 8945 |
| 619 | Ga0501076_0011665 | 3300049592 | Bacteria | 6558 |
| 620 | Ga0501076_0013165 | 3300049592 | Bacteria | 6196 |
| 621 | Ga0501076_0175046 | 3300049592 | Bacteria | 1749 |
| 622 | Ga0501076_0198657 | 3300049592 | Bacteria | 1637 |
| 623 | Ga0501077_0000046 | 3300049593 | Bacteria | 62239 |
| 624 | Ga0501077_0049491 | 3300049593 | Bacteria | 2671 |
| 625 | Ga0501224_009848 | 3300049664 | Unclassified | 1399 |
| 626 | Ga0501238_000091 | 3300049671 | Bacteria | 14462 |
| 627 | Ga0501249_000011 | 3300049679 | Bacteria | 168084 |
| 628 | Ga0501249_000854 | 3300049679 | Bacteria | 6757 |
| 629 | Ga0501249_024946 | 3300049679 | Bacteria | 1318 |
| 630 | Ga0501079_0017878 | 3300049741 | Bacteria | 5415 |
| 631 | Ga0501080_0004063 | 3300049742 | Bacteria | 12958 |
| 632 | Ga0501080_0047224 | 3300049742 | Bacteria | 4008 |
| 633 | Ga0501080_0081093 | 3300049742 | Bacteria | 3015 |
| 634 | Ga0501080_0258375 | 3300049742 | Bacteria | 1587 |
| 635 | Ga0501083_0001353 | 3300049744 | Bacteria | 16651 |
| 636 | Ga0501266_000016 | 3300049763 | Bacteria | 164181 |
| 637 | Ga0501280_000271 | 3300049776 | Bacteria | 13166 |
| 638 | Ga0501035_0006113 | 3300049822 | Bacteria | 11333 |
| 639 | Ga0501035_0057940 | 3300049822 | Bacteria | 3453 |
| 640 | Ga0501035_0318909 | 3300049822 | Bacteria | 1306 |
| 641 | Ga0501044_0000957 | 3300049823 | Bacteria | 34681 |
| 642 | Ga0501044_0249872 | 3300049823 | Bacteria | 1715 |
| 643 | Ga0501045_0043791 | 3300049824 | Bacteria | 3260 |
| 644 | Ga0501045_0201832 | 3300049824 | Bacteria | 1481 |
| 645 | nmdc:mga06z11_74688_c1 | 3300050494 | Bacteria | 1803 |
| 646 | nmdc:mga0n895_2275_c1 | 3300050512 | Bacteria | 14895 |
| 647 | nmdc:mga0rr50_29956_c1 | 3300050513 | Bacteria | 3846 |
| 648 | nmdc:mga08x19_20979_c1 | 3300050514 | Bacteria | 4029 |
| 649 | nmdc:mga08x19_4578_c1 | 3300050514 | Bacteria | 8208 |
| 650 | nmdc:mga0a205_6325_c1 | 3300050515 | Bacteria | 10690 |
| 651 | Ga0495655_0031599 | 3300053083 | Bacteria | 1289 |
| 652 | Ga0500633_0000311 | 3300053160 | Bacteria | 7182 |
| 653 | Ga0501084_0085793 | 3300054114 | Bacteria | 2643 |
| 654 | Ga0501084_0168728 | 3300054114 | Bacteria | 1847 |
| 655 | Ga0590071_000585 | 3300059421 | Bacteria | 10495 |
| 656 | Ga0590071_000919 | 3300059421 | Bacteria | 8163 |
| 657 | Ga0590071_000953 | 3300059421 | Bacteria | 8000 |
| 658 | Ga0590071_007895 | 3300059421 | Bacteria | 2516 |
| 659 | Ga0590071_017868 | 3300059421 | Bacteria | 1667 |
| 660 | Ga0590071_019247 | 3300059421 | Bacteria | 1606 |
| 661 | Ga0590071_025947 | 3300059421 | Bacteria | 1390 |
| 662 | Ga0590074_001496 | 3300059423 | Bacteria | 3773 |
| 663 | Ga0590074_002612 | 3300059423 | Bacteria | 2956 |
| 664 | Ga0590074_007523 | 3300059423 | Bacteria | 1810 |
| 665 | Ga0590075_001890 | 3300059424 | Bacteria | 5082 |
| 666 | Ga0590077_000022 | 3300059426 | Bacteria | 35588 |
| 667 | Ga0590077_000232 | 3300059426 | Bacteria | 15988 |
| 668 | Ga0587084_002340 | 3300059477 | Unclassified | 1950 |
| 669 | Ga0587093_004122 | 3300059478 | Bacteria | 1465 |
| 670 | Ga0587066_000022 | 3300059490 | Bacteria | 7063 |
| 671 | Ga0587077_000609 | 3300059493 | Unclassified | 3232 |
| 672 | Ga0587080_000484 | 3300059503 | Unclassified | 3414 |
| 673 | Ga0587082_000015 | 3300059504 | Bacteria | 8062 |
| 674 | Ga0587085_000330 | 3300059506 | Unclassified | 3276 |
| 675 | Ga0587088_000816 | 3300059508 | Unclassified | 2902 |
| 676 | Ga0587091_000091 | 3300059511 | Bacteria | 5068 |
| 677 | Ga0587094_000263 | 3300059513 | Unclassified | 3602 |
| 678 | Ga0587099_000992 | 3300059622 | Unclassified | 1895 |
| 679 | Ga0587072_000992 | 3300059643 | Unclassified | 3304 |
| 680 | Ga0587075_000008 | 3300059644 | Bacteria | 9548 |
| 681 | Ga0501082_0000072 | 3300060353 | Bacteria | 73322 |
| 682 | Ga0501082_0002039 | 3300060353 | Bacteria | 17754 |
| 683 | Ga0501082_0232812 | 3300060353 | Bacteria | 1603 |
| 684 | Ga0466962_0000017 | 3300061719 | Bacteria | 97361 |
| 685 | Ga0466962_0025790 | 3300061719 | Bacteria | 2821 |
| 686 | Ga0530510_0047805 | 3300061734 | Bacteria | 3092 |
| 687 | Ga0530510_0113535 | 3300061734 | Bacteria | 1985 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049539 | Ga0501323_004310 | Ga0501323_004310_498_1481 | 327 |
| 2 | 3300045049 | Ga0466959_0222703 | Ga0466959_0222703_89_1096 | 331 |
| 3 | 3300061719 | Ga0466962_0025790 | Ga0466962_0025790_1762_2811 | 332 |
| 4 | 3300039447 | Ga0436361_0323325 | Ga0436361_0323325_780_1817 | 341 |
| 5 | 3300009545 | Ga0105237_10083831 | Ga0105237_100838312 | 344 |
| 6 | 3300046528 | Ga0495642_0055178 | Ga0495642_0055178_546_1604 | 344 |
| 7 | 3300045976 | Ga0466967_0019542 | Ga0466967_0019542_2177_3295 | 348 |
| 8 | 3300044694 | Ga0466963_0022152 | Ga0466963_0022152_2114_3226 | 352 |
| 9 | 3300044842 | Ga0466957_0009810 | Ga0466957_0009810_801_1913 | 352 |
| 10 | 3300045836 | Ga0466958_0038998 | Ga0466958_0038998_204_1316 | 352 |
| 11 | 3300049592 | Ga0501076_0175046 | Ga0501076_0175046_389_1504 | 354 |
| 12 | 3300032002 | Ga0307416_100216193 | Ga0307416_1002161931 | 355 |
| 13 | 3300006914 | Ga0075436_100000256 | Ga0075436_10000025615 | 356 |
| 14 | 3300009093 | Ga0105240_10027417 | Ga0105240_100274175 | 356 |
| 15 | 3300050514 | nmdc:mga08x19_4578_c1 | nmdc:mga08x19_4578_c1_1130_2251 | 356 |
| 16 | 3300009174 | Ga0105241_10000074 | Ga0105241_1000007417 | 357 |
| 17 | 3300010375 | Ga0105239_10179478 | Ga0105239_101794782 | 357 |
| 18 | 3300025911 | Ga0207654_10000380 | Ga0207654_1000038016 | 357 |
| 19 | 3300044712 | Ga0453684_0095925 | Ga0453684_0095925_401_1522 | 357 |
| 20 | 3300049568 | Ga0501031_0014975 | Ga0501031_0014975_1260_2375 | 357 |
| 21 | 3300049570 | Ga0501033_0019236 | Ga0501033_0019236_3773_4888 | 357 |
| 22 | 3300049572 | Ga0501036_0024337 | Ga0501036_0024337_136_1251 | 357 |
| 23 | 3300049574 | Ga0501038_0030585 | Ga0501038_0030585_3200_4315 | 357 |
| 24 | 3300049575 | Ga0501039_0145499 | Ga0501039_0145499_514_1629 | 357 |
| 25 | 3300049580 | Ga0501046_0007013 | Ga0501046_0007013_3757_4872 | 357 |
| 26 | 3300049583 | Ga0501067_0000849 | Ga0501067_0000849_1733_2848 | 357 |
| 27 | 3300049584 | Ga0501068_0009520 | Ga0501068_0009520_3024_4139 | 357 |
| 28 | 3300049586 | Ga0501070_0019217 | Ga0501070_0019217_3313_4428 | 357 |
| 29 | 3300049587 | Ga0501071_0005144 | Ga0501071_0005144_3333_4448 | 357 |
| 30 | 3300049589 | Ga0501073_0005253 | Ga0501073_0005253_3547_4662 | 357 |
| 31 | 3300049591 | Ga0501075_0238847 | Ga0501075_0238847_59_1174 | 357 |
| 32 | 3300049592 | Ga0501076_0198657 | Ga0501076_0198657_181_1296 | 357 |
| 33 | 3300049741 | Ga0501079_0017878 | Ga0501079_0017878_2998_4113 | 357 |
| 34 | 3300049824 | Ga0501045_0043791 | Ga0501045_0043791_300_1415 | 357 |
| 35 | 3300060353 | Ga0501082_0002039 | Ga0501082_0002039_2651_3766 | 357 |
| 36 | 3300037466 | Ga0395898_0019877 | Ga0395898_0019877_4290_5408 | 359 |
| 37 | 3300044842 | Ga0466957_0041836 | Ga0466957_0041836_386_1471 | 359 |
| 38 | 3300059477 | Ga0587084_002340 | Ga0587084_002340_120_1238 | 359 |
| 39 | 3300059478 | Ga0587093_004122 | Ga0587093_004122_262_1380 | 359 |
| 40 | 3300059490 | Ga0587066_000022 | Ga0587066_000022_3806_4924 | 359 |
| 41 | 3300059493 | Ga0587077_000609 | Ga0587077_000609_1843_2961 | 359 |
| 42 | 3300059503 | Ga0587080_000484 | Ga0587080_000484_1933_3051 | 359 |
| 43 | 3300059504 | Ga0587082_000015 | Ga0587082_000015_4797_5915 | 359 |
| 44 | 3300059506 | Ga0587085_000330 | Ga0587085_000330_1765_2883 | 359 |
| 45 | 3300059508 | Ga0587088_000816 | Ga0587088_000816_1394_2512 | 359 |
| 46 | 3300059511 | Ga0587091_000091 | Ga0587091_000091_2158_3276 | 359 |
| 47 | 3300059513 | Ga0587094_000263 | Ga0587094_000263_425_1543 | 359 |
| 48 | 3300059622 | Ga0587099_000992 | Ga0587099_000992_425_1543 | 359 |
| 49 | 3300059643 | Ga0587072_000992 | Ga0587072_000992_1784_2902 | 359 |
| 50 | 3300059644 | Ga0587075_000008 | Ga0587075_000008_6644_7762 | 359 |
| 51 | 3300005344 | Ga0070661_100035295 | Ga0070661_1000352953 | 360 |
| 52 | 3300005344 | Ga0070661_100061373 | Ga0070661_1000613732 | 360 |
| 53 | 3300005535 | Ga0070684_100063457 | Ga0070684_1000634572 | 360 |
| 54 | 3300005539 | Ga0068853_100000645 | Ga0068853_10000064512 | 360 |
| 55 | 3300005539 | Ga0068853_100080059 | Ga0068853_1000800592 | 360 |
| 56 | 3300005563 | Ga0068855_100003472 | Ga0068855_10000347211 | 360 |
| 57 | 3300005563 | Ga0068855_100017874 | Ga0068855_1000178745 | 360 |
| 58 | 3300005577 | Ga0068857_100007995 | Ga0068857_1000079956 | 360 |
| 59 | 3300005578 | Ga0068854_100007202 | Ga0068854_1000072025 | 360 |
| 60 | 3300005614 | Ga0068856_100023721 | Ga0068856_1000237213 | 360 |
| 61 | 3300005616 | Ga0068852_100029057 | Ga0068852_1000290576 | 360 |
| 62 | 3300005834 | Ga0068851_10017700 | Ga0068851_100177004 | 360 |
| 63 | 3300009093 | Ga0105240_10012189 | Ga0105240_100121894 | 360 |
| 64 | 3300009093 | Ga0105240_10015500 | Ga0105240_100155002 | 360 |
| 65 | 3300009174 | Ga0105241_10002755 | Ga0105241_1000275511 | 360 |
| 66 | 3300009545 | Ga0105237_10004817 | Ga0105237_1000481714 | 360 |
| 67 | 3300009551 | Ga0105238_10028496 | Ga0105238_100284965 | 360 |
| 68 | 3300009551 | Ga0105238_10075818 | Ga0105238_100758182 | 360 |
| 69 | 3300010375 | Ga0105239_10036104 | Ga0105239_100361043 | 360 |
| 70 | 3300013105 | Ga0157369_10005663 | Ga0157369_1000566312 | 360 |
| 71 | 3300013105 | Ga0157369_10021141 | Ga0157369_100211412 | 360 |
| 72 | 3300013105 | Ga0157369_10103974 | Ga0157369_101039743 | 360 |
| 73 | 3300013307 | Ga0157372_10001505 | Ga0157372_100015057 | 360 |
| 74 | 3300013307 | Ga0157372_10005419 | Ga0157372_100054198 | 360 |
| 75 | 3300013307 | Ga0157372_10114709 | Ga0157372_101147092 | 360 |
| 76 | 3300013307 | Ga0157372_10489690 | Ga0157372_104896901 | 360 |
| 77 | 3300020080 | Ga0206350_10856568 | Ga0206350_108565685 | 360 |
| 78 | 3300022467 | Ga0224712_10000481 | Ga0224712_100004815 | 360 |
| 79 | 3300025321 | Ga0207656_10016389 | Ga0207656_100163892 | 360 |
| 80 | 3300025913 | Ga0207695_10003411 | Ga0207695_1000341114 | 360 |
| 81 | 3300025913 | Ga0207695_10031688 | Ga0207695_100316883 | 360 |
| 82 | 3300025914 | Ga0207671_10003647 | Ga0207671_100036472 | 360 |
| 83 | 3300025920 | Ga0207649_10047500 | Ga0207649_100475002 | 360 |
| 84 | 3300025924 | Ga0207694_10000160 | Ga0207694_1000016013 | 360 |
| 85 | 3300025924 | Ga0207694_10016365 | Ga0207694_100163652 | 360 |
| 86 | 3300025944 | Ga0207661_10020713 | Ga0207661_100207133 | 360 |
| 87 | 3300025949 | Ga0207667_10044718 | Ga0207667_100447183 | 360 |
| 88 | 3300025981 | Ga0207640_10004197 | Ga0207640_100041975 | 360 |
| 89 | 3300026041 | Ga0207639_10000145 | Ga0207639_1000014539 | 360 |
| 90 | 3300026078 | Ga0207702_10035114 | Ga0207702_100351143 | 360 |
| 91 | 3300026116 | Ga0207674_10020466 | Ga0207674_100204662 | 360 |
| 92 | 3300005435 | Ga0070714_100134707 | Ga0070714_1001347071 | 361 |
| 93 | 3300025929 | Ga0207664_10385871 | Ga0207664_103858711 | 361 |
| 94 | 3300045976 | Ga0466967_0044823 | Ga0466967_0044823_1693_2784 | 361 |
| 95 | 3300045976 | Ga0466967_0034868 | Ga0466967_0034868_613_1728 | 363 |
| 96 | 3300045976 | Ga0466967_0062381 | Ga0466967_0062381_1943_3040 | 363 |
| 97 | 3300049583 | Ga0501067_0049823 | Ga0501067_0049823_50_1171 | 364 |
| 98 | 3300036712 | Ga0316584_0037359 | Ga0316584_0037359_2241_3359 | 365 |
| 99 | 3300005329 | Ga0070683_100070223 | Ga0070683_1000702232 | 366 |
| 100 | 3300005439 | Ga0070711_100227387 | Ga0070711_1002273872 | 366 |
| 101 | 3300013307 | Ga0157372_10002780 | Ga0157372_1000278015 | 366 |
| 102 | 3300021388 | Ga0213875_10001132 | Ga0213875_100011324 | 366 |
| 103 | 3300037853 | Ga0436364_0566500 | Ga0436364_0566500_52974_54125 | 366 |
| 104 | 3300044694 | Ga0466963_0097910 | Ga0466963_0097910_733_1851 | 366 |
| 105 | 3300045976 | Ga0466967_0024454 | Ga0466967_0024454_3338_4486 | 366 |
| 106 | iso_pu_bacteria | 2857613821 | 2857614856 | 366 |
| 107 | 3300004799 | Ga0058863_11748332 | Ga0058863_117483323 | 367 |
| 108 | 3300004803 | Ga0058862_12292174 | Ga0058862_122921742 | 367 |
| 109 | 3300004803 | Ga0058862_12842061 | Ga0058862_128420613 | 367 |
| 110 | 3300005327 | Ga0070658_10002428 | Ga0070658_1000242813 | 367 |
| 111 | 3300005327 | Ga0070658_10010486 | Ga0070658_100104862 | 367 |
| 112 | 3300005327 | Ga0070658_10045618 | Ga0070658_100456183 | 367 |
| 113 | 3300005327 | Ga0070658_10046302 | Ga0070658_100463023 | 367 |
| 114 | 3300005327 | Ga0070658_10348271 | Ga0070658_103482711 | 367 |
| 115 | 3300005329 | Ga0070683_100003153 | Ga0070683_10000315312 | 367 |
| 116 | 3300005329 | Ga0070683_100039535 | Ga0070683_1000395354 | 367 |
| 117 | 3300005329 | Ga0070683_100204148 | Ga0070683_1002041482 | 367 |
| 118 | 3300005331 | Ga0070670_100001140 | Ga0070670_10000114011 | 367 |
| 119 | 3300005334 | Ga0068869_100003119 | Ga0068869_1000031192 | 367 |
| 120 | 3300005336 | Ga0070680_100006987 | Ga0070680_1000069872 | 367 |
| 121 | 3300005338 | Ga0068868_100000110 | Ga0068868_10000011043 | 367 |
| 122 | 3300005339 | Ga0070660_100014526 | Ga0070660_1000145267 | 367 |
| 123 | 3300005339 | Ga0070660_100174821 | Ga0070660_1001748212 | 367 |
| 124 | 3300005340 | Ga0070689_100016821 | Ga0070689_1000168214 | 367 |
| 125 | 3300005344 | Ga0070661_100003285 | Ga0070661_1000032852 | 367 |
| 126 | 3300005344 | Ga0070661_100013818 | Ga0070661_1000138182 | 367 |
| 127 | 3300005344 | Ga0070661_100050703 | Ga0070661_1000507032 | 367 |
| 128 | 3300005355 | Ga0070671_100001247 | Ga0070671_1000012474 | 367 |
| 129 | 3300005366 | Ga0070659_100037292 | Ga0070659_1000372922 | 367 |
| 130 | 3300005367 | Ga0070667_100000289 | Ga0070667_10000028932 | 367 |
| 131 | 3300005436 | Ga0070713_100096966 | Ga0070713_1000969662 | 367 |
| 132 | 3300005458 | Ga0070681_10048941 | Ga0070681_100489413 | 367 |
| 133 | 3300005530 | Ga0070679_100002644 | Ga0070679_1000026448 | 367 |
| 134 | 3300005530 | Ga0070679_100104512 | Ga0070679_1001045122 | 367 |
| 135 | 3300005530 | Ga0070679_100139692 | Ga0070679_1001396922 | 367 |
| 136 | 3300005535 | Ga0070684_100000822 | Ga0070684_1000008229 | 367 |
| 137 | 3300005535 | Ga0070684_100077072 | Ga0070684_1000770722 | 367 |
| 138 | 3300005539 | Ga0068853_100049991 | Ga0068853_1000499912 | 367 |
| 139 | 3300005539 | Ga0068853_100054589 | Ga0068853_1000545892 | 367 |
| 140 | 3300005539 | Ga0068853_100342974 | Ga0068853_1003429741 | 367 |
| 141 | 3300005563 | Ga0068855_100004985 | Ga0068855_1000049857 | 367 |
| 142 | 3300005563 | Ga0068855_100022663 | Ga0068855_1000226634 | 367 |
| 143 | 3300005563 | Ga0068855_100026188 | Ga0068855_1000261886 | 367 |
| 144 | 3300005563 | Ga0068855_100037620 | Ga0068855_1000376202 | 367 |
| 145 | 3300005563 | Ga0068855_100045621 | Ga0068855_1000456216 | 367 |
| 146 | 3300005563 | Ga0068855_100058558 | Ga0068855_1000585584 | 367 |
| 147 | 3300005563 | Ga0068855_100072754 | Ga0068855_1000727543 | 367 |
| 148 | 3300005563 | Ga0068855_100175664 | Ga0068855_1001756642 | 367 |
| 149 | 3300005563 | Ga0068855_100291181 | Ga0068855_1002911812 | 367 |
| 150 | 3300005577 | Ga0068857_100002939 | Ga0068857_1000029399 | 367 |
| 151 | 3300005577 | Ga0068857_100003860 | Ga0068857_10000386011 | 367 |
| 152 | 3300005614 | Ga0068856_100002433 | Ga0068856_10000243315 | 367 |
| 153 | 3300005614 | Ga0068856_100011197 | Ga0068856_1000111972 | 367 |
| 154 | 3300005614 | Ga0068856_100049532 | Ga0068856_1000495322 | 367 |
| 155 | 3300005614 | Ga0068856_100059555 | Ga0068856_1000595554 | 367 |
| 156 | 3300005614 | Ga0068856_100115561 | Ga0068856_1001155612 | 367 |
| 157 | 3300005616 | Ga0068852_100000027 | Ga0068852_10000002711 | 367 |
| 158 | 3300005616 | Ga0068852_100001442 | Ga0068852_1000014429 | 367 |
| 159 | 3300005616 | Ga0068852_100060214 | Ga0068852_1000602143 | 367 |
| 160 | 3300005617 | Ga0068859_100003668 | Ga0068859_1000036686 | 367 |
| 161 | 3300005618 | Ga0068864_100001232 | Ga0068864_10000123220 | 367 |
| 162 | 3300005834 | Ga0068851_10006679 | Ga0068851_100066793 | 367 |
| 163 | 3300005834 | Ga0068851_10024026 | Ga0068851_100240262 | 367 |
| 164 | 3300005834 | Ga0068851_10043919 | Ga0068851_100439192 | 367 |
| 165 | 3300005841 | Ga0068863_100002128 | Ga0068863_1000021282 | 367 |
| 166 | 3300005842 | Ga0068858_100015131 | Ga0068858_1000151316 | 367 |
| 167 | 3300005843 | Ga0068860_100083152 | Ga0068860_1000831522 | 367 |
| 168 | 3300005844 | Ga0068862_100240410 | Ga0068862_1002404102 | 367 |
| 169 | 3300005937 | Ga0081455_10026466 | Ga0081455_100264661 | 367 |
| 170 | 3300005937 | Ga0081455_10028271 | Ga0081455_100282712 | 367 |
| 171 | 3300006028 | Ga0070717_10003134 | Ga0070717_100031343 | 367 |
| 172 | 3300006237 | Ga0097621_100005059 | Ga0097621_1000050592 | 367 |
| 173 | 3300006358 | Ga0068871_100000321 | Ga0068871_10000032117 | 367 |
| 174 | 3300006931 | Ga0097620_100003668 | Ga0097620_1000036686 | 367 |
| 175 | 3300009093 | Ga0105240_10000002 | Ga0105240_10000002292 | 367 |
| 176 | 3300009093 | Ga0105240_10000130 | Ga0105240_1000013074 | 367 |
| 177 | 3300009093 | Ga0105240_10000222 | Ga0105240_1000022210 | 367 |
| 178 | 3300009093 | Ga0105240_10005666 | Ga0105240_1000566611 | 367 |
| 179 | 3300009093 | Ga0105240_10172550 | Ga0105240_101725502 | 367 |
| 180 | 3300009098 | Ga0105245_10000169 | Ga0105245_1000016935 | 367 |
| 181 | 3300009101 | Ga0105247_10035139 | Ga0105247_100351392 | 367 |
| 182 | 3300009174 | Ga0105241_10004865 | Ga0105241_100048657 | 367 |
| 183 | 3300009174 | Ga0105241_10096571 | Ga0105241_100965712 | 367 |
| 184 | 3300009174 | Ga0105241_10115283 | Ga0105241_101152832 | 367 |
| 185 | 3300009177 | Ga0105248_10006190 | Ga0105248_100061906 | 367 |
| 186 | 3300009545 | Ga0105237_10015269 | Ga0105237_100152696 | 367 |
| 187 | 3300009545 | Ga0105237_10107264 | Ga0105237_101072642 | 367 |
| 188 | 3300009551 | Ga0105238_10000516 | Ga0105238_100005169 | 367 |
| 189 | 3300009551 | Ga0105238_10001890 | Ga0105238_100018902 | 367 |
| 190 | 3300009551 | Ga0105238_10032609 | Ga0105238_100326094 | 367 |
| 191 | 3300009551 | Ga0105238_10044053 | Ga0105238_100440534 | 367 |
| 192 | 3300009553 | Ga0105249_10019112 | Ga0105249_100191123 | 367 |
| 193 | 3300010375 | Ga0105239_10092589 | Ga0105239_100925892 | 367 |
| 194 | 3300010375 | Ga0105239_10114770 | Ga0105239_101147703 | 367 |
| 195 | 3300011119 | Ga0105246_10004915 | Ga0105246_100049156 | 367 |
| 196 | 3300013102 | Ga0157371_10027541 | Ga0157371_100275413 | 367 |
| 197 | 3300013102 | Ga0157371_10131433 | Ga0157371_101314332 | 367 |
| 198 | 3300013104 | Ga0157370_10001610 | Ga0157370_1000161010 | 367 |
| 199 | 3300013104 | Ga0157370_10003900 | Ga0157370_1000390016 | 367 |
| 200 | 3300013104 | Ga0157370_10284123 | Ga0157370_102841232 | 367 |
| 201 | 3300013105 | Ga0157369_10000112 | Ga0157369_1000011211 | 367 |
| 202 | 3300013105 | Ga0157369_10006503 | Ga0157369_100065033 | 367 |
| 203 | 3300013105 | Ga0157369_10011061 | Ga0157369_100110618 | 367 |
| 204 | 3300013105 | Ga0157369_10019713 | Ga0157369_100197136 | 367 |
| 205 | 3300013105 | Ga0157369_10028434 | Ga0157369_100284342 | 367 |
| 206 | 3300013105 | Ga0157369_10041174 | Ga0157369_100411742 | 367 |
| 207 | 3300013105 | Ga0157369_10053709 | Ga0157369_100537092 | 367 |
| 208 | 3300013105 | Ga0157369_10109224 | Ga0157369_101092242 | 367 |
| 209 | 3300013105 | Ga0157369_10317042 | Ga0157369_103170422 | 367 |
| 210 | 3300013296 | Ga0157374_10003684 | Ga0157374_100036849 | 367 |
| 211 | 3300013296 | Ga0157374_10212079 | Ga0157374_102120792 | 367 |
| 212 | 3300013297 | Ga0157378_10068696 | Ga0157378_100686962 | 367 |
| 213 | 3300013306 | Ga0163162_10007637 | Ga0163162_100076378 | 367 |
| 214 | 3300013307 | Ga0157372_10000422 | Ga0157372_100004225 | 367 |
| 215 | 3300013307 | Ga0157372_10001211 | Ga0157372_1000121110 | 367 |
| 216 | 3300013307 | Ga0157372_10010205 | Ga0157372_100102055 | 367 |
| 217 | 3300013307 | Ga0157372_10014537 | Ga0157372_100145376 | 367 |
| 218 | 3300013307 | Ga0157372_10029940 | Ga0157372_100299403 | 367 |
| 219 | 3300013307 | Ga0157372_10118093 | Ga0157372_101180932 | 367 |
| 220 | 3300013307 | Ga0157372_10159313 | Ga0157372_101593132 | 367 |
| 221 | 3300013307 | Ga0157372_10188412 | Ga0157372_101884122 | 367 |
| 222 | 3300013307 | Ga0157372_10540176 | Ga0157372_105401761 | 367 |
| 223 | 3300013308 | Ga0157375_10009640 | Ga0157375_100096402 | 367 |
| 224 | 3300014325 | Ga0163163_10000679 | Ga0163163_1000067923 | 367 |
| 225 | 3300014968 | Ga0157379_10000499 | Ga0157379_1000049918 | 367 |
| 226 | 3300014969 | Ga0157376_10049393 | Ga0157376_100493933 | 367 |
| 227 | 3300020069 | Ga0197907_10413395 | Ga0197907_104133952 | 367 |
| 228 | 3300020070 | Ga0206356_11119816 | Ga0206356_111198162 | 367 |
| 229 | 3300020070 | Ga0206356_11224057 | Ga0206356_112240572 | 367 |
| 230 | 3300020070 | Ga0206356_11259921 | Ga0206356_112599213 | 367 |
| 231 | 3300020075 | Ga0206349_1887837 | Ga0206349_18878372 | 367 |
| 232 | 3300020076 | Ga0206355_1317415 | Ga0206355_13174152 | 367 |
| 233 | 3300020077 | Ga0206351_10173209 | Ga0206351_101732092 | 367 |
| 234 | 3300020077 | Ga0206351_10279165 | Ga0206351_102791652 | 367 |
| 235 | 3300020077 | Ga0206351_10397847 | Ga0206351_103978474 | 367 |
| 236 | 3300020077 | Ga0206351_10501227 | Ga0206351_105012272 | 367 |
| 237 | 3300020080 | Ga0206350_10152871 | Ga0206350_101528712 | 367 |
| 238 | 3300020080 | Ga0206350_10331461 | Ga0206350_103314615 | 367 |
| 239 | 3300020080 | Ga0206350_11147263 | Ga0206350_111472635 | 367 |
| 240 | 3300020082 | Ga0206353_10373932 | Ga0206353_103739322 | 367 |
| 241 | 3300020082 | Ga0206353_11873519 | Ga0206353_118735192 | 367 |
| 242 | 3300021361 | Ga0213872_10074906 | Ga0213872_100749062 | 367 |
| 243 | 3300022467 | Ga0224712_10000924 | Ga0224712_100009244 | 367 |
| 244 | 3300025321 | Ga0207656_10012886 | Ga0207656_100128862 | 367 |
| 245 | 3300025321 | Ga0207656_10022804 | Ga0207656_100228042 | 367 |
| 246 | 3300025900 | Ga0207710_10018498 | Ga0207710_100184982 | 367 |
| 247 | 3300025909 | Ga0207705_10009770 | Ga0207705_100097702 | 367 |
| 248 | 3300025909 | Ga0207705_10013790 | Ga0207705_100137903 | 367 |
| 249 | 3300025909 | Ga0207705_10021455 | Ga0207705_100214552 | 367 |
| 250 | 3300025911 | Ga0207654_10001262 | Ga0207654_100012622 | 367 |
| 251 | 3300025911 | Ga0207654_10075093 | Ga0207654_100750932 | 367 |
| 252 | 3300025913 | Ga0207695_10000002 | Ga0207695_10000002294 | 367 |
| 253 | 3300025913 | Ga0207695_10000028 | Ga0207695_10000028208 | 367 |
| 254 | 3300025913 | Ga0207695_10000094 | Ga0207695_10000094114 | 367 |
| 255 | 3300025913 | Ga0207695_10000177 | Ga0207695_1000017718 | 367 |
| 256 | 3300025913 | Ga0207695_10000292 | Ga0207695_1000029274 | 367 |
| 257 | 3300025913 | Ga0207695_10013379 | Ga0207695_100133797 | 367 |
| 258 | 3300025914 | Ga0207671_10000487 | Ga0207671_100004873 | 367 |
| 259 | 3300025917 | Ga0207660_10120254 | Ga0207660_101202542 | 367 |
| 260 | 3300025919 | Ga0207657_10002127 | Ga0207657_1000212723 | 367 |
| 261 | 3300025919 | Ga0207657_10128475 | Ga0207657_101284752 | 367 |
| 262 | 3300025919 | Ga0207657_10176205 | Ga0207657_101762052 | 367 |
| 263 | 3300025920 | Ga0207649_10001021 | Ga0207649_1000102113 | 367 |
| 264 | 3300025920 | Ga0207649_10036626 | Ga0207649_100366263 | 367 |
| 265 | 3300025921 | Ga0207652_10002522 | Ga0207652_100025227 | 367 |
| 266 | 3300025921 | Ga0207652_10054285 | Ga0207652_100542854 | 367 |
| 267 | 3300025921 | Ga0207652_10171045 | Ga0207652_101710452 | 367 |
| 268 | 3300025924 | Ga0207694_10001418 | Ga0207694_100014182 | 367 |
| 269 | 3300025924 | Ga0207694_10003078 | Ga0207694_1000307810 | 367 |
| 270 | 3300025924 | Ga0207694_10195322 | Ga0207694_101953221 | 367 |
| 271 | 3300025925 | Ga0207650_10006218 | Ga0207650_100062183 | 367 |
| 272 | 3300025927 | Ga0207687_10000471 | Ga0207687_1000047112 | 367 |
| 273 | 3300025928 | Ga0207700_10085582 | Ga0207700_100855822 | 367 |
| 274 | 3300025929 | Ga0207664_10058997 | Ga0207664_100589973 | 367 |
| 275 | 3300025931 | Ga0207644_10018310 | Ga0207644_100183102 | 367 |
| 276 | 3300025936 | Ga0207670_10010318 | Ga0207670_100103182 | 367 |
| 277 | 3300025941 | Ga0207711_10024254 | Ga0207711_100242542 | 367 |
| 278 | 3300025942 | Ga0207689_10006228 | Ga0207689_100062282 | 367 |
| 279 | 3300025944 | Ga0207661_10041851 | Ga0207661_100418512 | 367 |
| 280 | 3300025944 | Ga0207661_10089413 | Ga0207661_100894132 | 367 |
| 281 | 3300025944 | Ga0207661_10163589 | Ga0207661_101635892 | 367 |
| 282 | 3300025949 | Ga0207667_10000056 | Ga0207667_1000005696 | 367 |
| 283 | 3300025949 | Ga0207667_10003095 | Ga0207667_1000309514 | 367 |
| 284 | 3300025949 | Ga0207667_10014779 | Ga0207667_100147795 | 367 |
| 285 | 3300025949 | Ga0207667_10014961 | Ga0207667_100149616 | 367 |
| 286 | 3300025949 | Ga0207667_10156868 | Ga0207667_101568682 | 367 |
| 287 | 3300025949 | Ga0207667_10188096 | Ga0207667_101880961 | 367 |
| 288 | 3300025949 | Ga0207667_10206587 | Ga0207667_102065872 | 367 |
| 289 | 3300025949 | Ga0207667_10242541 | Ga0207667_102425412 | 367 |
| 290 | 3300025986 | Ga0207658_10000549 | Ga0207658_1000054921 | 367 |
| 291 | 3300026023 | Ga0207677_10000055 | Ga0207677_1000005574 | 367 |
| 292 | 3300026035 | Ga0207703_10072517 | Ga0207703_100725173 | 367 |
| 293 | 3300026041 | Ga0207639_10000460 | Ga0207639_100004608 | 367 |
| 294 | 3300026041 | Ga0207639_10154624 | Ga0207639_101546242 | 367 |
| 295 | 3300026067 | Ga0207678_10011955 | Ga0207678_100119557 | 367 |
| 296 | 3300026078 | Ga0207702_10001122 | Ga0207702_1000112214 | 367 |
| 297 | 3300026078 | Ga0207702_10067512 | Ga0207702_100675122 | 367 |
| 298 | 3300026078 | Ga0207702_10224718 | Ga0207702_102247181 | 367 |
| 299 | 3300026078 | Ga0207702_10259265 | Ga0207702_102592652 | 367 |
| 300 | 3300026088 | Ga0207641_10000596 | Ga0207641_1000059625 | 367 |
| 301 | 3300026095 | Ga0207676_10002442 | Ga0207676_100024422 | 367 |
| 302 | 3300026116 | Ga0207674_10001250 | Ga0207674_1000125012 | 367 |
| 303 | 3300026116 | Ga0207674_10002359 | Ga0207674_1000235915 | 367 |
| 304 | 3300026142 | Ga0207698_10000021 | Ga0207698_10000021113 | 367 |
| 305 | 3300026142 | Ga0207698_10061251 | Ga0207698_100612512 | 367 |
| 306 | 3300026142 | Ga0207698_10066020 | Ga0207698_100660203 | 367 |
| 307 | 3300026142 | Ga0207698_10191627 | Ga0207698_101916272 | 367 |
| 308 | 3300028380 | Ga0268265_10075316 | Ga0268265_100753162 | 367 |
| 309 | 3300028381 | Ga0268264_10000433 | Ga0268264_1000043311 | 367 |
| 310 | 3300031548 | Ga0307408_100019720 | Ga0307408_1000197203 | 367 |
| 311 | 3300031730 | Ga0307516_10007406 | Ga0307516_100074064 | 367 |
| 312 | 3300031731 | Ga0307405_10026664 | Ga0307405_100266643 | 367 |
| 313 | 3300031903 | Ga0307407_10000809 | Ga0307407_100008096 | 367 |
| 314 | 3300031911 | Ga0307412_10081163 | Ga0307412_100811632 | 367 |
| 315 | 3300031995 | Ga0307409_100000776 | Ga0307409_1000007767 | 367 |
| 316 | 3300032002 | Ga0307416_100002055 | Ga0307416_1000020556 | 367 |
| 317 | 3300032002 | Ga0307416_100104559 | Ga0307416_1001045592 | 367 |
| 318 | 3300032004 | Ga0307414_10028651 | Ga0307414_100286513 | 367 |
| 319 | 3300032126 | Ga0307415_100006483 | Ga0307415_1000064835 | 367 |
| 320 | 3300037418 | Ga0395900_0108357 | Ga0395900_0108357_795_1916 | 367 |
| 321 | 3300037466 | Ga0395898_0223176 | Ga0395898_0223176_426_1547 | 367 |
| 322 | 3300039437 | Ga0436365_0281631 | Ga0436365_0281631_711_1826 | 367 |
| 323 | 3300039438 | Ga0436360_0257927 | Ga0436360_0257927_3853_4974 | 367 |
| 324 | 3300039438 | Ga0436360_0373346 | Ga0436360_0373346_1387_2508 | 367 |
| 325 | 3300039447 | Ga0436361_0221137 | Ga0436361_0221137_2604_3725 | 367 |
| 326 | 3300039447 | Ga0436361_0997213 | Ga0436361_0997213_17872_18993 | 367 |
| 327 | 3300042005 | Ga0439448_0017508 | Ga0439448_0017508_47_1168 | 367 |
| 328 | 3300044684 | Ga0466966_0146274 | Ga0466966_0146274_43_1164 | 367 |
| 329 | 3300045049 | Ga0466959_0071712 | Ga0466959_0071712_387_1508 | 367 |
| 330 | 3300045836 | Ga0466958_0084694 | Ga0466958_0084694_525_1646 | 367 |
| 331 | 3300045976 | Ga0466967_0002127 | Ga0466967_0002127_2569_3690 | 367 |
| 332 | 3300046543 | Ga0495645_0023850 | Ga0495645_0023850_195_1319 | 367 |
| 333 | 3300047472 | Ga0495686_0007303 | Ga0495686_0007303_258_1379 | 367 |
| 334 | 3300049576 | Ga0501040_0001682 | Ga0501040_0001682_6683_7861 | 367 |
| 335 | 3300049578 | Ga0501042_0000935 | Ga0501042_0000935_4304_5482 | 367 |
| 336 | 3300061734 | Ga0530510_0047805 | Ga0530510_0047805_1242_2357 | 367 |
| 337 | iso_pu_bacteria | 2910245624 | 2910248541 | 367 |
| 338 | iso_pu_bacteria | 8003014200 | 8003014749 | 367 |
| 339 | 3300003856 | Ga0058692_1000006 | Ga0058692_1000006139 | 368 |
| 340 | 3300005336 | Ga0070680_100007450 | Ga0070680_1000074504 | 368 |
| 341 | 3300005458 | Ga0070681_10001597 | Ga0070681_100015977 | 368 |
| 342 | 3300005530 | Ga0070679_100000854 | Ga0070679_10000085421 | 368 |
| 343 | 3300005563 | Ga0068855_100005586 | Ga0068855_1000055863 | 368 |
| 344 | 3300005985 | Ga0081539_10000639 | Ga0081539_1000063985 | 368 |
| 345 | 3300013102 | Ga0157371_10009561 | Ga0157371_100095615 | 368 |
| 346 | 3300013104 | Ga0157370_10190990 | Ga0157370_101909902 | 368 |
| 347 | 3300013105 | Ga0157369_10123221 | Ga0157369_101232212 | 368 |
| 348 | 3300015261 | Ga0182006_1013694 | Ga0182006_10136943 | 368 |
| 349 | 3300025912 | Ga0207707_10000481 | Ga0207707_1000048113 | 368 |
| 350 | 3300025917 | Ga0207660_10006095 | Ga0207660_100060955 | 368 |
| 351 | 3300025921 | Ga0207652_10000148 | Ga0207652_1000014867 | 368 |
| 352 | 3300025949 | Ga0207667_10002192 | Ga0207667_100021927 | 368 |
| 353 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016141 | 368 |
| 354 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015430 | 368 |
| 355 | 3300031824 | Ga0307413_10004354 | Ga0307413_100043541 | 368 |
| 356 | 3300031852 | Ga0307410_10000012 | Ga0307410_1000001226 | 368 |
| 357 | 3300031901 | Ga0307406_10000429 | Ga0307406_1000042915 | 368 |
| 358 | 3300031903 | Ga0307407_10003796 | Ga0307407_100037962 | 368 |
| 359 | 3300031911 | Ga0307412_10205765 | Ga0307412_102057652 | 368 |
| 360 | 3300031995 | Ga0307409_100008829 | Ga0307409_1000088293 | 368 |
| 361 | 3300032004 | Ga0307414_10000001 | Ga0307414_100000011123 | 368 |
| 362 | 3300032004 | Ga0307414_10035984 | Ga0307414_100359842 | 368 |
| 363 | 3300032005 | Ga0307411_10000001 | Ga0307411_10000001551 | 368 |
| 364 | 3300037471 | Ga0395905_0407569 | Ga0395905_0407569_29_1138 | 368 |
| 365 | 3300044712 | Ga0453684_0001086 | Ga0453684_0001086_62609_63727 | 368 |
| 366 | 3300044712 | Ga0453684_0001854 | Ga0453684_0001854_36748_37866 | 368 |
| 367 | 3300044712 | Ga0453684_0283778 | Ga0453684_0283778_640_1758 | 368 |
| 368 | 3300046515 | Ga0495620_0001937 | Ga0495620_0001937_9023_10138 | 368 |
| 369 | 3300048915 | Ga0496112_0003611 | Ga0496112_0003611_952_2064 | 368 |
| 370 | 3300049586 | Ga0501070_0040158 | Ga0501070_0040158_2454_3596 | 368 |
| 371 | 3300049664 | Ga0501224_009848 | Ga0501224_009848_108_1220 | 368 |
| 372 | 3300049671 | Ga0501238_000091 | Ga0501238_000091_4212_5324 | 368 |
| 373 | 3300049679 | Ga0501249_000011 | Ga0501249_000011_33201_34313 | 368 |
| 374 | 3300049679 | Ga0501249_000854 | Ga0501249_000854_5036_6148 | 368 |
| 375 | 3300049744 | Ga0501083_0001353 | Ga0501083_0001353_12070_13176 | 368 |
| 376 | 3300049763 | Ga0501266_000016 | Ga0501266_000016_68289_69401 | 368 |
| 377 | 3300049776 | Ga0501280_000271 | Ga0501280_000271_1719_2831 | 368 |
| 378 | 3300049822 | Ga0501035_0006113 | Ga0501035_0006113_1702_2844 | 368 |
| 379 | 3300054114 | Ga0501084_0168728 | Ga0501084_0168728_591_1697 | 368 |
| 380 | 3300059421 | Ga0590071_007895 | Ga0590071_007895_418_1533 | 368 |
| 381 | iso_pu_bacteria | 8021622325 | 8021623051 | 368 |
| 382 | iso_pu_bacteria | 8021626552 | 8021629959 | 368 |
| 383 | iso_pu_bacteria | 8021648035 | 8021650385 | 368 |
| 384 | 3300001991 | JGI24743J22301_10007917 | JGI24743J22301_100079172 | 369 |
| 385 | 3300003577 | Ga0007416J51690_1041533 | Ga0007416J51690_10415331 | 369 |
| 386 | 3300003693 | Ga0032354_1020727 | Ga0032354_10207271 | 369 |
| 387 | 3300003693 | Ga0032354_1021065 | Ga0032354_10210653 | 369 |
| 388 | 3300005288 | Ga0065714_10073034 | Ga0065714_100730343 | 369 |
| 389 | 3300005290 | Ga0065712_10003968 | Ga0065712_100039684 | 369 |
| 390 | 3300005293 | Ga0065715_10001568 | Ga0065715_100015685 | 369 |
| 391 | 3300005327 | Ga0070658_10000345 | Ga0070658_1000034513 | 369 |
| 392 | 3300005327 | Ga0070658_10000650 | Ga0070658_1000065027 | 369 |
| 393 | 3300005327 | Ga0070658_10145001 | Ga0070658_101450012 | 369 |
| 394 | 3300005327 | Ga0070658_10150341 | Ga0070658_101503411 | 369 |
| 395 | 3300005328 | Ga0070676_10048169 | Ga0070676_100481691 | 369 |
| 396 | 3300005329 | Ga0070683_100083384 | Ga0070683_1000833843 | 369 |
| 397 | 3300005330 | Ga0070690_100046425 | Ga0070690_1000464252 | 369 |
| 398 | 3300005335 | Ga0070666_10017705 | Ga0070666_100177052 | 369 |
| 399 | 3300005335 | Ga0070666_10052546 | Ga0070666_100525462 | 369 |
| 400 | 3300005335 | Ga0070666_10071574 | Ga0070666_100715742 | 369 |
| 401 | 3300005336 | Ga0070680_100000072 | Ga0070680_10000007219 | 369 |
| 402 | 3300005336 | Ga0070680_100300850 | Ga0070680_1003008501 | 369 |
| 403 | 3300005338 | Ga0068868_100122053 | Ga0068868_1001220533 | 369 |
| 404 | 3300005339 | Ga0070660_100032650 | Ga0070660_1000326503 | 369 |
| 405 | 3300005339 | Ga0070660_100033615 | Ga0070660_1000336152 | 369 |
| 406 | 3300005340 | Ga0070689_100016114 | Ga0070689_1000161142 | 369 |
| 407 | 3300005344 | Ga0070661_100042894 | Ga0070661_1000428942 | 369 |
| 408 | 3300005344 | Ga0070661_100186822 | Ga0070661_1001868221 | 369 |
| 409 | 3300005347 | Ga0070668_100067406 | Ga0070668_1000674062 | 369 |
| 410 | 3300005354 | Ga0070675_100008863 | Ga0070675_1000088633 | 369 |
| 411 | 3300005355 | Ga0070671_100012945 | Ga0070671_1000129453 | 369 |
| 412 | 3300005355 | Ga0070671_100017289 | Ga0070671_1000172893 | 369 |
| 413 | 3300005355 | Ga0070671_100094714 | Ga0070671_1000947143 | 369 |
| 414 | 3300005364 | Ga0070673_100004217 | Ga0070673_1000042175 | 369 |
| 415 | 3300005365 | Ga0070688_100001831 | Ga0070688_1000018312 | 369 |
| 416 | 3300005366 | Ga0070659_100093424 | Ga0070659_1000934242 | 369 |
| 417 | 3300005366 | Ga0070659_100145440 | Ga0070659_1001454402 | 369 |
| 418 | 3300005367 | Ga0070667_100035813 | Ga0070667_1000358132 | 369 |
| 419 | 3300005367 | Ga0070667_100201079 | Ga0070667_1002010792 | 369 |
| 420 | 3300005435 | Ga0070714_100085991 | Ga0070714_1000859911 | 369 |
| 421 | 3300005437 | Ga0070710_10028098 | Ga0070710_100280982 | 369 |
| 422 | 3300005437 | Ga0070710_10066564 | Ga0070710_100665642 | 369 |
| 423 | 3300005438 | Ga0070701_10153135 | Ga0070701_101531351 | 369 |
| 424 | 3300005439 | Ga0070711_100074515 | Ga0070711_1000745152 | 369 |
| 425 | 3300005441 | Ga0070700_100154870 | Ga0070700_1001548702 | 369 |
| 426 | 3300005455 | Ga0070663_100185036 | Ga0070663_1001850361 | 369 |
| 427 | 3300005456 | Ga0070678_100094099 | Ga0070678_1000940992 | 369 |
| 428 | 3300005457 | Ga0070662_100163584 | Ga0070662_1001635842 | 369 |
| 429 | 3300005458 | Ga0070681_10090672 | Ga0070681_100906722 | 369 |
| 430 | 3300005458 | Ga0070681_10090714 | Ga0070681_100907142 | 369 |
| 431 | 3300005458 | Ga0070681_10109455 | Ga0070681_101094552 | 369 |
| 432 | 3300005466 | Ga0070685_10003418 | Ga0070685_100034184 | 369 |
| 433 | 3300005530 | Ga0070679_100204288 | Ga0070679_1002042882 | 369 |
| 434 | 3300005539 | Ga0068853_100021631 | Ga0068853_1000216312 | 369 |
| 435 | 3300005543 | Ga0070672_100133354 | Ga0070672_1001333542 | 369 |
| 436 | 3300005543 | Ga0070672_100176438 | Ga0070672_1001764381 | 369 |
| 437 | 3300005544 | Ga0070686_100025434 | Ga0070686_1000254342 | 369 |
| 438 | 3300005548 | Ga0070665_100000134 | Ga0070665_10000013460 | 369 |
| 439 | 3300005548 | Ga0070665_100024237 | Ga0070665_1000242372 | 369 |
| 440 | 3300005548 | Ga0070665_100108672 | Ga0070665_1001086722 | 369 |
| 441 | 3300005563 | Ga0068855_100003388 | Ga0068855_1000033884 | 369 |
| 442 | 3300005563 | Ga0068855_100032978 | Ga0068855_1000329783 | 369 |
| 443 | 3300005578 | Ga0068854_100027922 | Ga0068854_1000279222 | 369 |
| 444 | 3300005614 | Ga0068856_100150059 | Ga0068856_1001500593 | 369 |
| 445 | 3300005841 | Ga0068863_100054324 | Ga0068863_1000543242 | 369 |
| 446 | 3300005981 | Ga0081538_10017318 | Ga0081538_100173182 | 369 |
| 447 | 3300006028 | Ga0070717_10020816 | Ga0070717_100208164 | 369 |
| 448 | 3300006173 | Ga0070716_100024703 | Ga0070716_1000247032 | 369 |
| 449 | 3300006175 | Ga0070712_100157935 | Ga0070712_1001579352 | 369 |
| 450 | 3300006852 | Ga0075433_10039695 | Ga0075433_100396953 | 369 |
| 451 | 3300006871 | Ga0075434_100000641 | Ga0075434_10000064120 | 369 |
| 452 | 3300006914 | Ga0075436_100049922 | Ga0075436_1000499224 | 369 |
| 453 | 3300009093 | Ga0105240_10006104 | Ga0105240_100061047 | 369 |
| 454 | 3300009093 | Ga0105240_10080777 | Ga0105240_100807772 | 369 |
| 455 | 3300009093 | Ga0105240_10086151 | Ga0105240_100861512 | 369 |
| 456 | 3300009094 | Ga0111539_10043418 | Ga0111539_100434183 | 369 |
| 457 | 3300009098 | Ga0105245_10067425 | Ga0105245_100674251 | 369 |
| 458 | 3300009147 | Ga0114129_10432061 | Ga0114129_104320611 | 369 |
| 459 | 3300009545 | Ga0105237_10134046 | Ga0105237_101340462 | 369 |
| 460 | 3300009551 | Ga0105238_10003327 | Ga0105238_100033274 | 369 |
| 461 | 3300009551 | Ga0105238_10010605 | Ga0105238_100106056 | 369 |
| 462 | 3300010375 | Ga0105239_10003064 | Ga0105239_100030648 | 369 |
| 463 | 3300010375 | Ga0105239_10026650 | Ga0105239_100266502 | 369 |
| 464 | 3300013104 | Ga0157370_10030259 | Ga0157370_100302595 | 369 |
| 465 | 3300013104 | Ga0157370_10067695 | Ga0157370_100676952 | 369 |
| 466 | 3300013104 | Ga0157370_10368755 | Ga0157370_103687551 | 369 |
| 467 | 3300013105 | Ga0157369_10034889 | Ga0157369_100348894 | 369 |
| 468 | 3300013105 | Ga0157369_10201586 | Ga0157369_102015862 | 369 |
| 469 | 3300013296 | Ga0157374_10040228 | Ga0157374_100402284 | 369 |
| 470 | 3300013297 | Ga0157378_10013535 | Ga0157378_100135354 | 369 |
| 471 | 3300013307 | Ga0157372_10077669 | Ga0157372_100776693 | 369 |
| 472 | 3300013308 | Ga0157375_10013056 | Ga0157375_100130563 | 369 |
| 473 | 3300014497 | Ga0182008_10092460 | Ga0182008_100924602 | 369 |
| 474 | 3300014497 | Ga0182008_10112226 | Ga0182008_101122261 | 369 |
| 475 | 3300014969 | Ga0157376_10006836 | Ga0157376_100068366 | 369 |
| 476 | 3300020080 | Ga0206350_10326591 | Ga0206350_103265912 | 369 |
| 477 | 3300021358 | Ga0213873_10000001 | Ga0213873_100000011462 | 369 |
| 478 | 3300021361 | Ga0213872_10021296 | Ga0213872_100212961 | 369 |
| 479 | 3300021361 | Ga0213872_10038149 | Ga0213872_100381492 | 369 |
| 480 | 3300021384 | Ga0213876_10000002 | Ga0213876_1000000277 | 369 |
| 481 | 3300021388 | Ga0213875_10000022 | Ga0213875_1000002223 | 369 |
| 482 | 3300021388 | Ga0213875_10000098 | Ga0213875_1000009857 | 369 |
| 483 | 3300021388 | Ga0213875_10001220 | Ga0213875_100012207 | 369 |
| 484 | 3300021388 | Ga0213875_10012047 | Ga0213875_100120471 | 369 |
| 485 | 3300022467 | Ga0224712_10003449 | Ga0224712_100034494 | 369 |
| 486 | 3300022467 | Ga0224712_10042673 | Ga0224712_100426732 | 369 |
| 487 | 3300025271 | Ga0207666_1000203 | Ga0207666_10002035 | 369 |
| 488 | 3300025315 | Ga0207697_10001245 | Ga0207697_100012457 | 369 |
| 489 | 3300025315 | Ga0207697_10002753 | Ga0207697_100027534 | 369 |
| 490 | 3300025898 | Ga0207692_10068186 | Ga0207692_100681861 | 369 |
| 491 | 3300025898 | Ga0207692_10098504 | Ga0207692_100985042 | 369 |
| 492 | 3300025909 | Ga0207705_10003383 | Ga0207705_100033832 | 369 |
| 493 | 3300025909 | Ga0207705_10224550 | Ga0207705_102245502 | 369 |
| 494 | 3300025912 | Ga0207707_10001382 | Ga0207707_100013822 | 369 |
| 495 | 3300025912 | Ga0207707_10040309 | Ga0207707_100403093 | 369 |
| 496 | 3300025913 | Ga0207695_10018270 | Ga0207695_100182702 | 369 |
| 497 | 3300025913 | Ga0207695_10029477 | Ga0207695_100294775 | 369 |
| 498 | 3300025915 | Ga0207693_10040100 | Ga0207693_100401002 | 369 |
| 499 | 3300025916 | Ga0207663_10124525 | Ga0207663_101245251 | 369 |
| 500 | 3300025917 | Ga0207660_10000419 | Ga0207660_1000041920 | 369 |
| 501 | 3300025917 | Ga0207660_10023320 | Ga0207660_100233201 | 369 |
| 502 | 3300025919 | Ga0207657_10041017 | Ga0207657_100410173 | 369 |
| 503 | 3300025919 | Ga0207657_10060529 | Ga0207657_100605292 | 369 |
| 504 | 3300025919 | Ga0207657_10234294 | Ga0207657_102342942 | 369 |
| 505 | 3300025924 | Ga0207694_10034558 | Ga0207694_100345582 | 369 |
| 506 | 3300025924 | Ga0207694_10073706 | Ga0207694_100737063 | 369 |
| 507 | 3300025928 | Ga0207700_10013750 | Ga0207700_100137506 | 369 |
| 508 | 3300025931 | Ga0207644_10027025 | Ga0207644_100270253 | 369 |
| 509 | 3300025931 | Ga0207644_10029497 | Ga0207644_100294972 | 369 |
| 510 | 3300025931 | Ga0207644_10073260 | Ga0207644_100732602 | 369 |
| 511 | 3300025932 | Ga0207690_10095942 | Ga0207690_100959422 | 369 |
| 512 | 3300025932 | Ga0207690_10101045 | Ga0207690_101010451 | 369 |
| 513 | 3300025936 | Ga0207670_10055887 | Ga0207670_100558872 | 369 |
| 514 | 3300025939 | Ga0207665_10023774 | Ga0207665_100237742 | 369 |
| 515 | 3300025940 | Ga0207691_10104014 | Ga0207691_101040142 | 369 |
| 516 | 3300025944 | Ga0207661_10026617 | Ga0207661_100266174 | 369 |
| 517 | 3300025944 | Ga0207661_10215437 | Ga0207661_102154372 | 369 |
| 518 | 3300025945 | Ga0207679_10052719 | Ga0207679_100527192 | 369 |
| 519 | 3300025949 | Ga0207667_10060830 | Ga0207667_100608303 | 369 |
| 520 | 3300025972 | Ga0207668_10074567 | Ga0207668_100745672 | 369 |
| 521 | 3300025981 | Ga0207640_10070567 | Ga0207640_100705671 | 369 |
| 522 | 3300025986 | Ga0207658_10041337 | Ga0207658_100413372 | 369 |
| 523 | 3300026023 | Ga0207677_10099141 | Ga0207677_100991412 | 369 |
| 524 | 3300026041 | Ga0207639_10016832 | Ga0207639_100168323 | 369 |
| 525 | 3300026041 | Ga0207639_10027069 | Ga0207639_100270694 | 369 |
| 526 | 3300026067 | Ga0207678_10045845 | Ga0207678_100458453 | 369 |
| 527 | 3300026075 | Ga0207708_10195103 | Ga0207708_101951032 | 369 |
| 528 | 3300026088 | Ga0207641_10203712 | Ga0207641_102037122 | 369 |
| 529 | 3300028379 | Ga0268266_10000637 | Ga0268266_1000063746 | 369 |
| 530 | 3300028379 | Ga0268266_10148142 | Ga0268266_101481422 | 369 |
| 531 | 3300031251 | Ga0265327_10027096 | Ga0265327_100270962 | 369 |
| 532 | 3300031548 | Ga0307408_100085860 | Ga0307408_1000858601 | 369 |
| 533 | 3300031548 | Ga0307408_100119750 | Ga0307408_1001197501 | 369 |
| 534 | 3300031548 | Ga0307408_100157716 | Ga0307408_1001577162 | 369 |
| 535 | 3300031727 | Ga0316576_10007137 | Ga0316576_100071374 | 369 |
| 536 | 3300031728 | Ga0316578_10000808 | Ga0316578_100008087 | 369 |
| 537 | 3300031731 | Ga0307405_10051826 | Ga0307405_100518261 | 369 |
| 538 | 3300031731 | Ga0307405_10056826 | Ga0307405_100568262 | 369 |
| 539 | 3300031731 | Ga0307405_10163311 | Ga0307405_101633112 | 369 |
| 540 | 3300031824 | Ga0307413_10035950 | Ga0307413_100359502 | 369 |
| 541 | 3300031824 | Ga0307413_10063501 | Ga0307413_100635011 | 369 |
| 542 | 3300031852 | Ga0307410_10073607 | Ga0307410_100736073 | 369 |
| 543 | 3300031901 | Ga0307406_10128122 | Ga0307406_101281222 | 369 |
| 544 | 3300031903 | Ga0307407_10004745 | Ga0307407_100047455 | 369 |
| 545 | 3300031903 | Ga0307407_10038198 | Ga0307407_100381982 | 369 |
| 546 | 3300031903 | Ga0307407_10057291 | Ga0307407_100572912 | 369 |
| 547 | 3300031903 | Ga0307407_10057996 | Ga0307407_100579962 | 369 |
| 548 | 3300031903 | Ga0307407_10094190 | Ga0307407_100941902 | 369 |
| 549 | 3300031911 | Ga0307412_10020065 | Ga0307412_100200652 | 369 |
| 550 | 3300031911 | Ga0307412_10027125 | Ga0307412_100271253 | 369 |
| 551 | 3300031911 | Ga0307412_10078647 | Ga0307412_100786472 | 369 |
| 552 | 3300031911 | Ga0307412_10091642 | Ga0307412_100916422 | 369 |
| 553 | 3300031911 | Ga0307412_10095834 | Ga0307412_100958342 | 369 |
| 554 | 3300031911 | Ga0307412_10192740 | Ga0307412_101927401 | 369 |
| 555 | 3300031995 | Ga0307409_100000202 | Ga0307409_10000020214 | 369 |
| 556 | 3300031995 | Ga0307409_100016125 | Ga0307409_1000161255 | 369 |
| 557 | 3300031995 | Ga0307409_100019725 | Ga0307409_1000197252 | 369 |
| 558 | 3300031995 | Ga0307409_100028392 | Ga0307409_1000283922 | 369 |
| 559 | 3300032002 | Ga0307416_100004513 | Ga0307416_1000045136 | 369 |
| 560 | 3300032002 | Ga0307416_100004568 | Ga0307416_1000045683 | 369 |
| 561 | 3300032002 | Ga0307416_100008103 | Ga0307416_1000081035 | 369 |
| 562 | 3300032002 | Ga0307416_100012459 | Ga0307416_1000124595 | 369 |
| 563 | 3300032002 | Ga0307416_100141337 | Ga0307416_1001413372 | 369 |
| 564 | 3300032004 | Ga0307414_10000187 | Ga0307414_1000018723 | 369 |
| 565 | 3300032004 | Ga0307414_10032764 | Ga0307414_100327642 | 369 |
| 566 | 3300032004 | Ga0307414_10054596 | Ga0307414_100545962 | 369 |
| 567 | 3300032005 | Ga0307411_10010072 | Ga0307411_100100722 | 369 |
| 568 | 3300032005 | Ga0307411_10025703 | Ga0307411_100257033 | 369 |
| 569 | 3300032005 | Ga0307411_10149928 | Ga0307411_101499282 | 369 |
| 570 | 3300032005 | Ga0307411_10151253 | Ga0307411_101512532 | 369 |
| 571 | 3300032126 | Ga0307415_100091304 | Ga0307415_1000913042 | 369 |
| 572 | 3300032126 | Ga0307415_100153009 | Ga0307415_1001530092 | 369 |
| 573 | 3300032126 | Ga0307415_100167392 | Ga0307415_1001673922 | 369 |
| 574 | 3300032126 | Ga0307415_100284513 | Ga0307415_1002845131 | 369 |
| 575 | 3300032139 | Ga0316580_10003585 | Ga0316580_100035852 | 369 |
| 576 | 3300035083 | Ga0373926_0009750 | Ga0373926_0009750_1504_2631 | 369 |
| 577 | 3300035117 | Ga0373953_0007522 | Ga0373953_0007522_822_1949 | 369 |
| 578 | 3300035118 | Ga0373954_0022354 | Ga0373954_0022354_318_1445 | 369 |
| 579 | 3300035119 | Ga0373956_0037041 | Ga0373956_0037041_725_1852 | 369 |
| 580 | 3300035724 | Ga0373933_0005010 | Ga0373933_0005010_5939_7066 | 369 |
| 581 | 3300036401 | Ga0373937_0008999 | Ga0373937_0008999_7362_8489 | 369 |
| 582 | 3300036712 | Ga0316584_0004516 | Ga0316584_0004516_5246_6364 | 369 |
| 583 | 3300037068 | Ga0373925_0282298 | Ga0373925_0282298_208_1326 | 369 |
| 584 | 3300037471 | Ga0395905_0046822 | Ga0395905_0046822_2102_3283 | 369 |
| 585 | 3300037853 | Ga0436364_0530951 | Ga0436364_0530951_175827_176945 | 369 |
| 586 | 3300037853 | Ga0436364_0558108 | Ga0436364_0558108_30923_32050 | 369 |
| 587 | 3300037853 | Ga0436364_0927813 | Ga0436364_0927813_300_1427 | 369 |
| 588 | 3300037853 | Ga0436364_1325276 | Ga0436364_1325276_20748_21875 | 369 |
| 589 | 3300037853 | Ga0436364_1390920 | Ga0436364_1390920_56730_57872 | 369 |
| 590 | 3300039437 | Ga0436365_0190860 | Ga0436365_0190860_9566_10684 | 369 |
| 591 | 3300039437 | Ga0436365_0813146 | Ga0436365_0813146_51_1178 | 369 |
| 592 | 3300039437 | Ga0436365_1528146 | Ga0436365_1528146_157_1284 | 369 |
| 593 | 3300039438 | Ga0436360_0034025 | Ga0436360_0034025_1044_2162 | 369 |
| 594 | 3300039438 | Ga0436360_0129245 | Ga0436360_0129245_442_1569 | 369 |
| 595 | 3300039438 | Ga0436360_0247545 | Ga0436360_0247545_4459_5577 | 369 |
| 596 | 3300039447 | Ga0436361_0523980 | Ga0436361_0523980_3094_4212 | 369 |
| 597 | 3300039447 | Ga0436361_0765221 | Ga0436361_0765221_7787_8905 | 369 |
| 598 | 3300039447 | Ga0436361_0941399 | Ga0436361_0941399_51_1181 | 369 |
| 599 | 3300039450 | Ga0436363_0834601 | Ga0436363_0834601_2326_3453 | 369 |
| 600 | 3300039453 | Ga0436362_0429742 | Ga0436362_0429742_231_1358 | 369 |
| 601 | 3300039453 | Ga0436362_0649416 | Ga0436362_0649416_166471_167589 | 369 |
| 602 | 3300042004 | Ga0439445_0035105 | Ga0439445_0035105_30_1157 | 369 |
| 603 | 3300042876 | Ga0451577_0301872 | Ga0451577_0301872_20_1138 | 369 |
| 604 | 3300044673 | Ga0453683_0000194 | Ga0453683_0000194_68285_69403 | 369 |
| 605 | 3300044673 | Ga0453683_0000655 | Ga0453683_0000655_23633_24757 | 369 |
| 606 | 3300044673 | Ga0453683_0009023 | Ga0453683_0009023_4344_5462 | 369 |
| 607 | 3300044693 | Ga0466961_0099692 | Ga0466961_0099692_61_1233 | 369 |
| 608 | 3300044712 | Ga0453684_0001215 | Ga0453684_0001215_45384_46505 | 369 |
| 609 | 3300044712 | Ga0453684_0045814 | Ga0453684_0045814_4368_5486 | 369 |
| 610 | 3300044712 | Ga0453684_0124438 | Ga0453684_0124438_156_1274 | 369 |
| 611 | 3300044719 | Ga0466971_0000020 | Ga0466971_0000020_12742_13860 | 369 |
| 612 | 3300044765 | Ga0466970_0002918 | Ga0466970_0002918_1706_2821 | 369 |
| 613 | 3300044842 | Ga0466957_0080447 | Ga0466957_0080447_287_1405 | 369 |
| 614 | 3300045051 | Ga0451576_0000135 | Ga0451576_0000135_22221_23339 | 369 |
| 615 | 3300045051 | Ga0451576_0005678 | Ga0451576_0005678_8305_9423 | 369 |
| 616 | 3300046472 | Ga0495580_0044422 | Ga0495580_0044422_1673_2800 | 369 |
| 617 | 3300046512 | Ga0495610_0000741 | Ga0495610_0000741_14236_15351 | 369 |
| 618 | 3300046515 | Ga0495620_0026522 | Ga0495620_0026522_1030_2145 | 369 |
| 619 | 3300046519 | Ga0495632_0019430 | Ga0495632_0019430_318_1433 | 369 |
| 620 | 3300046660 | Ga0495625_0012365 | Ga0495625_0012365_1103_2218 | 369 |
| 621 | 3300047472 | Ga0495686_0011196 | Ga0495686_0011196_5070_6185 | 369 |
| 622 | 3300048905 | Ga0496102_0153433 | Ga0496102_0153433_75_1193 | 369 |
| 623 | 3300048907 | Ga0496104_0014966 | Ga0496104_0014966_3744_4871 | 369 |
| 624 | 3300048911 | Ga0496108_0308875 | Ga0496108_0308875_166_1284 | 369 |
| 625 | 3300048912 | Ga0496109_0109004 | Ga0496109_0109004_1045_2163 | 369 |
| 626 | 3300048915 | Ga0496112_0038502 | Ga0496112_0038502_2231_3349 | 369 |
| 627 | 3300048915 | Ga0496112_0284605 | Ga0496112_0284605_295_1413 | 369 |
| 628 | 3300048916 | Ga0496113_0017282 | Ga0496113_0017282_3700_4827 | 369 |
| 629 | 3300049568 | Ga0501031_0039359 | Ga0501031_0039359_1325_2440 | 369 |
| 630 | 3300049571 | Ga0501034_0142646 | Ga0501034_0142646_1089_2204 | 369 |
| 631 | 3300049571 | Ga0501034_0239515 | Ga0501034_0239515_458_1573 | 369 |
| 632 | 3300049572 | Ga0501036_0030940 | Ga0501036_0030940_1406_2542 | 369 |
| 633 | 3300049573 | Ga0501037_0000240 | Ga0501037_0000240_25964_27082 | 369 |
| 634 | 3300049574 | Ga0501038_0036575 | Ga0501038_0036575_3136_4251 | 369 |
| 635 | 3300049575 | Ga0501039_0049676 | Ga0501039_0049676_1315_2430 | 369 |
| 636 | 3300049576 | Ga0501040_0069168 | Ga0501040_0069168_58_1173 | 369 |
| 637 | 3300049577 | Ga0501041_0003044 | Ga0501041_0003044_618_1733 | 369 |
| 638 | 3300049578 | Ga0501042_0005151 | Ga0501042_0005151_5378_6514 | 369 |
| 639 | 3300049579 | Ga0501043_0049989 | Ga0501043_0049989_1647_2762 | 369 |
| 640 | 3300049580 | Ga0501046_0087707 | Ga0501046_0087707_274_1389 | 369 |
| 641 | 3300049581 | Ga0501047_0235683 | Ga0501047_0235683_475_1587 | 369 |
| 642 | 3300049582 | Ga0501048_0034730 | Ga0501048_0034730_1216_2331 | 369 |
| 643 | 3300049582 | Ga0501048_0039381 | Ga0501048_0039381_74_1210 | 369 |
| 644 | 3300049583 | Ga0501067_0064111 | Ga0501067_0064111_662_1780 | 369 |
| 645 | 3300049585 | Ga0501069_0081649 | Ga0501069_0081649_347_1456 | 369 |
| 646 | 3300049587 | Ga0501071_0014009 | Ga0501071_0014009_635_1750 | 369 |
| 647 | 3300049587 | Ga0501071_0103433 | Ga0501071_0103433_193_1302 | 369 |
| 648 | 3300049588 | Ga0501072_0026890 | Ga0501072_0026890_2124_3239 | 369 |
| 649 | 3300049588 | Ga0501072_0183338 | Ga0501072_0183338_144_1280 | 369 |
| 650 | 3300049589 | Ga0501073_0135221 | Ga0501073_0135221_97_1233 | 369 |
| 651 | 3300049589 | Ga0501073_0228257 | Ga0501073_0228257_94_1209 | 369 |
| 652 | 3300049590 | Ga0501074_0051307 | Ga0501074_0051307_27_1142 | 369 |
| 653 | 3300049591 | Ga0501075_0029266 | Ga0501075_0029266_1441_2739 | 369 |
| 654 | 3300049591 | Ga0501075_0058535 | Ga0501075_0058535_261_1376 | 369 |
| 655 | 3300049592 | Ga0501076_0005738 | Ga0501076_0005738_5164_6300 | 369 |
| 656 | 3300049592 | Ga0501076_0011665 | Ga0501076_0011665_1350_2465 | 369 |
| 657 | 3300049592 | Ga0501076_0013165 | Ga0501076_0013165_3588_4697 | 369 |
| 658 | 3300049593 | Ga0501077_0000046 | Ga0501077_0000046_51175_52473 | 369 |
| 659 | 3300049593 | Ga0501077_0049491 | Ga0501077_0049491_128_1237 | 369 |
| 660 | 3300049679 | Ga0501249_024946 | Ga0501249_024946_106_1224 | 369 |
| 661 | 3300049742 | Ga0501080_0004063 | Ga0501080_0004063_6539_7837 | 369 |
| 662 | 3300049742 | Ga0501080_0047224 | Ga0501080_0047224_2643_3758 | 369 |
| 663 | 3300049742 | Ga0501080_0081093 | Ga0501080_0081093_1764_2900 | 369 |
| 664 | 3300049742 | Ga0501080_0258375 | Ga0501080_0258375_284_1402 | 369 |
| 665 | 3300049822 | Ga0501035_0057940 | Ga0501035_0057940_594_1709 | 369 |
| 666 | 3300049822 | Ga0501035_0318909 | Ga0501035_0318909_142_1278 | 369 |
| 667 | 3300049823 | Ga0501044_0000957 | Ga0501044_0000957_25671_26789 | 369 |
| 668 | 3300049823 | Ga0501044_0249872 | Ga0501044_0249872_132_1253 | 369 |
| 669 | 3300049824 | Ga0501045_0201832 | Ga0501045_0201832_220_1335 | 369 |
| 670 | 3300050494 | nmdc:mga06z11_74688_c1 | nmdc:mga06z11_74688_c1_106_1224 | 369 |
| 671 | 3300050512 | nmdc:mga0n895_2275_c1 | nmdc:mga0n895_2275_c1_8086_9204 | 369 |
| 672 | 3300050513 | nmdc:mga0rr50_29956_c1 | nmdc:mga0rr50_29956_c1_2060_3187 | 369 |
| 673 | 3300050514 | nmdc:mga08x19_20979_c1 | nmdc:mga08x19_20979_c1_275_1402 | 369 |
| 674 | 3300050515 | nmdc:mga0a205_6325_c1 | nmdc:mga0a205_6325_c1_7414_8532 | 369 |
| 675 | 3300053083 | Ga0495655_0031599 | Ga0495655_0031599_42_1172 | 369 |
| 676 | 3300053160 | Ga0500633_0000311 | Ga0500633_0000311_5572_6687 | 369 |
| 677 | 3300054114 | Ga0501084_0085793 | Ga0501084_0085793_534_1643 | 369 |
| 678 | 3300059421 | Ga0590071_000585 | Ga0590071_000585_9001_10110 | 369 |
| 679 | 3300059421 | Ga0590071_000919 | Ga0590071_000919_1209_2327 | 369 |
| 680 | 3300059421 | Ga0590071_000953 | Ga0590071_000953_2567_3676 | 369 |
| 681 | 3300059421 | Ga0590071_017868 | Ga0590071_017868_128_1246 | 369 |
| 682 | 3300059421 | Ga0590071_019247 | Ga0590071_019247_428_1537 | 369 |
| 683 | 3300059421 | Ga0590071_025947 | Ga0590071_025947_132_1241 | 369 |
| 684 | 3300059423 | Ga0590074_001496 | Ga0590074_001496_1142_2251 | 369 |
| 685 | 3300059423 | Ga0590074_002612 | Ga0590074_002612_338_1447 | 369 |
| 686 | 3300059423 | Ga0590074_007523 | Ga0590074_007523_328_1446 | 369 |
| 687 | 3300059424 | Ga0590075_001890 | Ga0590075_001890_3814_4923 | 369 |
| 688 | 3300059426 | Ga0590077_000022 | Ga0590077_000022_3264_4373 | 369 |
| 689 | 3300059426 | Ga0590077_000232 | Ga0590077_000232_13690_14799 | 369 |
| 690 | 3300060353 | Ga0501082_0000072 | Ga0501082_0000072_57545_58843 | 369 |
| 691 | 3300060353 | Ga0501082_0232812 | Ga0501082_0232812_434_1549 | 369 |
| 692 | 3300061719 | Ga0466962_0000017 | Ga0466962_0000017_73699_74817 | 369 |
| 693 | 3300061734 | Ga0530510_0113535 | Ga0530510_0113535_46_1161 | 369 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kv9-assembly1.cif.gz_A-2 | moee5 in complex with udp-glucuronic acid and nad | 0.9205 | 1 | 345 |
| 6kvc-assembly1.cif.gz_A-2 | moee5 in complex with udp-glucose and nad | 0.9146 | 1 | 345 |
| 6dnt-assembly1.cif.gz_A-2 | udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid | 0.911 | 2 | 345 |
| 4zrn-assembly1.cif.gz_B | crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima | 0.9103 | 1 | 345 |
| 6kv9-assembly1.cif.gz_A-2 | moee5 in complex with udp-glucuronic acid and nad | 0.9057 | 1 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N670_2_342_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.933 | 3 | 342 | 3.40.50.720 |
| af_L7N670_2_342_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9251 | 3 | 342 | 3.40.50.720 |
| 4zrnB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9103 | 1 | 277 | 3.40.50.720 |
| af_P72050_1_314_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9079 | 1 | 350 | 3.40.50.720 |
| af_A0A0R0KMW5_231_418_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9061 | 175 | 355 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-S4Y9C3-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9933 | 2 | 367 |
|
| AF-A0A250KYI1-F1-model_v4 | UDP-galactose 4-epimerase | 0.9899 | 2 | 367 |
|
| AF-S4Y9C3-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9879 | 2 | 367 |
|
| AF-A0A537M5A6-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9868 | 184 | 367 |
|
| AF-A0A538M237-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9864 | 2 | 367 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar