F475680

General Info

Members Datasets Scaffolds Average Seq Length
693 289 687 372

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0029266|Ga0501075_0029266_1441_2739
Length 432
Sequence MSNPRLAIGLDSPEQVGRRASGVNDRGGDIDQDEIAEIDTSRVRAPRRDVRTLHGGLCMSVRGRILITGGAGFIGSHLADELLEHGYAVRALDNLSEQVHGLGAQRPSYLHPDVELVRGDVRDRAAVRAALADVDAVFHFAAMVGVGQSMYEIARYTDVNNLGTAVLLEALAERPVGRLVVASSMSIYGEGLYRDRRGDLAAGVERDREQLKARDWEVRDSDGEPLTPVPTPESKTPTLSSVYALSKYDQERMCLMVGKAYNIPTVALRFFNVYGTRQALSNPYTGVLAIFASRLLNGRPPLIFEDGRQMRDFVHVSDIARACRLALTVPEAAGQVFNIGSGRQATVREIADALADVLDRKDLEPEITGKYRVGDIRHCFADITLARRVLGYEPQMPLARGLLELSSWLADQVADDRVAQGHAELTARGLTV

Samples

Sample ID Description Type Environment
1 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
2 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
101 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
248 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
249 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
254 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
287 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
288 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
289 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.22
Metatranscriptomes 5.92
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 1.15
Rhizosphere 95.82
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10007917 3300001991 Bacteria 1854
2 Ga0007416J51690_1041533 3300003577 Bacteria 1467
3 Ga0032354_1020727 3300003693 Bacteria 1443
4 Ga0032354_1021065 3300003693 Bacteria 3577
5 Ga0058692_1000006 3300003856 Bacteria 398109
6 Ga0058863_11748332 3300004799 Bacteria 3099
7 Ga0058862_12292174 3300004803 Bacteria 4690
8 Ga0058862_12842061 3300004803 Bacteria 2324
9 Ga0065714_10073034 3300005288 Bacteria 3256
10 Ga0065712_10003968 3300005290 Bacteria 8902
11 Ga0065715_10001568 3300005293 Bacteria 9435
12 Ga0070658_10000345 3300005327 Bacteria 40226
13 Ga0070658_10000650 3300005327 Bacteria 30049
14 Ga0070658_10002428 3300005327 Bacteria 15598
15 Ga0070658_10010486 3300005327 Bacteria 7432
16 Ga0070658_10045618 3300005327 Bacteria 3544
17 Ga0070658_10046302 3300005327 Bacteria 3520
18 Ga0070658_10145001 3300005327 Bacteria 1985
19 Ga0070658_10150341 3300005327 Bacteria 1949
20 Ga0070658_10348271 3300005327 Unclassified 1268
21 Ga0070676_10048169 3300005328 Bacteria 2491
22 Ga0070683_100003153 3300005329 Bacteria 13286
23 Ga0070683_100039535 3300005329 Bacteria 4331
24 Ga0070683_100070223 3300005329 Bacteria 3267
25 Ga0070683_100083384 3300005329 Bacteria 2994
26 Ga0070683_100204148 3300005329 Bacteria 1877
27 Ga0070690_100046425 3300005330 Bacteria 2761
28 Ga0070670_100001140 3300005331 Bacteria 21113
29 Ga0068869_100003119 3300005334 Bacteria 10109
30 Ga0070666_10017705 3300005335 Bacteria 4571
31 Ga0070666_10052546 3300005335 Bacteria 2746
32 Ga0070666_10071574 3300005335 Bacteria 2360
33 Ga0070680_100000072 3300005336 Bacteria 53846
34 Ga0070680_100006987 3300005336 Bacteria 8603
35 Ga0070680_100007450 3300005336 Bacteria 8349
36 Ga0070680_100300850 3300005336 Bacteria 1360
37 Ga0068868_100000110 3300005338 Bacteria 51175
38 Ga0068868_100122053 3300005338 Bacteria 2126
39 Ga0070660_100014526 3300005339 Bacteria 5676
40 Ga0070660_100032650 3300005339 Bacteria 3919
41 Ga0070660_100033615 3300005339 Bacteria 3867
42 Ga0070660_100174821 3300005339 Unclassified 1736
43 Ga0070689_100016114 3300005340 Bacteria 5467
44 Ga0070689_100016821 3300005340 Bacteria 5360
45 Ga0070661_100003285 3300005344 Bacteria 11166
46 Ga0070661_100013818 3300005344 Bacteria 5674
47 Ga0070661_100035295 3300005344 Bacteria 3630
48 Ga0070661_100042894 3300005344 Bacteria 3303
49 Ga0070661_100050703 3300005344 Bacteria 3037
50 Ga0070661_100061373 3300005344 Bacteria 2759
51 Ga0070661_100186822 3300005344 Bacteria 1579
52 Ga0070668_100067406 3300005347 Bacteria 2780
53 Ga0070675_100008863 3300005354 Bacteria 7822
54 Ga0070671_100001247 3300005355 Bacteria 19073
55 Ga0070671_100012945 3300005355 Bacteria 6721
56 Ga0070671_100017289 3300005355 Bacteria 5840
57 Ga0070671_100094714 3300005355 Bacteria 2503
58 Ga0070673_100004217 3300005364 Bacteria 9071
59 Ga0070688_100001831 3300005365 Bacteria 10678
60 Ga0070659_100037292 3300005366 Bacteria 3789
61 Ga0070659_100093424 3300005366 Bacteria 2414
62 Ga0070659_100145440 3300005366 Bacteria 1931
63 Ga0070667_100000289 3300005367 Bacteria 56919
64 Ga0070667_100035813 3300005367 Bacteria 4159
65 Ga0070667_100201079 3300005367 Bacteria 1768
66 Ga0070714_100085991 3300005435 Bacteria 2747
67 Ga0070714_100134707 3300005435 Bacteria 2211
68 Ga0070713_100096966 3300005436 Bacteria 2547
69 Ga0070710_10028098 3300005437 Bacteria 3006
70 Ga0070710_10066564 3300005437 Bacteria 2066
71 Ga0070701_10153135 3300005438 Bacteria 1329
72 Ga0070711_100074515 3300005439 Bacteria 2400
73 Ga0070711_100227387 3300005439 Bacteria 1453
74 Ga0070700_100154870 3300005441 Bacteria 1571
75 Ga0070663_100185036 3300005455 Bacteria 1618
76 Ga0070678_100094099 3300005456 Bacteria 2306
77 Ga0070662_100163584 3300005457 Unclassified 1742
78 Ga0070681_10001597 3300005458 Bacteria 20162
79 Ga0070681_10048941 3300005458 Bacteria 4222
80 Ga0070681_10090672 3300005458 Bacteria 3007
81 Ga0070681_10090714 3300005458 Bacteria 3006
82 Ga0070681_10109455 3300005458 Bacteria 2703
83 Ga0070685_10003418 3300005466 Bacteria 8076
84 Ga0070679_100000854 3300005530 Bacteria 26529
85 Ga0070679_100002644 3300005530 Bacteria 16299
86 Ga0070679_100104512 3300005530 Bacteria 2819
87 Ga0070679_100139692 3300005530 Bacteria 2403
88 Ga0070679_100204288 3300005530 Bacteria 1940
89 Ga0070684_100000822 3300005535 Bacteria 21733
90 Ga0070684_100063457 3300005535 Bacteria 3238
91 Ga0070684_100077072 3300005535 Bacteria 2944
92 Ga0068853_100000645 3300005539 Bacteria 23916
93 Ga0068853_100021631 3300005539 Bacteria 5365
94 Ga0068853_100049991 3300005539 Bacteria 3595
95 Ga0068853_100054589 3300005539 Bacteria 3443
96 Ga0068853_100080059 3300005539 Bacteria 2858
97 Ga0068853_100342974 3300005539 Bacteria 1388
98 Ga0070672_100133354 3300005543 Unclassified 2043
99 Ga0070672_100176438 3300005543 Bacteria 1779
100 Ga0070686_100025434 3300005544 Bacteria 3563
101 Ga0070665_100000134 3300005548 Bacteria 139586
102 Ga0070665_100024237 3300005548 Bacteria 6110
103 Ga0070665_100108672 3300005548 Bacteria 2776
104 Ga0068855_100003388 3300005563 Bacteria 19510
105 Ga0068855_100003472 3300005563 Bacteria 19296
106 Ga0068855_100004985 3300005563 Bacteria 16204
107 Ga0068855_100005586 3300005563 Bacteria 15344
108 Ga0068855_100017874 3300005563 Bacteria 8521
109 Ga0068855_100022663 3300005563 Bacteria 7524
110 Ga0068855_100026188 3300005563 Bacteria 6977
111 Ga0068855_100032978 3300005563 Bacteria 6183
112 Ga0068855_100037620 3300005563 Bacteria 5753
113 Ga0068855_100045621 3300005563 Bacteria 5183
114 Ga0068855_100058558 3300005563 Bacteria 4511
115 Ga0068855_100072754 3300005563 Bacteria 3995
116 Ga0068855_100175664 3300005563 Bacteria 2424
117 Ga0068855_100291181 3300005563 Bacteria 1810
118 Ga0068857_100002939 3300005577 Bacteria 14044
119 Ga0068857_100003860 3300005577 Bacteria 12613
120 Ga0068857_100007995 3300005577 Bacteria 9127
121 Ga0068854_100007202 3300005578 Bacteria 7101
122 Ga0068854_100027922 3300005578 Bacteria 3894
123 Ga0068856_100002433 3300005614 Bacteria 19150
124 Ga0068856_100011197 3300005614 Bacteria 8705
125 Ga0068856_100023721 3300005614 Bacteria 5966
126 Ga0068856_100049532 3300005614 Bacteria 4140
127 Ga0068856_100059555 3300005614 Bacteria 3772
128 Ga0068856_100115561 3300005614 Bacteria 2683
129 Ga0068856_100150059 3300005614 Bacteria 2340
130 Ga0068852_100000027 3300005616 Bacteria 113819
131 Ga0068852_100001442 3300005616 Bacteria 16042
132 Ga0068852_100029057 3300005616 Unclassified 4535
133 Ga0068852_100060214 3300005616 Bacteria 3296
134 Ga0068859_100003668 3300005617 Bacteria 15638
135 Ga0068864_100001232 3300005618 Bacteria 21282
136 Ga0068851_10006679 3300005834 Bacteria 5278
137 Ga0068851_10017700 3300005834 Bacteria 3426
138 Ga0068851_10024026 3300005834 Bacteria 2982
139 Ga0068851_10043919 3300005834 Bacteria 2254
140 Ga0068863_100002128 3300005841 Bacteria 19652
141 Ga0068863_100054324 3300005841 Bacteria 3795
142 Ga0068858_100015131 3300005842 Bacteria 7256
143 Ga0068860_100083152 3300005843 Bacteria 3044
144 Ga0068862_100240410 3300005844 Bacteria 1646
145 Ga0081455_10026466 3300005937 Bacteria 5333
146 Ga0081455_10028271 3300005937 Bacteria 5125
147 Ga0081538_10017318 3300005981 Bacteria 5475
148 Ga0081539_10000639 3300005985 Bacteria 70847
149 Ga0070717_10003134 3300006028 Bacteria 11812
150 Ga0070717_10020816 3300006028 Bacteria 5163
151 Ga0070716_100024703 3300006173 Bacteria 3201
152 Ga0070712_100157935 3300006175 Bacteria 1748
153 Ga0097621_100005059 3300006237 Bacteria 9265
154 Ga0068871_100000321 3300006358 Bacteria 33368
155 Ga0075433_10039695 3300006852 Bacteria 4072
156 Ga0075434_100000641 3300006871 Bacteria 27050
157 Ga0075436_100000256 3300006914 Bacteria 33232
158 Ga0075436_100049922 3300006914 Bacteria 2887
159 Ga0097620_100003668 3300006931 Bacteria 15638
160 Ga0105240_10000002 3300009093 Bacteria 1924170
161 Ga0105240_10000130 3300009093 Bacteria 154390
162 Ga0105240_10000222 3300009093 Bacteria 113825
163 Ga0105240_10005666 3300009093 Bacteria 18538
164 Ga0105240_10006104 3300009093 Bacteria 17778
165 Ga0105240_10012189 3300009093 Bacteria 11895
166 Ga0105240_10015500 3300009093 Bacteria 10361
167 Ga0105240_10027417 3300009093 Bacteria 7456
168 Ga0105240_10080777 3300009093 Bacteria 3997
169 Ga0105240_10086151 3300009093 Bacteria 3847
170 Ga0105240_10172550 3300009093 Unclassified 2559
171 Ga0111539_10043418 3300009094 Bacteria 5389
172 Ga0105245_10000169 3300009098 Bacteria 61835
173 Ga0105245_10067425 3300009098 Bacteria 3241
174 Ga0105247_10035139 3300009101 Bacteria 3054
175 Ga0114129_10432061 3300009147 Bacteria 1730
176 Ga0105241_10000074 3300009174 Bacteria 75523
177 Ga0105241_10002755 3300009174 Bacteria 13168
178 Ga0105241_10004865 3300009174 Bacteria 9907
179 Ga0105241_10096571 3300009174 Bacteria 2341
180 Ga0105241_10115283 3300009174 Bacteria 2156
181 Ga0105248_10006190 3300009177 Bacteria 13115
182 Ga0105237_10004817 3300009545 Bacteria 15502
183 Ga0105237_10015269 3300009545 Bacteria 8000
184 Ga0105237_10083831 3300009545 Bacteria 3178
185 Ga0105237_10107264 3300009545 Bacteria 2785
186 Ga0105237_10134046 3300009545 Bacteria 2472
187 Ga0105238_10000516 3300009551 Bacteria 40563
188 Ga0105238_10001890 3300009551 Bacteria 21028
189 Ga0105238_10003327 3300009551 Bacteria 16042
190 Ga0105238_10010605 3300009551 Bacteria 9252
191 Ga0105238_10028496 3300009551 Bacteria 5690
192 Ga0105238_10032609 3300009551 Bacteria 5300
193 Ga0105238_10044053 3300009551 Bacteria 4513
194 Ga0105238_10075818 3300009551 Bacteria 3355
195 Ga0105249_10019112 3300009553 Bacteria 6111
196 Ga0105239_10003064 3300010375 Bacteria 20772
197 Ga0105239_10026650 3300010375 Bacteria 6362
198 Ga0105239_10036104 3300010375 Bacteria 5427
199 Ga0105239_10092589 3300010375 Bacteria 3337
200 Ga0105239_10114770 3300010375 Bacteria 2987
201 Ga0105239_10179478 3300010375 Unclassified 2369
202 Ga0105246_10004915 3300011119 Bacteria 8145
203 Ga0157371_10009561 3300013102 Bacteria 7625
204 Ga0157371_10027541 3300013102 Bacteria 4122
205 Ga0157371_10131433 3300013102 Bacteria 1781
206 Ga0157370_10001610 3300013104 Bacteria 27915
207 Ga0157370_10003900 3300013104 Bacteria 17380
208 Ga0157370_10030259 3300013104 Bacteria 5305
209 Ga0157370_10067695 3300013104 Bacteria 3375
210 Ga0157370_10190990 3300013104 Bacteria 1901
211 Ga0157370_10284123 3300013104 Unclassified 1529
212 Ga0157370_10368755 3300013104 Bacteria 1323
213 Ga0157369_10000112 3300013105 Bacteria 114309
214 Ga0157369_10005663 3300013105 Bacteria 14513
215 Ga0157369_10006503 3300013105 Bacteria 13544
216 Ga0157369_10011061 3300013105 Bacteria 10267
217 Ga0157369_10019713 3300013105 Bacteria 7547
218 Ga0157369_10021141 3300013105 Bacteria 7276
219 Ga0157369_10028434 3300013105 Bacteria 6187
220 Ga0157369_10034889 3300013105 Bacteria 5518
221 Ga0157369_10041174 3300013105 Bacteria 5043
222 Ga0157369_10053709 3300013105 Bacteria 4353
223 Ga0157369_10103974 3300013105 Bacteria 3025
224 Ga0157369_10109224 3300013105 Bacteria 2941
225 Ga0157369_10123221 3300013105 Bacteria 2750
226 Ga0157369_10201586 3300013105 Bacteria 2088
227 Ga0157369_10317042 3300013105 Unclassified 1621
228 Ga0157374_10003684 3300013296 Bacteria 12877
229 Ga0157374_10040228 3300013296 Bacteria 4304
230 Ga0157374_10212079 3300013296 Bacteria 1899
231 Ga0157378_10013535 3300013297 Bacteria 7136
232 Ga0157378_10068696 3300013297 Bacteria 3178
233 Ga0163162_10007637 3300013306 Bacteria 10534
234 Ga0157372_10000422 3300013307 Bacteria 46497
235 Ga0157372_10001211 3300013307 Bacteria 27915
236 Ga0157372_10001505 3300013307 Bacteria 25337
237 Ga0157372_10002780 3300013307 Bacteria 18917
238 Ga0157372_10005419 3300013307 Bacteria 13559
239 Ga0157372_10010205 3300013307 Bacteria 9974
240 Ga0157372_10014537 3300013307 Bacteria 8423
241 Ga0157372_10029940 3300013307 Bacteria 5949
242 Ga0157372_10077669 3300013307 Bacteria 3751
243 Ga0157372_10114709 3300013307 Bacteria 3088
244 Ga0157372_10118093 3300013307 Bacteria 3043
245 Ga0157372_10159313 3300013307 Bacteria 2608
246 Ga0157372_10188412 3300013307 Bacteria 2389
247 Ga0157372_10489690 3300013307 Bacteria 1434
248 Ga0157372_10540176 3300013307 Unclassified 1359
249 Ga0157375_10009640 3300013308 Bacteria 8486
250 Ga0157375_10013056 3300013308 Bacteria 7381
251 Ga0163163_10000679 3300014325 Bacteria 29109
252 Ga0182008_10092460 3300014497 Bacteria 1492
253 Ga0182008_10112226 3300014497 Bacteria 1351
254 Ga0157379_10000499 3300014968 Bacteria 31901
255 Ga0157376_10006836 3300014969 Bacteria 8078
256 Ga0157376_10049393 3300014969 Bacteria 3484
257 Ga0182006_1013694 3300015261 Bacteria 3510
258 Ga0197907_10413395 3300020069 Bacteria 2942
259 Ga0206356_11119816 3300020070 Bacteria 5138
260 Ga0206356_11224057 3300020070 Bacteria 4947
261 Ga0206356_11259921 3300020070 Bacteria 3450
262 Ga0206349_1887837 3300020075 Bacteria 2680
263 Ga0206355_1317415 3300020076 Unclassified 3094
264 Ga0206351_10173209 3300020077 Bacteria 2527
265 Ga0206351_10279165 3300020077 Unclassified 1310
266 Ga0206351_10397847 3300020077 Bacteria 4136
267 Ga0206351_10501227 3300020077 Bacteria 1756
268 Ga0206350_10152871 3300020080 Bacteria 2367
269 Ga0206350_10326591 3300020080 Bacteria 3374
270 Ga0206350_10331461 3300020080 Bacteria 6054
271 Ga0206350_10856568 3300020080 Bacteria 5702
272 Ga0206350_11147263 3300020080 Bacteria 5416
273 Ga0206353_10373932 3300020082 Bacteria 2776
274 Ga0206353_11873519 3300020082 Bacteria 1592
275 Ga0213873_10000001 3300021358 Bacteria 1657979
276 Ga0213872_10021296 3300021361 Bacteria 2986
277 Ga0213872_10038149 3300021361 Bacteria 2193
278 Ga0213872_10074906 3300021361 Bacteria 1523
279 Ga0213876_10000002 3300021384 Bacteria 1168769
280 Ga0213875_10000022 3300021388 Bacteria 215075
281 Ga0213875_10000098 3300021388 Bacteria 98684
282 Ga0213875_10001132 3300021388 Bacteria 18346
283 Ga0213875_10001220 3300021388 Bacteria 17409
284 Ga0213875_10012047 3300021388 Bacteria 4283
285 Ga0224712_10000481 3300022467 Bacteria 8011
286 Ga0224712_10000924 3300022467 Bacteria 6318
287 Ga0224712_10003449 3300022467 Bacteria 4109
288 Ga0224712_10042673 3300022467 Bacteria 1720
289 Ga0207666_1000203 3300025271 Bacteria 8848
290 Ga0207697_10001245 3300025315 Bacteria 13958
291 Ga0207697_10002753 3300025315 Bacteria 8971
292 Ga0207656_10012886 3300025321 Bacteria 3185
293 Ga0207656_10016389 3300025321 Bacteria 2884
294 Ga0207656_10022804 3300025321 Bacteria 2515
295 Ga0207692_10068186 3300025898 Bacteria 1864
296 Ga0207692_10098504 3300025898 Bacteria 1600
297 Ga0207710_10018498 3300025900 Bacteria 2964
298 Ga0207705_10003383 3300025909 Bacteria 12130
299 Ga0207705_10009770 3300025909 Bacteria 6983
300 Ga0207705_10013790 3300025909 Bacteria 5827
301 Ga0207705_10021455 3300025909 Bacteria 4609
302 Ga0207705_10224550 3300025909 Bacteria 1427
303 Ga0207654_10000380 3300025911 Bacteria 25850
304 Ga0207654_10001262 3300025911 Bacteria 13476
305 Ga0207654_10075093 3300025911 Bacteria 2019
306 Ga0207707_10000481 3300025912 Bacteria 41355
307 Ga0207707_10001382 3300025912 Bacteria 22527
308 Ga0207707_10040309 3300025912 Bacteria 4079
309 Ga0207695_10000002 3300025913 Bacteria 2188391
310 Ga0207695_10000028 3300025913 Bacteria 551835
311 Ga0207695_10000094 3300025913 Bacteria 265779
312 Ga0207695_10000177 3300025913 Bacteria 185955
313 Ga0207695_10000292 3300025913 Bacteria 123721
314 Ga0207695_10003411 3300025913 Bacteria 22444
315 Ga0207695_10013379 3300025913 Bacteria 9790
316 Ga0207695_10018270 3300025913 Bacteria 8114
317 Ga0207695_10029477 3300025913 Bacteria 6062
318 Ga0207695_10031688 3300025913 Bacteria 5794
319 Ga0207671_10000487 3300025914 Bacteria 53821
320 Ga0207671_10003647 3300025914 Bacteria 15208
321 Ga0207693_10040100 3300025915 Bacteria 3687
322 Ga0207663_10124525 3300025916 Unclassified 1771
323 Ga0207660_10000419 3300025917 Bacteria 28025
324 Ga0207660_10006095 3300025917 Bacteria 7826
325 Ga0207660_10023320 3300025917 Bacteria 4178
326 Ga0207660_10120254 3300025917 Bacteria 1988
327 Ga0207657_10002127 3300025919 Bacteria 21449
328 Ga0207657_10041017 3300025919 Bacteria 4096
329 Ga0207657_10060529 3300025919 Bacteria 3249
330 Ga0207657_10128475 3300025919 Bacteria 2079
331 Ga0207657_10176205 3300025919 Unclassified 1730
332 Ga0207657_10234294 3300025919 Bacteria 1467
333 Ga0207649_10001021 3300025920 Bacteria 17258
334 Ga0207649_10036626 3300025920 Bacteria 2957
335 Ga0207649_10047500 3300025920 Bacteria 2642
336 Ga0207652_10000148 3300025921 Bacteria 75801
337 Ga0207652_10002522 3300025921 Bacteria 15385
338 Ga0207652_10054285 3300025921 Bacteria 3444
339 Ga0207652_10171045 3300025921 Bacteria 1949
340 Ga0207694_10000160 3300025924 Bacteria 68770
341 Ga0207694_10001418 3300025924 Bacteria 20539
342 Ga0207694_10003078 3300025924 Bacteria 13349
343 Ga0207694_10016365 3300025924 Bacteria 5599
344 Ga0207694_10034558 3300025924 Bacteria 3877
345 Ga0207694_10073706 3300025924 Bacteria 2671
346 Ga0207694_10195322 3300025924 Unclassified 1645
347 Ga0207650_10006218 3300025925 Bacteria 8135
348 Ga0207687_10000471 3300025927 Bacteria 27489
349 Ga0207700_10013750 3300025928 Bacteria 5280
350 Ga0207700_10085582 3300025928 Bacteria 2475
351 Ga0207664_10058997 3300025929 Bacteria 3055
352 Ga0207664_10385871 3300025929 Bacteria 1244
353 Ga0207644_10018310 3300025931 Bacteria 4736
354 Ga0207644_10027025 3300025931 Bacteria 3962
355 Ga0207644_10029497 3300025931 Bacteria 3807
356 Ga0207644_10073260 3300025931 Bacteria 2511
357 Ga0207690_10095942 3300025932 Bacteria 2107
358 Ga0207690_10101045 3300025932 Bacteria 2059
359 Ga0207670_10010318 3300025936 Bacteria 5373
360 Ga0207670_10055887 3300025936 Bacteria 2669
361 Ga0207665_10023774 3300025939 Bacteria 4036
362 Ga0207691_10104014 3300025940 Bacteria 2531
363 Ga0207711_10024254 3300025941 Bacteria 5078
364 Ga0207689_10006228 3300025942 Bacteria 10567
365 Ga0207661_10020713 3300025944 Bacteria 4920
366 Ga0207661_10026617 3300025944 Bacteria 4410
367 Ga0207661_10041851 3300025944 Bacteria 3609
368 Ga0207661_10089413 3300025944 Bacteria 2562
369 Ga0207661_10163589 3300025944 Bacteria 1932
370 Ga0207661_10215437 3300025944 Bacteria 1695
371 Ga0207679_10052719 3300025945 Bacteria 2985
372 Ga0207667_10000056 3300025949 Bacteria 206107
373 Ga0207667_10002192 3300025949 Bacteria 24516
374 Ga0207667_10003095 3300025949 Bacteria 20587
375 Ga0207667_10014779 3300025949 Bacteria 8882
376 Ga0207667_10014961 3300025949 Bacteria 8824
377 Ga0207667_10044718 3300025949 Bacteria 4691
378 Ga0207667_10060830 3300025949 Bacteria 3953
379 Ga0207667_10156868 3300025949 Bacteria 2341
380 Ga0207667_10188096 3300025949 Bacteria 2119
381 Ga0207667_10206587 3300025949 Bacteria 2013
382 Ga0207667_10242541 3300025949 Bacteria 1844
383 Ga0207668_10074567 3300025972 Bacteria 2436
384 Ga0207640_10004197 3300025981 Bacteria 7793
385 Ga0207640_10070567 3300025981 Bacteria 2350
386 Ga0207658_10000549 3300025986 Bacteria 34004
387 Ga0207658_10041337 3300025986 Bacteria 3338
388 Ga0207677_10000055 3300026023 Bacteria 98214
389 Ga0207677_10099141 3300026023 Bacteria 2139
390 Ga0207703_10072517 3300026035 Bacteria 2847
391 Ga0207639_10000145 3300026041 Bacteria 53212
392 Ga0207639_10000460 3300026041 Bacteria 28135
393 Ga0207639_10016832 3300026041 Bacteria 5179
394 Ga0207639_10027069 3300026041 Bacteria 4173
395 Ga0207639_10154624 3300026041 Bacteria 1925
396 Ga0207678_10011955 3300026067 Bacteria 7622
397 Ga0207678_10045845 3300026067 Bacteria 3780
398 Ga0207708_10195103 3300026075 Bacteria 1613
399 Ga0207702_10001122 3300026078 Bacteria 27348
400 Ga0207702_10035114 3300026078 Bacteria 4192
401 Ga0207702_10067512 3300026078 Bacteria 3069
402 Ga0207702_10224718 3300026078 Bacteria 1751
403 Ga0207702_10259265 3300026078 Bacteria 1636
404 Ga0207641_10000596 3300026088 Bacteria 39785
405 Ga0207641_10203712 3300026088 Bacteria 1826
406 Ga0207676_10002442 3300026095 Bacteria 13241
407 Ga0207674_10001250 3300026116 Bacteria 33196
408 Ga0207674_10002359 3300026116 Bacteria 23871
409 Ga0207674_10020466 3300026116 Bacteria 7147
410 Ga0207698_10000021 3300026142 Bacteria 133280
411 Ga0207698_10061251 3300026142 Bacteria 2932
412 Ga0207698_10066020 3300026142 Bacteria 2846
413 Ga0207698_10191627 3300026142 Unclassified 1822
414 Ga0209371_1000016 3300027312 Bacteria 646301
415 Ga0268266_10000637 3300028379 Bacteria 47708
416 Ga0268266_10148142 3300028379 Bacteria 2112
417 Ga0268265_10075316 3300028380 Bacteria 2643
418 Ga0268264_10000433 3300028381 Bacteria 57744
419 Ga0268256_1000015 3300030500 Bacteria 646300
420 Ga0265327_10027096 3300031251 Bacteria 3304
421 Ga0307408_100019720 3300031548 Bacteria 4543
422 Ga0307408_100085860 3300031548 Bacteria 2364
423 Ga0307408_100119750 3300031548 Bacteria 2037
424 Ga0307408_100157716 3300031548 Bacteria 1799
425 Ga0316576_10007137 3300031727 Bacteria 7005
426 Ga0316578_10000808 3300031728 Bacteria 11611
427 Ga0307516_10007406 3300031730 Bacteria 12625
428 Ga0307405_10026664 3300031731 Bacteria 3337
429 Ga0307405_10051826 3300031731 Bacteria 2548
430 Ga0307405_10056826 3300031731 Bacteria 2455
431 Ga0307405_10163311 3300031731 Bacteria 1580
432 Ga0307413_10004354 3300031824 Bacteria 6149
433 Ga0307413_10035950 3300031824 Bacteria 2847
434 Ga0307413_10063501 3300031824 Bacteria 2290
435 Ga0307410_10000012 3300031852 Bacteria 79112
436 Ga0307410_10073607 3300031852 Bacteria 2376
437 Ga0307406_10000429 3300031901 Bacteria 24463
438 Ga0307406_10128122 3300031901 Bacteria 1777
439 Ga0307407_10000809 3300031903 Bacteria 10369
440 Ga0307407_10003796 3300031903 Bacteria 6287
441 Ga0307407_10004745 3300031903 Bacteria 5813
442 Ga0307407_10038198 3300031903 Bacteria 2659
443 Ga0307407_10057291 3300031903 Bacteria 2260
444 Ga0307407_10057996 3300031903 Bacteria 2249
445 Ga0307407_10094190 3300031903 Bacteria 1843
446 Ga0307412_10020065 3300031911 Bacteria 4061
447 Ga0307412_10027125 3300031911 Bacteria 3568
448 Ga0307412_10078647 3300031911 Bacteria 2273
449 Ga0307412_10081163 3300031911 Bacteria 2242
450 Ga0307412_10091642 3300031911 Bacteria 2128
451 Ga0307412_10095834 3300031911 Bacteria 2087
452 Ga0307412_10192740 3300031911 Bacteria 1542
453 Ga0307412_10205765 3300031911 Bacteria 1498
454 Ga0307409_100000202 3300031995 Bacteria 23457
455 Ga0307409_100000776 3300031995 Bacteria 14462
456 Ga0307409_100008829 3300031995 Bacteria 6147
457 Ga0307409_100016125 3300031995 Bacteria 4933
458 Ga0307409_100019725 3300031995 Bacteria 4574
459 Ga0307409_100028392 3300031995 Bacteria 3985
460 Ga0307416_100002055 3300032002 Bacteria 11334
461 Ga0307416_100004513 3300032002 Bacteria 8405
462 Ga0307416_100004568 3300032002 Bacteria 8366
463 Ga0307416_100008103 3300032002 Bacteria 6744
464 Ga0307416_100012459 3300032002 Bacteria 5730
465 Ga0307416_100104559 3300032002 Bacteria 2476
466 Ga0307416_100141337 3300032002 Bacteria 2188
467 Ga0307416_100216193 3300032002 Bacteria 1834
468 Ga0307414_10000001 3300032004 Bacteria 1352954
469 Ga0307414_10000187 3300032004 Bacteria 42062
470 Ga0307414_10028651 3300032004 Bacteria 3615
471 Ga0307414_10032764 3300032004 Bacteria 3426
472 Ga0307414_10035984 3300032004 Bacteria 3300
473 Ga0307414_10054596 3300032004 Bacteria 2793
474 Ga0307411_10000001 3300032005 Bacteria 931810
475 Ga0307411_10010072 3300032005 Bacteria 5017
476 Ga0307411_10025703 3300032005 Bacteria 3533
477 Ga0307411_10149928 3300032005 Bacteria 1731
478 Ga0307411_10151253 3300032005 Bacteria 1725
479 Ga0307415_100006483 3300032126 Bacteria 6320
480 Ga0307415_100091304 3300032126 Bacteria 2205
481 Ga0307415_100153009 3300032126 Bacteria 1778
482 Ga0307415_100167392 3300032126 Bacteria 1710
483 Ga0307415_100284513 3300032126 Bacteria 1361
484 Ga0316580_10003585 3300032139 Bacteria 4420
485 Ga0373926_0009750 3300035083 Bacteria 3209
486 Ga0373953_0007522 3300035117 Bacteria 3653
487 Ga0373954_0022354 3300035118 Bacteria 2868
488 Ga0373956_0037041 3300035119 Bacteria 2155
489 Ga0373933_0005010 3300035724 Bacteria 7225
490 Ga0373937_0008999 3300036401 Bacteria 8668
491 Ga0316584_0004516 3300036712 Bacteria 9213
492 Ga0316584_0037359 3300036712 Bacteria 3608
493 Ga0373925_0282298 3300037068 Bacteria 1337
494 Ga0395900_0108357 3300037418 Bacteria 2854
495 Ga0395898_0019877 3300037466 Bacteria 6830
496 Ga0395898_0223176 3300037466 Bacteria 1797
497 Ga0395905_0046822 3300037471 Bacteria 4055
498 Ga0395905_0407569 3300037471 Bacteria 1255
499 Ga0436364_0530951 3300037853 Bacteria 215117
500 Ga0436364_0558108 3300037853 Bacteria 39499
501 Ga0436364_0566500 3300037853 Bacteria 56428
502 Ga0436364_0927813 3300037853 Unclassified 2114
503 Ga0436364_1325276 3300037853 Bacteria 58128
504 Ga0436364_1390920 3300037853 Bacteria 113944
505 Ga0436365_0190860 3300039437 Bacteria 42582
506 Ga0436365_0281631 3300039437 Bacteria 1899
507 Ga0436365_0813146 3300039437 Unclassified 1253
508 Ga0436365_1528146 3300039437 Bacteria 1868
509 Ga0436360_0034025 3300039438 Unclassified 2176
510 Ga0436360_0129245 3300039438 Bacteria 1989
511 Ga0436360_0247545 3300039438 Bacteria 8033
512 Ga0436360_0257927 3300039438 Bacteria 6020
513 Ga0436360_0373346 3300039438 Bacteria 2525
514 Ga0436361_0221137 3300039447 Bacteria 5102
515 Ga0436361_0323325 3300039447 Bacteria 1831
516 Ga0436361_0523980 3300039447 Unclassified 4960
517 Ga0436361_0765221 3300039447 Bacteria 9171
518 Ga0436361_0941399 3300039447 Bacteria 1217
519 Ga0436361_0997213 3300039447 Bacteria 24500
520 Ga0436363_0834601 3300039450 Bacteria 6944
521 Ga0436362_0429742 3300039453 Bacteria 1569
522 Ga0436362_0649416 3300039453 Bacteria 210038
523 Ga0439445_0035105 3300042004 Bacteria 1316
524 Ga0439448_0017508 3300042005 Bacteria 2189
525 Ga0451577_0301872 3300042876 Bacteria 1451
526 Ga0453683_0000194 3300044673 Bacteria 83328
527 Ga0453683_0000655 3300044673 Bacteria 37122
528 Ga0453683_0009023 3300044673 Bacteria 6660
529 Ga0466966_0146274 3300044684 Bacteria 1442
530 Ga0466961_0099692 3300044693 Bacteria 1831
531 Ga0466963_0022152 3300044694 Bacteria 4021
532 Ga0466963_0097910 3300044694 Bacteria 2005
533 Ga0453684_0001086 3300044712 Bacteria 86208
534 Ga0453684_0001215 3300044712 Bacteria 79022
535 Ga0453684_0001854 3300044712 Bacteria 55179
536 Ga0453684_0045814 3300044712 Bacteria 5828
537 Ga0453684_0095925 3300044712 Bacteria 3644
538 Ga0453684_0124438 3300044712 Bacteria 3106
539 Ga0453684_0283778 3300044712 Bacteria 1887
540 Ga0466971_0000020 3300044719 Bacteria 78865
541 Ga0466970_0002918 3300044765 Bacteria 8287
542 Ga0466957_0009810 3300044842 Bacteria 5474
543 Ga0466957_0041836 3300044842 Bacteria 2771
544 Ga0466957_0080447 3300044842 Bacteria 2028
545 Ga0466959_0071712 3300045049 Bacteria 2508
546 Ga0466959_0222703 3300045049 Bacteria 1308
547 Ga0451576_0000135 3300045051 Bacteria 186763
548 Ga0451576_0005678 3300045051 Bacteria 15571
549 Ga0466958_0038998 3300045836 Bacteria 2852
550 Ga0466958_0084694 3300045836 Bacteria 1955
551 Ga0466967_0002127 3300045976 Bacteria 12138
552 Ga0466967_0019542 3300045976 Bacteria 5450
553 Ga0466967_0024454 3300045976 Unclassified 4966
554 Ga0466967_0034868 3300045976 Bacteria 4276
555 Ga0466967_0044823 3300045976 Bacteria 3839
556 Ga0466967_0062381 3300045976 Bacteria 3308
557 Ga0495580_0044422 3300046472 Bacteria 3160
558 Ga0495610_0000741 3300046512 Bacteria 30987
559 Ga0495620_0001937 3300046515 Bacteria 12117
560 Ga0495620_0026522 3300046515 Bacteria 2724
561 Ga0495632_0019430 3300046519 Bacteria 3702
562 Ga0495642_0055178 3300046528 Bacteria 1640
563 Ga0495645_0023850 3300046543 Bacteria 4435
564 Ga0495625_0012365 3300046660 Bacteria 6918
565 Ga0495686_0007303 3300047472 Bacteria 8303
566 Ga0495686_0011196 3300047472 Bacteria 6328
567 Ga0496102_0153433 3300048905 Bacteria 2165
568 Ga0496104_0014966 3300048907 Bacteria 7017
569 Ga0496108_0308875 3300048911 Bacteria 1378
570 Ga0496109_0109004 3300048912 Bacteria 2574
571 Ga0496112_0003611 3300048915 Bacteria 12880
572 Ga0496112_0038502 3300048915 Unclassified 4669
573 Ga0496112_0284605 3300048915 Bacteria 1600
574 Ga0496113_0017282 3300048916 Bacteria 5003
575 Ga0501323_004310 3300049539 Unclassified 1499
576 Ga0501031_0014975 3300049568 Bacteria 5037
577 Ga0501031_0039359 3300049568 Bacteria 3085
578 Ga0501033_0019236 3300049570 Bacteria 5162
579 Ga0501034_0142646 3300049571 Bacteria 2374
580 Ga0501034_0239515 3300049571 Bacteria 1761
581 Ga0501036_0024337 3300049572 Bacteria 5104
582 Ga0501036_0030940 3300049572 Bacteria 4523
583 Ga0501037_0000240 3300049573 Bacteria 47068
584 Ga0501038_0030585 3300049574 Bacteria 4762
585 Ga0501038_0036575 3300049574 Bacteria 4308
586 Ga0501039_0049676 3300049575 Bacteria 3243
587 Ga0501039_0145499 3300049575 Bacteria 1862
588 Ga0501040_0001682 3300049576 Bacteria 14164
589 Ga0501040_0069168 3300049576 Bacteria 2435
590 Ga0501041_0003044 3300049577 Bacteria 9618
591 Ga0501042_0000935 3300049578 Bacteria 16467
592 Ga0501042_0005151 3300049578 Bacteria 8391
593 Ga0501043_0049989 3300049579 Bacteria 3287
594 Ga0501046_0007013 3300049580 Bacteria 9926
595 Ga0501046_0087707 3300049580 Bacteria 2397
596 Ga0501047_0235683 3300049581 Bacteria 1682
597 Ga0501048_0034730 3300049582 Bacteria 3635
598 Ga0501048_0039381 3300049582 Bacteria 3391
599 Ga0501067_0000849 3300049583 Bacteria 16474
600 Ga0501067_0049823 3300049583 Bacteria 2321
601 Ga0501067_0064111 3300049583 Bacteria 2035
602 Ga0501068_0009520 3300049584 Bacteria 5440
603 Ga0501069_0081649 3300049585 Bacteria 1821
604 Ga0501070_0019217 3300049586 Bacteria 5730
605 Ga0501070_0040158 3300049586 Bacteria 3902
606 Ga0501071_0005144 3300049587 Bacteria 8380
607 Ga0501071_0014009 3300049587 Bacteria 5479
608 Ga0501071_0103433 3300049587 Bacteria 2101
609 Ga0501072_0026890 3300049588 Bacteria 4489
610 Ga0501072_0183338 3300049588 Bacteria 1670
611 Ga0501073_0005253 3300049589 Bacteria 9709
612 Ga0501073_0135221 3300049589 Bacteria 1709
613 Ga0501073_0228257 3300049589 Bacteria 1286
614 Ga0501074_0051307 3300049590 Bacteria 2977
615 Ga0501075_0029266 3300049591 Bacteria 4072
616 Ga0501075_0058535 3300049591 Bacteria 2902
617 Ga0501075_0238847 3300049591 Bacteria 1385
618 Ga0501076_0005738 3300049592 Bacteria 8945
619 Ga0501076_0011665 3300049592 Bacteria 6558
620 Ga0501076_0013165 3300049592 Bacteria 6196
621 Ga0501076_0175046 3300049592 Bacteria 1749
622 Ga0501076_0198657 3300049592 Bacteria 1637
623 Ga0501077_0000046 3300049593 Bacteria 62239
624 Ga0501077_0049491 3300049593 Bacteria 2671
625 Ga0501224_009848 3300049664 Unclassified 1399
626 Ga0501238_000091 3300049671 Bacteria 14462
627 Ga0501249_000011 3300049679 Bacteria 168084
628 Ga0501249_000854 3300049679 Bacteria 6757
629 Ga0501249_024946 3300049679 Bacteria 1318
630 Ga0501079_0017878 3300049741 Bacteria 5415
631 Ga0501080_0004063 3300049742 Bacteria 12958
632 Ga0501080_0047224 3300049742 Bacteria 4008
633 Ga0501080_0081093 3300049742 Bacteria 3015
634 Ga0501080_0258375 3300049742 Bacteria 1587
635 Ga0501083_0001353 3300049744 Bacteria 16651
636 Ga0501266_000016 3300049763 Bacteria 164181
637 Ga0501280_000271 3300049776 Bacteria 13166
638 Ga0501035_0006113 3300049822 Bacteria 11333
639 Ga0501035_0057940 3300049822 Bacteria 3453
640 Ga0501035_0318909 3300049822 Bacteria 1306
641 Ga0501044_0000957 3300049823 Bacteria 34681
642 Ga0501044_0249872 3300049823 Bacteria 1715
643 Ga0501045_0043791 3300049824 Bacteria 3260
644 Ga0501045_0201832 3300049824 Bacteria 1481
645 nmdc:mga06z11_74688_c1 3300050494 Bacteria 1803
646 nmdc:mga0n895_2275_c1 3300050512 Bacteria 14895
647 nmdc:mga0rr50_29956_c1 3300050513 Bacteria 3846
648 nmdc:mga08x19_20979_c1 3300050514 Bacteria 4029
649 nmdc:mga08x19_4578_c1 3300050514 Bacteria 8208
650 nmdc:mga0a205_6325_c1 3300050515 Bacteria 10690
651 Ga0495655_0031599 3300053083 Bacteria 1289
652 Ga0500633_0000311 3300053160 Bacteria 7182
653 Ga0501084_0085793 3300054114 Bacteria 2643
654 Ga0501084_0168728 3300054114 Bacteria 1847
655 Ga0590071_000585 3300059421 Bacteria 10495
656 Ga0590071_000919 3300059421 Bacteria 8163
657 Ga0590071_000953 3300059421 Bacteria 8000
658 Ga0590071_007895 3300059421 Bacteria 2516
659 Ga0590071_017868 3300059421 Bacteria 1667
660 Ga0590071_019247 3300059421 Bacteria 1606
661 Ga0590071_025947 3300059421 Bacteria 1390
662 Ga0590074_001496 3300059423 Bacteria 3773
663 Ga0590074_002612 3300059423 Bacteria 2956
664 Ga0590074_007523 3300059423 Bacteria 1810
665 Ga0590075_001890 3300059424 Bacteria 5082
666 Ga0590077_000022 3300059426 Bacteria 35588
667 Ga0590077_000232 3300059426 Bacteria 15988
668 Ga0587084_002340 3300059477 Unclassified 1950
669 Ga0587093_004122 3300059478 Bacteria 1465
670 Ga0587066_000022 3300059490 Bacteria 7063
671 Ga0587077_000609 3300059493 Unclassified 3232
672 Ga0587080_000484 3300059503 Unclassified 3414
673 Ga0587082_000015 3300059504 Bacteria 8062
674 Ga0587085_000330 3300059506 Unclassified 3276
675 Ga0587088_000816 3300059508 Unclassified 2902
676 Ga0587091_000091 3300059511 Bacteria 5068
677 Ga0587094_000263 3300059513 Unclassified 3602
678 Ga0587099_000992 3300059622 Unclassified 1895
679 Ga0587072_000992 3300059643 Unclassified 3304
680 Ga0587075_000008 3300059644 Bacteria 9548
681 Ga0501082_0000072 3300060353 Bacteria 73322
682 Ga0501082_0002039 3300060353 Bacteria 17754
683 Ga0501082_0232812 3300060353 Bacteria 1603
684 Ga0466962_0000017 3300061719 Bacteria 97361
685 Ga0466962_0025790 3300061719 Bacteria 2821
686 Ga0530510_0047805 3300061734 Bacteria 3092
687 Ga0530510_0113535 3300061734 Bacteria 1985

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049539 Ga0501323_004310 Ga0501323_004310_498_1481 327
2 3300045049 Ga0466959_0222703 Ga0466959_0222703_89_1096 331
3 3300061719 Ga0466962_0025790 Ga0466962_0025790_1762_2811 332
4 3300039447 Ga0436361_0323325 Ga0436361_0323325_780_1817 341
5 3300009545 Ga0105237_10083831 Ga0105237_100838312 344
6 3300046528 Ga0495642_0055178 Ga0495642_0055178_546_1604 344
7 3300045976 Ga0466967_0019542 Ga0466967_0019542_2177_3295 348
8 3300044694 Ga0466963_0022152 Ga0466963_0022152_2114_3226 352
9 3300044842 Ga0466957_0009810 Ga0466957_0009810_801_1913 352
10 3300045836 Ga0466958_0038998 Ga0466958_0038998_204_1316 352
11 3300049592 Ga0501076_0175046 Ga0501076_0175046_389_1504 354
12 3300032002 Ga0307416_100216193 Ga0307416_1002161931 355
13 3300006914 Ga0075436_100000256 Ga0075436_10000025615 356
14 3300009093 Ga0105240_10027417 Ga0105240_100274175 356
15 3300050514 nmdc:mga08x19_4578_c1 nmdc:mga08x19_4578_c1_1130_2251 356
16 3300009174 Ga0105241_10000074 Ga0105241_1000007417 357
17 3300010375 Ga0105239_10179478 Ga0105239_101794782 357
18 3300025911 Ga0207654_10000380 Ga0207654_1000038016 357
19 3300044712 Ga0453684_0095925 Ga0453684_0095925_401_1522 357
20 3300049568 Ga0501031_0014975 Ga0501031_0014975_1260_2375 357
21 3300049570 Ga0501033_0019236 Ga0501033_0019236_3773_4888 357
22 3300049572 Ga0501036_0024337 Ga0501036_0024337_136_1251 357
23 3300049574 Ga0501038_0030585 Ga0501038_0030585_3200_4315 357
24 3300049575 Ga0501039_0145499 Ga0501039_0145499_514_1629 357
25 3300049580 Ga0501046_0007013 Ga0501046_0007013_3757_4872 357
26 3300049583 Ga0501067_0000849 Ga0501067_0000849_1733_2848 357
27 3300049584 Ga0501068_0009520 Ga0501068_0009520_3024_4139 357
28 3300049586 Ga0501070_0019217 Ga0501070_0019217_3313_4428 357
29 3300049587 Ga0501071_0005144 Ga0501071_0005144_3333_4448 357
30 3300049589 Ga0501073_0005253 Ga0501073_0005253_3547_4662 357
31 3300049591 Ga0501075_0238847 Ga0501075_0238847_59_1174 357
32 3300049592 Ga0501076_0198657 Ga0501076_0198657_181_1296 357
33 3300049741 Ga0501079_0017878 Ga0501079_0017878_2998_4113 357
34 3300049824 Ga0501045_0043791 Ga0501045_0043791_300_1415 357
35 3300060353 Ga0501082_0002039 Ga0501082_0002039_2651_3766 357
36 3300037466 Ga0395898_0019877 Ga0395898_0019877_4290_5408 359
37 3300044842 Ga0466957_0041836 Ga0466957_0041836_386_1471 359
38 3300059477 Ga0587084_002340 Ga0587084_002340_120_1238 359
39 3300059478 Ga0587093_004122 Ga0587093_004122_262_1380 359
40 3300059490 Ga0587066_000022 Ga0587066_000022_3806_4924 359
41 3300059493 Ga0587077_000609 Ga0587077_000609_1843_2961 359
42 3300059503 Ga0587080_000484 Ga0587080_000484_1933_3051 359
43 3300059504 Ga0587082_000015 Ga0587082_000015_4797_5915 359
44 3300059506 Ga0587085_000330 Ga0587085_000330_1765_2883 359
45 3300059508 Ga0587088_000816 Ga0587088_000816_1394_2512 359
46 3300059511 Ga0587091_000091 Ga0587091_000091_2158_3276 359
47 3300059513 Ga0587094_000263 Ga0587094_000263_425_1543 359
48 3300059622 Ga0587099_000992 Ga0587099_000992_425_1543 359
49 3300059643 Ga0587072_000992 Ga0587072_000992_1784_2902 359
50 3300059644 Ga0587075_000008 Ga0587075_000008_6644_7762 359
51 3300005344 Ga0070661_100035295 Ga0070661_1000352953 360
52 3300005344 Ga0070661_100061373 Ga0070661_1000613732 360
53 3300005535 Ga0070684_100063457 Ga0070684_1000634572 360
54 3300005539 Ga0068853_100000645 Ga0068853_10000064512 360
55 3300005539 Ga0068853_100080059 Ga0068853_1000800592 360
56 3300005563 Ga0068855_100003472 Ga0068855_10000347211 360
57 3300005563 Ga0068855_100017874 Ga0068855_1000178745 360
58 3300005577 Ga0068857_100007995 Ga0068857_1000079956 360
59 3300005578 Ga0068854_100007202 Ga0068854_1000072025 360
60 3300005614 Ga0068856_100023721 Ga0068856_1000237213 360
61 3300005616 Ga0068852_100029057 Ga0068852_1000290576 360
62 3300005834 Ga0068851_10017700 Ga0068851_100177004 360
63 3300009093 Ga0105240_10012189 Ga0105240_100121894 360
64 3300009093 Ga0105240_10015500 Ga0105240_100155002 360
65 3300009174 Ga0105241_10002755 Ga0105241_1000275511 360
66 3300009545 Ga0105237_10004817 Ga0105237_1000481714 360
67 3300009551 Ga0105238_10028496 Ga0105238_100284965 360
68 3300009551 Ga0105238_10075818 Ga0105238_100758182 360
69 3300010375 Ga0105239_10036104 Ga0105239_100361043 360
70 3300013105 Ga0157369_10005663 Ga0157369_1000566312 360
71 3300013105 Ga0157369_10021141 Ga0157369_100211412 360
72 3300013105 Ga0157369_10103974 Ga0157369_101039743 360
73 3300013307 Ga0157372_10001505 Ga0157372_100015057 360
74 3300013307 Ga0157372_10005419 Ga0157372_100054198 360
75 3300013307 Ga0157372_10114709 Ga0157372_101147092 360
76 3300013307 Ga0157372_10489690 Ga0157372_104896901 360
77 3300020080 Ga0206350_10856568 Ga0206350_108565685 360
78 3300022467 Ga0224712_10000481 Ga0224712_100004815 360
79 3300025321 Ga0207656_10016389 Ga0207656_100163892 360
80 3300025913 Ga0207695_10003411 Ga0207695_1000341114 360
81 3300025913 Ga0207695_10031688 Ga0207695_100316883 360
82 3300025914 Ga0207671_10003647 Ga0207671_100036472 360
83 3300025920 Ga0207649_10047500 Ga0207649_100475002 360
84 3300025924 Ga0207694_10000160 Ga0207694_1000016013 360
85 3300025924 Ga0207694_10016365 Ga0207694_100163652 360
86 3300025944 Ga0207661_10020713 Ga0207661_100207133 360
87 3300025949 Ga0207667_10044718 Ga0207667_100447183 360
88 3300025981 Ga0207640_10004197 Ga0207640_100041975 360
89 3300026041 Ga0207639_10000145 Ga0207639_1000014539 360
90 3300026078 Ga0207702_10035114 Ga0207702_100351143 360
91 3300026116 Ga0207674_10020466 Ga0207674_100204662 360
92 3300005435 Ga0070714_100134707 Ga0070714_1001347071 361
93 3300025929 Ga0207664_10385871 Ga0207664_103858711 361
94 3300045976 Ga0466967_0044823 Ga0466967_0044823_1693_2784 361
95 3300045976 Ga0466967_0034868 Ga0466967_0034868_613_1728 363
96 3300045976 Ga0466967_0062381 Ga0466967_0062381_1943_3040 363
97 3300049583 Ga0501067_0049823 Ga0501067_0049823_50_1171 364
98 3300036712 Ga0316584_0037359 Ga0316584_0037359_2241_3359 365
99 3300005329 Ga0070683_100070223 Ga0070683_1000702232 366
100 3300005439 Ga0070711_100227387 Ga0070711_1002273872 366
101 3300013307 Ga0157372_10002780 Ga0157372_1000278015 366
102 3300021388 Ga0213875_10001132 Ga0213875_100011324 366
103 3300037853 Ga0436364_0566500 Ga0436364_0566500_52974_54125 366
104 3300044694 Ga0466963_0097910 Ga0466963_0097910_733_1851 366
105 3300045976 Ga0466967_0024454 Ga0466967_0024454_3338_4486 366
106 iso_pu_bacteria 2857613821 2857614856 366
107 3300004799 Ga0058863_11748332 Ga0058863_117483323 367
108 3300004803 Ga0058862_12292174 Ga0058862_122921742 367
109 3300004803 Ga0058862_12842061 Ga0058862_128420613 367
110 3300005327 Ga0070658_10002428 Ga0070658_1000242813 367
111 3300005327 Ga0070658_10010486 Ga0070658_100104862 367
112 3300005327 Ga0070658_10045618 Ga0070658_100456183 367
113 3300005327 Ga0070658_10046302 Ga0070658_100463023 367
114 3300005327 Ga0070658_10348271 Ga0070658_103482711 367
115 3300005329 Ga0070683_100003153 Ga0070683_10000315312 367
116 3300005329 Ga0070683_100039535 Ga0070683_1000395354 367
117 3300005329 Ga0070683_100204148 Ga0070683_1002041482 367
118 3300005331 Ga0070670_100001140 Ga0070670_10000114011 367
119 3300005334 Ga0068869_100003119 Ga0068869_1000031192 367
120 3300005336 Ga0070680_100006987 Ga0070680_1000069872 367
121 3300005338 Ga0068868_100000110 Ga0068868_10000011043 367
122 3300005339 Ga0070660_100014526 Ga0070660_1000145267 367
123 3300005339 Ga0070660_100174821 Ga0070660_1001748212 367
124 3300005340 Ga0070689_100016821 Ga0070689_1000168214 367
125 3300005344 Ga0070661_100003285 Ga0070661_1000032852 367
126 3300005344 Ga0070661_100013818 Ga0070661_1000138182 367
127 3300005344 Ga0070661_100050703 Ga0070661_1000507032 367
128 3300005355 Ga0070671_100001247 Ga0070671_1000012474 367
129 3300005366 Ga0070659_100037292 Ga0070659_1000372922 367
130 3300005367 Ga0070667_100000289 Ga0070667_10000028932 367
131 3300005436 Ga0070713_100096966 Ga0070713_1000969662 367
132 3300005458 Ga0070681_10048941 Ga0070681_100489413 367
133 3300005530 Ga0070679_100002644 Ga0070679_1000026448 367
134 3300005530 Ga0070679_100104512 Ga0070679_1001045122 367
135 3300005530 Ga0070679_100139692 Ga0070679_1001396922 367
136 3300005535 Ga0070684_100000822 Ga0070684_1000008229 367
137 3300005535 Ga0070684_100077072 Ga0070684_1000770722 367
138 3300005539 Ga0068853_100049991 Ga0068853_1000499912 367
139 3300005539 Ga0068853_100054589 Ga0068853_1000545892 367
140 3300005539 Ga0068853_100342974 Ga0068853_1003429741 367
141 3300005563 Ga0068855_100004985 Ga0068855_1000049857 367
142 3300005563 Ga0068855_100022663 Ga0068855_1000226634 367
143 3300005563 Ga0068855_100026188 Ga0068855_1000261886 367
144 3300005563 Ga0068855_100037620 Ga0068855_1000376202 367
145 3300005563 Ga0068855_100045621 Ga0068855_1000456216 367
146 3300005563 Ga0068855_100058558 Ga0068855_1000585584 367
147 3300005563 Ga0068855_100072754 Ga0068855_1000727543 367
148 3300005563 Ga0068855_100175664 Ga0068855_1001756642 367
149 3300005563 Ga0068855_100291181 Ga0068855_1002911812 367
150 3300005577 Ga0068857_100002939 Ga0068857_1000029399 367
151 3300005577 Ga0068857_100003860 Ga0068857_10000386011 367
152 3300005614 Ga0068856_100002433 Ga0068856_10000243315 367
153 3300005614 Ga0068856_100011197 Ga0068856_1000111972 367
154 3300005614 Ga0068856_100049532 Ga0068856_1000495322 367
155 3300005614 Ga0068856_100059555 Ga0068856_1000595554 367
156 3300005614 Ga0068856_100115561 Ga0068856_1001155612 367
157 3300005616 Ga0068852_100000027 Ga0068852_10000002711 367
158 3300005616 Ga0068852_100001442 Ga0068852_1000014429 367
159 3300005616 Ga0068852_100060214 Ga0068852_1000602143 367
160 3300005617 Ga0068859_100003668 Ga0068859_1000036686 367
161 3300005618 Ga0068864_100001232 Ga0068864_10000123220 367
162 3300005834 Ga0068851_10006679 Ga0068851_100066793 367
163 3300005834 Ga0068851_10024026 Ga0068851_100240262 367
164 3300005834 Ga0068851_10043919 Ga0068851_100439192 367
165 3300005841 Ga0068863_100002128 Ga0068863_1000021282 367
166 3300005842 Ga0068858_100015131 Ga0068858_1000151316 367
167 3300005843 Ga0068860_100083152 Ga0068860_1000831522 367
168 3300005844 Ga0068862_100240410 Ga0068862_1002404102 367
169 3300005937 Ga0081455_10026466 Ga0081455_100264661 367
170 3300005937 Ga0081455_10028271 Ga0081455_100282712 367
171 3300006028 Ga0070717_10003134 Ga0070717_100031343 367
172 3300006237 Ga0097621_100005059 Ga0097621_1000050592 367
173 3300006358 Ga0068871_100000321 Ga0068871_10000032117 367
174 3300006931 Ga0097620_100003668 Ga0097620_1000036686 367
175 3300009093 Ga0105240_10000002 Ga0105240_10000002292 367
176 3300009093 Ga0105240_10000130 Ga0105240_1000013074 367
177 3300009093 Ga0105240_10000222 Ga0105240_1000022210 367
178 3300009093 Ga0105240_10005666 Ga0105240_1000566611 367
179 3300009093 Ga0105240_10172550 Ga0105240_101725502 367
180 3300009098 Ga0105245_10000169 Ga0105245_1000016935 367
181 3300009101 Ga0105247_10035139 Ga0105247_100351392 367
182 3300009174 Ga0105241_10004865 Ga0105241_100048657 367
183 3300009174 Ga0105241_10096571 Ga0105241_100965712 367
184 3300009174 Ga0105241_10115283 Ga0105241_101152832 367
185 3300009177 Ga0105248_10006190 Ga0105248_100061906 367
186 3300009545 Ga0105237_10015269 Ga0105237_100152696 367
187 3300009545 Ga0105237_10107264 Ga0105237_101072642 367
188 3300009551 Ga0105238_10000516 Ga0105238_100005169 367
189 3300009551 Ga0105238_10001890 Ga0105238_100018902 367
190 3300009551 Ga0105238_10032609 Ga0105238_100326094 367
191 3300009551 Ga0105238_10044053 Ga0105238_100440534 367
192 3300009553 Ga0105249_10019112 Ga0105249_100191123 367
193 3300010375 Ga0105239_10092589 Ga0105239_100925892 367
194 3300010375 Ga0105239_10114770 Ga0105239_101147703 367
195 3300011119 Ga0105246_10004915 Ga0105246_100049156 367
196 3300013102 Ga0157371_10027541 Ga0157371_100275413 367
197 3300013102 Ga0157371_10131433 Ga0157371_101314332 367
198 3300013104 Ga0157370_10001610 Ga0157370_1000161010 367
199 3300013104 Ga0157370_10003900 Ga0157370_1000390016 367
200 3300013104 Ga0157370_10284123 Ga0157370_102841232 367
201 3300013105 Ga0157369_10000112 Ga0157369_1000011211 367
202 3300013105 Ga0157369_10006503 Ga0157369_100065033 367
203 3300013105 Ga0157369_10011061 Ga0157369_100110618 367
204 3300013105 Ga0157369_10019713 Ga0157369_100197136 367
205 3300013105 Ga0157369_10028434 Ga0157369_100284342 367
206 3300013105 Ga0157369_10041174 Ga0157369_100411742 367
207 3300013105 Ga0157369_10053709 Ga0157369_100537092 367
208 3300013105 Ga0157369_10109224 Ga0157369_101092242 367
209 3300013105 Ga0157369_10317042 Ga0157369_103170422 367
210 3300013296 Ga0157374_10003684 Ga0157374_100036849 367
211 3300013296 Ga0157374_10212079 Ga0157374_102120792 367
212 3300013297 Ga0157378_10068696 Ga0157378_100686962 367
213 3300013306 Ga0163162_10007637 Ga0163162_100076378 367
214 3300013307 Ga0157372_10000422 Ga0157372_100004225 367
215 3300013307 Ga0157372_10001211 Ga0157372_1000121110 367
216 3300013307 Ga0157372_10010205 Ga0157372_100102055 367
217 3300013307 Ga0157372_10014537 Ga0157372_100145376 367
218 3300013307 Ga0157372_10029940 Ga0157372_100299403 367
219 3300013307 Ga0157372_10118093 Ga0157372_101180932 367
220 3300013307 Ga0157372_10159313 Ga0157372_101593132 367
221 3300013307 Ga0157372_10188412 Ga0157372_101884122 367
222 3300013307 Ga0157372_10540176 Ga0157372_105401761 367
223 3300013308 Ga0157375_10009640 Ga0157375_100096402 367
224 3300014325 Ga0163163_10000679 Ga0163163_1000067923 367
225 3300014968 Ga0157379_10000499 Ga0157379_1000049918 367
226 3300014969 Ga0157376_10049393 Ga0157376_100493933 367
227 3300020069 Ga0197907_10413395 Ga0197907_104133952 367
228 3300020070 Ga0206356_11119816 Ga0206356_111198162 367
229 3300020070 Ga0206356_11224057 Ga0206356_112240572 367
230 3300020070 Ga0206356_11259921 Ga0206356_112599213 367
231 3300020075 Ga0206349_1887837 Ga0206349_18878372 367
232 3300020076 Ga0206355_1317415 Ga0206355_13174152 367
233 3300020077 Ga0206351_10173209 Ga0206351_101732092 367
234 3300020077 Ga0206351_10279165 Ga0206351_102791652 367
235 3300020077 Ga0206351_10397847 Ga0206351_103978474 367
236 3300020077 Ga0206351_10501227 Ga0206351_105012272 367
237 3300020080 Ga0206350_10152871 Ga0206350_101528712 367
238 3300020080 Ga0206350_10331461 Ga0206350_103314615 367
239 3300020080 Ga0206350_11147263 Ga0206350_111472635 367
240 3300020082 Ga0206353_10373932 Ga0206353_103739322 367
241 3300020082 Ga0206353_11873519 Ga0206353_118735192 367
242 3300021361 Ga0213872_10074906 Ga0213872_100749062 367
243 3300022467 Ga0224712_10000924 Ga0224712_100009244 367
244 3300025321 Ga0207656_10012886 Ga0207656_100128862 367
245 3300025321 Ga0207656_10022804 Ga0207656_100228042 367
246 3300025900 Ga0207710_10018498 Ga0207710_100184982 367
247 3300025909 Ga0207705_10009770 Ga0207705_100097702 367
248 3300025909 Ga0207705_10013790 Ga0207705_100137903 367
249 3300025909 Ga0207705_10021455 Ga0207705_100214552 367
250 3300025911 Ga0207654_10001262 Ga0207654_100012622 367
251 3300025911 Ga0207654_10075093 Ga0207654_100750932 367
252 3300025913 Ga0207695_10000002 Ga0207695_10000002294 367
253 3300025913 Ga0207695_10000028 Ga0207695_10000028208 367
254 3300025913 Ga0207695_10000094 Ga0207695_10000094114 367
255 3300025913 Ga0207695_10000177 Ga0207695_1000017718 367
256 3300025913 Ga0207695_10000292 Ga0207695_1000029274 367
257 3300025913 Ga0207695_10013379 Ga0207695_100133797 367
258 3300025914 Ga0207671_10000487 Ga0207671_100004873 367
259 3300025917 Ga0207660_10120254 Ga0207660_101202542 367
260 3300025919 Ga0207657_10002127 Ga0207657_1000212723 367
261 3300025919 Ga0207657_10128475 Ga0207657_101284752 367
262 3300025919 Ga0207657_10176205 Ga0207657_101762052 367
263 3300025920 Ga0207649_10001021 Ga0207649_1000102113 367
264 3300025920 Ga0207649_10036626 Ga0207649_100366263 367
265 3300025921 Ga0207652_10002522 Ga0207652_100025227 367
266 3300025921 Ga0207652_10054285 Ga0207652_100542854 367
267 3300025921 Ga0207652_10171045 Ga0207652_101710452 367
268 3300025924 Ga0207694_10001418 Ga0207694_100014182 367
269 3300025924 Ga0207694_10003078 Ga0207694_1000307810 367
270 3300025924 Ga0207694_10195322 Ga0207694_101953221 367
271 3300025925 Ga0207650_10006218 Ga0207650_100062183 367
272 3300025927 Ga0207687_10000471 Ga0207687_1000047112 367
273 3300025928 Ga0207700_10085582 Ga0207700_100855822 367
274 3300025929 Ga0207664_10058997 Ga0207664_100589973 367
275 3300025931 Ga0207644_10018310 Ga0207644_100183102 367
276 3300025936 Ga0207670_10010318 Ga0207670_100103182 367
277 3300025941 Ga0207711_10024254 Ga0207711_100242542 367
278 3300025942 Ga0207689_10006228 Ga0207689_100062282 367
279 3300025944 Ga0207661_10041851 Ga0207661_100418512 367
280 3300025944 Ga0207661_10089413 Ga0207661_100894132 367
281 3300025944 Ga0207661_10163589 Ga0207661_101635892 367
282 3300025949 Ga0207667_10000056 Ga0207667_1000005696 367
283 3300025949 Ga0207667_10003095 Ga0207667_1000309514 367
284 3300025949 Ga0207667_10014779 Ga0207667_100147795 367
285 3300025949 Ga0207667_10014961 Ga0207667_100149616 367
286 3300025949 Ga0207667_10156868 Ga0207667_101568682 367
287 3300025949 Ga0207667_10188096 Ga0207667_101880961 367
288 3300025949 Ga0207667_10206587 Ga0207667_102065872 367
289 3300025949 Ga0207667_10242541 Ga0207667_102425412 367
290 3300025986 Ga0207658_10000549 Ga0207658_1000054921 367
291 3300026023 Ga0207677_10000055 Ga0207677_1000005574 367
292 3300026035 Ga0207703_10072517 Ga0207703_100725173 367
293 3300026041 Ga0207639_10000460 Ga0207639_100004608 367
294 3300026041 Ga0207639_10154624 Ga0207639_101546242 367
295 3300026067 Ga0207678_10011955 Ga0207678_100119557 367
296 3300026078 Ga0207702_10001122 Ga0207702_1000112214 367
297 3300026078 Ga0207702_10067512 Ga0207702_100675122 367
298 3300026078 Ga0207702_10224718 Ga0207702_102247181 367
299 3300026078 Ga0207702_10259265 Ga0207702_102592652 367
300 3300026088 Ga0207641_10000596 Ga0207641_1000059625 367
301 3300026095 Ga0207676_10002442 Ga0207676_100024422 367
302 3300026116 Ga0207674_10001250 Ga0207674_1000125012 367
303 3300026116 Ga0207674_10002359 Ga0207674_1000235915 367
304 3300026142 Ga0207698_10000021 Ga0207698_10000021113 367
305 3300026142 Ga0207698_10061251 Ga0207698_100612512 367
306 3300026142 Ga0207698_10066020 Ga0207698_100660203 367
307 3300026142 Ga0207698_10191627 Ga0207698_101916272 367
308 3300028380 Ga0268265_10075316 Ga0268265_100753162 367
309 3300028381 Ga0268264_10000433 Ga0268264_1000043311 367
310 3300031548 Ga0307408_100019720 Ga0307408_1000197203 367
311 3300031730 Ga0307516_10007406 Ga0307516_100074064 367
312 3300031731 Ga0307405_10026664 Ga0307405_100266643 367
313 3300031903 Ga0307407_10000809 Ga0307407_100008096 367
314 3300031911 Ga0307412_10081163 Ga0307412_100811632 367
315 3300031995 Ga0307409_100000776 Ga0307409_1000007767 367
316 3300032002 Ga0307416_100002055 Ga0307416_1000020556 367
317 3300032002 Ga0307416_100104559 Ga0307416_1001045592 367
318 3300032004 Ga0307414_10028651 Ga0307414_100286513 367
319 3300032126 Ga0307415_100006483 Ga0307415_1000064835 367
320 3300037418 Ga0395900_0108357 Ga0395900_0108357_795_1916 367
321 3300037466 Ga0395898_0223176 Ga0395898_0223176_426_1547 367
322 3300039437 Ga0436365_0281631 Ga0436365_0281631_711_1826 367
323 3300039438 Ga0436360_0257927 Ga0436360_0257927_3853_4974 367
324 3300039438 Ga0436360_0373346 Ga0436360_0373346_1387_2508 367
325 3300039447 Ga0436361_0221137 Ga0436361_0221137_2604_3725 367
326 3300039447 Ga0436361_0997213 Ga0436361_0997213_17872_18993 367
327 3300042005 Ga0439448_0017508 Ga0439448_0017508_47_1168 367
328 3300044684 Ga0466966_0146274 Ga0466966_0146274_43_1164 367
329 3300045049 Ga0466959_0071712 Ga0466959_0071712_387_1508 367
330 3300045836 Ga0466958_0084694 Ga0466958_0084694_525_1646 367
331 3300045976 Ga0466967_0002127 Ga0466967_0002127_2569_3690 367
332 3300046543 Ga0495645_0023850 Ga0495645_0023850_195_1319 367
333 3300047472 Ga0495686_0007303 Ga0495686_0007303_258_1379 367
334 3300049576 Ga0501040_0001682 Ga0501040_0001682_6683_7861 367
335 3300049578 Ga0501042_0000935 Ga0501042_0000935_4304_5482 367
336 3300061734 Ga0530510_0047805 Ga0530510_0047805_1242_2357 367
337 iso_pu_bacteria 2910245624 2910248541 367
338 iso_pu_bacteria 8003014200 8003014749 367
339 3300003856 Ga0058692_1000006 Ga0058692_1000006139 368
340 3300005336 Ga0070680_100007450 Ga0070680_1000074504 368
341 3300005458 Ga0070681_10001597 Ga0070681_100015977 368
342 3300005530 Ga0070679_100000854 Ga0070679_10000085421 368
343 3300005563 Ga0068855_100005586 Ga0068855_1000055863 368
344 3300005985 Ga0081539_10000639 Ga0081539_1000063985 368
345 3300013102 Ga0157371_10009561 Ga0157371_100095615 368
346 3300013104 Ga0157370_10190990 Ga0157370_101909902 368
347 3300013105 Ga0157369_10123221 Ga0157369_101232212 368
348 3300015261 Ga0182006_1013694 Ga0182006_10136943 368
349 3300025912 Ga0207707_10000481 Ga0207707_1000048113 368
350 3300025917 Ga0207660_10006095 Ga0207660_100060955 368
351 3300025921 Ga0207652_10000148 Ga0207652_1000014867 368
352 3300025949 Ga0207667_10002192 Ga0207667_100021927 368
353 3300027312 Ga0209371_1000016 Ga0209371_1000016141 368
354 3300030500 Ga0268256_1000015 Ga0268256_1000015430 368
355 3300031824 Ga0307413_10004354 Ga0307413_100043541 368
356 3300031852 Ga0307410_10000012 Ga0307410_1000001226 368
357 3300031901 Ga0307406_10000429 Ga0307406_1000042915 368
358 3300031903 Ga0307407_10003796 Ga0307407_100037962 368
359 3300031911 Ga0307412_10205765 Ga0307412_102057652 368
360 3300031995 Ga0307409_100008829 Ga0307409_1000088293 368
361 3300032004 Ga0307414_10000001 Ga0307414_100000011123 368
362 3300032004 Ga0307414_10035984 Ga0307414_100359842 368
363 3300032005 Ga0307411_10000001 Ga0307411_10000001551 368
364 3300037471 Ga0395905_0407569 Ga0395905_0407569_29_1138 368
365 3300044712 Ga0453684_0001086 Ga0453684_0001086_62609_63727 368
366 3300044712 Ga0453684_0001854 Ga0453684_0001854_36748_37866 368
367 3300044712 Ga0453684_0283778 Ga0453684_0283778_640_1758 368
368 3300046515 Ga0495620_0001937 Ga0495620_0001937_9023_10138 368
369 3300048915 Ga0496112_0003611 Ga0496112_0003611_952_2064 368
370 3300049586 Ga0501070_0040158 Ga0501070_0040158_2454_3596 368
371 3300049664 Ga0501224_009848 Ga0501224_009848_108_1220 368
372 3300049671 Ga0501238_000091 Ga0501238_000091_4212_5324 368
373 3300049679 Ga0501249_000011 Ga0501249_000011_33201_34313 368
374 3300049679 Ga0501249_000854 Ga0501249_000854_5036_6148 368
375 3300049744 Ga0501083_0001353 Ga0501083_0001353_12070_13176 368
376 3300049763 Ga0501266_000016 Ga0501266_000016_68289_69401 368
377 3300049776 Ga0501280_000271 Ga0501280_000271_1719_2831 368
378 3300049822 Ga0501035_0006113 Ga0501035_0006113_1702_2844 368
379 3300054114 Ga0501084_0168728 Ga0501084_0168728_591_1697 368
380 3300059421 Ga0590071_007895 Ga0590071_007895_418_1533 368
381 iso_pu_bacteria 8021622325 8021623051 368
382 iso_pu_bacteria 8021626552 8021629959 368
383 iso_pu_bacteria 8021648035 8021650385 368
384 3300001991 JGI24743J22301_10007917 JGI24743J22301_100079172 369
385 3300003577 Ga0007416J51690_1041533 Ga0007416J51690_10415331 369
386 3300003693 Ga0032354_1020727 Ga0032354_10207271 369
387 3300003693 Ga0032354_1021065 Ga0032354_10210653 369
388 3300005288 Ga0065714_10073034 Ga0065714_100730343 369
389 3300005290 Ga0065712_10003968 Ga0065712_100039684 369
390 3300005293 Ga0065715_10001568 Ga0065715_100015685 369
391 3300005327 Ga0070658_10000345 Ga0070658_1000034513 369
392 3300005327 Ga0070658_10000650 Ga0070658_1000065027 369
393 3300005327 Ga0070658_10145001 Ga0070658_101450012 369
394 3300005327 Ga0070658_10150341 Ga0070658_101503411 369
395 3300005328 Ga0070676_10048169 Ga0070676_100481691 369
396 3300005329 Ga0070683_100083384 Ga0070683_1000833843 369
397 3300005330 Ga0070690_100046425 Ga0070690_1000464252 369
398 3300005335 Ga0070666_10017705 Ga0070666_100177052 369
399 3300005335 Ga0070666_10052546 Ga0070666_100525462 369
400 3300005335 Ga0070666_10071574 Ga0070666_100715742 369
401 3300005336 Ga0070680_100000072 Ga0070680_10000007219 369
402 3300005336 Ga0070680_100300850 Ga0070680_1003008501 369
403 3300005338 Ga0068868_100122053 Ga0068868_1001220533 369
404 3300005339 Ga0070660_100032650 Ga0070660_1000326503 369
405 3300005339 Ga0070660_100033615 Ga0070660_1000336152 369
406 3300005340 Ga0070689_100016114 Ga0070689_1000161142 369
407 3300005344 Ga0070661_100042894 Ga0070661_1000428942 369
408 3300005344 Ga0070661_100186822 Ga0070661_1001868221 369
409 3300005347 Ga0070668_100067406 Ga0070668_1000674062 369
410 3300005354 Ga0070675_100008863 Ga0070675_1000088633 369
411 3300005355 Ga0070671_100012945 Ga0070671_1000129453 369
412 3300005355 Ga0070671_100017289 Ga0070671_1000172893 369
413 3300005355 Ga0070671_100094714 Ga0070671_1000947143 369
414 3300005364 Ga0070673_100004217 Ga0070673_1000042175 369
415 3300005365 Ga0070688_100001831 Ga0070688_1000018312 369
416 3300005366 Ga0070659_100093424 Ga0070659_1000934242 369
417 3300005366 Ga0070659_100145440 Ga0070659_1001454402 369
418 3300005367 Ga0070667_100035813 Ga0070667_1000358132 369
419 3300005367 Ga0070667_100201079 Ga0070667_1002010792 369
420 3300005435 Ga0070714_100085991 Ga0070714_1000859911 369
421 3300005437 Ga0070710_10028098 Ga0070710_100280982 369
422 3300005437 Ga0070710_10066564 Ga0070710_100665642 369
423 3300005438 Ga0070701_10153135 Ga0070701_101531351 369
424 3300005439 Ga0070711_100074515 Ga0070711_1000745152 369
425 3300005441 Ga0070700_100154870 Ga0070700_1001548702 369
426 3300005455 Ga0070663_100185036 Ga0070663_1001850361 369
427 3300005456 Ga0070678_100094099 Ga0070678_1000940992 369
428 3300005457 Ga0070662_100163584 Ga0070662_1001635842 369
429 3300005458 Ga0070681_10090672 Ga0070681_100906722 369
430 3300005458 Ga0070681_10090714 Ga0070681_100907142 369
431 3300005458 Ga0070681_10109455 Ga0070681_101094552 369
432 3300005466 Ga0070685_10003418 Ga0070685_100034184 369
433 3300005530 Ga0070679_100204288 Ga0070679_1002042882 369
434 3300005539 Ga0068853_100021631 Ga0068853_1000216312 369
435 3300005543 Ga0070672_100133354 Ga0070672_1001333542 369
436 3300005543 Ga0070672_100176438 Ga0070672_1001764381 369
437 3300005544 Ga0070686_100025434 Ga0070686_1000254342 369
438 3300005548 Ga0070665_100000134 Ga0070665_10000013460 369
439 3300005548 Ga0070665_100024237 Ga0070665_1000242372 369
440 3300005548 Ga0070665_100108672 Ga0070665_1001086722 369
441 3300005563 Ga0068855_100003388 Ga0068855_1000033884 369
442 3300005563 Ga0068855_100032978 Ga0068855_1000329783 369
443 3300005578 Ga0068854_100027922 Ga0068854_1000279222 369
444 3300005614 Ga0068856_100150059 Ga0068856_1001500593 369
445 3300005841 Ga0068863_100054324 Ga0068863_1000543242 369
446 3300005981 Ga0081538_10017318 Ga0081538_100173182 369
447 3300006028 Ga0070717_10020816 Ga0070717_100208164 369
448 3300006173 Ga0070716_100024703 Ga0070716_1000247032 369
449 3300006175 Ga0070712_100157935 Ga0070712_1001579352 369
450 3300006852 Ga0075433_10039695 Ga0075433_100396953 369
451 3300006871 Ga0075434_100000641 Ga0075434_10000064120 369
452 3300006914 Ga0075436_100049922 Ga0075436_1000499224 369
453 3300009093 Ga0105240_10006104 Ga0105240_100061047 369
454 3300009093 Ga0105240_10080777 Ga0105240_100807772 369
455 3300009093 Ga0105240_10086151 Ga0105240_100861512 369
456 3300009094 Ga0111539_10043418 Ga0111539_100434183 369
457 3300009098 Ga0105245_10067425 Ga0105245_100674251 369
458 3300009147 Ga0114129_10432061 Ga0114129_104320611 369
459 3300009545 Ga0105237_10134046 Ga0105237_101340462 369
460 3300009551 Ga0105238_10003327 Ga0105238_100033274 369
461 3300009551 Ga0105238_10010605 Ga0105238_100106056 369
462 3300010375 Ga0105239_10003064 Ga0105239_100030648 369
463 3300010375 Ga0105239_10026650 Ga0105239_100266502 369
464 3300013104 Ga0157370_10030259 Ga0157370_100302595 369
465 3300013104 Ga0157370_10067695 Ga0157370_100676952 369
466 3300013104 Ga0157370_10368755 Ga0157370_103687551 369
467 3300013105 Ga0157369_10034889 Ga0157369_100348894 369
468 3300013105 Ga0157369_10201586 Ga0157369_102015862 369
469 3300013296 Ga0157374_10040228 Ga0157374_100402284 369
470 3300013297 Ga0157378_10013535 Ga0157378_100135354 369
471 3300013307 Ga0157372_10077669 Ga0157372_100776693 369
472 3300013308 Ga0157375_10013056 Ga0157375_100130563 369
473 3300014497 Ga0182008_10092460 Ga0182008_100924602 369
474 3300014497 Ga0182008_10112226 Ga0182008_101122261 369
475 3300014969 Ga0157376_10006836 Ga0157376_100068366 369
476 3300020080 Ga0206350_10326591 Ga0206350_103265912 369
477 3300021358 Ga0213873_10000001 Ga0213873_100000011462 369
478 3300021361 Ga0213872_10021296 Ga0213872_100212961 369
479 3300021361 Ga0213872_10038149 Ga0213872_100381492 369
480 3300021384 Ga0213876_10000002 Ga0213876_1000000277 369
481 3300021388 Ga0213875_10000022 Ga0213875_1000002223 369
482 3300021388 Ga0213875_10000098 Ga0213875_1000009857 369
483 3300021388 Ga0213875_10001220 Ga0213875_100012207 369
484 3300021388 Ga0213875_10012047 Ga0213875_100120471 369
485 3300022467 Ga0224712_10003449 Ga0224712_100034494 369
486 3300022467 Ga0224712_10042673 Ga0224712_100426732 369
487 3300025271 Ga0207666_1000203 Ga0207666_10002035 369
488 3300025315 Ga0207697_10001245 Ga0207697_100012457 369
489 3300025315 Ga0207697_10002753 Ga0207697_100027534 369
490 3300025898 Ga0207692_10068186 Ga0207692_100681861 369
491 3300025898 Ga0207692_10098504 Ga0207692_100985042 369
492 3300025909 Ga0207705_10003383 Ga0207705_100033832 369
493 3300025909 Ga0207705_10224550 Ga0207705_102245502 369
494 3300025912 Ga0207707_10001382 Ga0207707_100013822 369
495 3300025912 Ga0207707_10040309 Ga0207707_100403093 369
496 3300025913 Ga0207695_10018270 Ga0207695_100182702 369
497 3300025913 Ga0207695_10029477 Ga0207695_100294775 369
498 3300025915 Ga0207693_10040100 Ga0207693_100401002 369
499 3300025916 Ga0207663_10124525 Ga0207663_101245251 369
500 3300025917 Ga0207660_10000419 Ga0207660_1000041920 369
501 3300025917 Ga0207660_10023320 Ga0207660_100233201 369
502 3300025919 Ga0207657_10041017 Ga0207657_100410173 369
503 3300025919 Ga0207657_10060529 Ga0207657_100605292 369
504 3300025919 Ga0207657_10234294 Ga0207657_102342942 369
505 3300025924 Ga0207694_10034558 Ga0207694_100345582 369
506 3300025924 Ga0207694_10073706 Ga0207694_100737063 369
507 3300025928 Ga0207700_10013750 Ga0207700_100137506 369
508 3300025931 Ga0207644_10027025 Ga0207644_100270253 369
509 3300025931 Ga0207644_10029497 Ga0207644_100294972 369
510 3300025931 Ga0207644_10073260 Ga0207644_100732602 369
511 3300025932 Ga0207690_10095942 Ga0207690_100959422 369
512 3300025932 Ga0207690_10101045 Ga0207690_101010451 369
513 3300025936 Ga0207670_10055887 Ga0207670_100558872 369
514 3300025939 Ga0207665_10023774 Ga0207665_100237742 369
515 3300025940 Ga0207691_10104014 Ga0207691_101040142 369
516 3300025944 Ga0207661_10026617 Ga0207661_100266174 369
517 3300025944 Ga0207661_10215437 Ga0207661_102154372 369
518 3300025945 Ga0207679_10052719 Ga0207679_100527192 369
519 3300025949 Ga0207667_10060830 Ga0207667_100608303 369
520 3300025972 Ga0207668_10074567 Ga0207668_100745672 369
521 3300025981 Ga0207640_10070567 Ga0207640_100705671 369
522 3300025986 Ga0207658_10041337 Ga0207658_100413372 369
523 3300026023 Ga0207677_10099141 Ga0207677_100991412 369
524 3300026041 Ga0207639_10016832 Ga0207639_100168323 369
525 3300026041 Ga0207639_10027069 Ga0207639_100270694 369
526 3300026067 Ga0207678_10045845 Ga0207678_100458453 369
527 3300026075 Ga0207708_10195103 Ga0207708_101951032 369
528 3300026088 Ga0207641_10203712 Ga0207641_102037122 369
529 3300028379 Ga0268266_10000637 Ga0268266_1000063746 369
530 3300028379 Ga0268266_10148142 Ga0268266_101481422 369
531 3300031251 Ga0265327_10027096 Ga0265327_100270962 369
532 3300031548 Ga0307408_100085860 Ga0307408_1000858601 369
533 3300031548 Ga0307408_100119750 Ga0307408_1001197501 369
534 3300031548 Ga0307408_100157716 Ga0307408_1001577162 369
535 3300031727 Ga0316576_10007137 Ga0316576_100071374 369
536 3300031728 Ga0316578_10000808 Ga0316578_100008087 369
537 3300031731 Ga0307405_10051826 Ga0307405_100518261 369
538 3300031731 Ga0307405_10056826 Ga0307405_100568262 369
539 3300031731 Ga0307405_10163311 Ga0307405_101633112 369
540 3300031824 Ga0307413_10035950 Ga0307413_100359502 369
541 3300031824 Ga0307413_10063501 Ga0307413_100635011 369
542 3300031852 Ga0307410_10073607 Ga0307410_100736073 369
543 3300031901 Ga0307406_10128122 Ga0307406_101281222 369
544 3300031903 Ga0307407_10004745 Ga0307407_100047455 369
545 3300031903 Ga0307407_10038198 Ga0307407_100381982 369
546 3300031903 Ga0307407_10057291 Ga0307407_100572912 369
547 3300031903 Ga0307407_10057996 Ga0307407_100579962 369
548 3300031903 Ga0307407_10094190 Ga0307407_100941902 369
549 3300031911 Ga0307412_10020065 Ga0307412_100200652 369
550 3300031911 Ga0307412_10027125 Ga0307412_100271253 369
551 3300031911 Ga0307412_10078647 Ga0307412_100786472 369
552 3300031911 Ga0307412_10091642 Ga0307412_100916422 369
553 3300031911 Ga0307412_10095834 Ga0307412_100958342 369
554 3300031911 Ga0307412_10192740 Ga0307412_101927401 369
555 3300031995 Ga0307409_100000202 Ga0307409_10000020214 369
556 3300031995 Ga0307409_100016125 Ga0307409_1000161255 369
557 3300031995 Ga0307409_100019725 Ga0307409_1000197252 369
558 3300031995 Ga0307409_100028392 Ga0307409_1000283922 369
559 3300032002 Ga0307416_100004513 Ga0307416_1000045136 369
560 3300032002 Ga0307416_100004568 Ga0307416_1000045683 369
561 3300032002 Ga0307416_100008103 Ga0307416_1000081035 369
562 3300032002 Ga0307416_100012459 Ga0307416_1000124595 369
563 3300032002 Ga0307416_100141337 Ga0307416_1001413372 369
564 3300032004 Ga0307414_10000187 Ga0307414_1000018723 369
565 3300032004 Ga0307414_10032764 Ga0307414_100327642 369
566 3300032004 Ga0307414_10054596 Ga0307414_100545962 369
567 3300032005 Ga0307411_10010072 Ga0307411_100100722 369
568 3300032005 Ga0307411_10025703 Ga0307411_100257033 369
569 3300032005 Ga0307411_10149928 Ga0307411_101499282 369
570 3300032005 Ga0307411_10151253 Ga0307411_101512532 369
571 3300032126 Ga0307415_100091304 Ga0307415_1000913042 369
572 3300032126 Ga0307415_100153009 Ga0307415_1001530092 369
573 3300032126 Ga0307415_100167392 Ga0307415_1001673922 369
574 3300032126 Ga0307415_100284513 Ga0307415_1002845131 369
575 3300032139 Ga0316580_10003585 Ga0316580_100035852 369
576 3300035083 Ga0373926_0009750 Ga0373926_0009750_1504_2631 369
577 3300035117 Ga0373953_0007522 Ga0373953_0007522_822_1949 369
578 3300035118 Ga0373954_0022354 Ga0373954_0022354_318_1445 369
579 3300035119 Ga0373956_0037041 Ga0373956_0037041_725_1852 369
580 3300035724 Ga0373933_0005010 Ga0373933_0005010_5939_7066 369
581 3300036401 Ga0373937_0008999 Ga0373937_0008999_7362_8489 369
582 3300036712 Ga0316584_0004516 Ga0316584_0004516_5246_6364 369
583 3300037068 Ga0373925_0282298 Ga0373925_0282298_208_1326 369
584 3300037471 Ga0395905_0046822 Ga0395905_0046822_2102_3283 369
585 3300037853 Ga0436364_0530951 Ga0436364_0530951_175827_176945 369
586 3300037853 Ga0436364_0558108 Ga0436364_0558108_30923_32050 369
587 3300037853 Ga0436364_0927813 Ga0436364_0927813_300_1427 369
588 3300037853 Ga0436364_1325276 Ga0436364_1325276_20748_21875 369
589 3300037853 Ga0436364_1390920 Ga0436364_1390920_56730_57872 369
590 3300039437 Ga0436365_0190860 Ga0436365_0190860_9566_10684 369
591 3300039437 Ga0436365_0813146 Ga0436365_0813146_51_1178 369
592 3300039437 Ga0436365_1528146 Ga0436365_1528146_157_1284 369
593 3300039438 Ga0436360_0034025 Ga0436360_0034025_1044_2162 369
594 3300039438 Ga0436360_0129245 Ga0436360_0129245_442_1569 369
595 3300039438 Ga0436360_0247545 Ga0436360_0247545_4459_5577 369
596 3300039447 Ga0436361_0523980 Ga0436361_0523980_3094_4212 369
597 3300039447 Ga0436361_0765221 Ga0436361_0765221_7787_8905 369
598 3300039447 Ga0436361_0941399 Ga0436361_0941399_51_1181 369
599 3300039450 Ga0436363_0834601 Ga0436363_0834601_2326_3453 369
600 3300039453 Ga0436362_0429742 Ga0436362_0429742_231_1358 369
601 3300039453 Ga0436362_0649416 Ga0436362_0649416_166471_167589 369
602 3300042004 Ga0439445_0035105 Ga0439445_0035105_30_1157 369
603 3300042876 Ga0451577_0301872 Ga0451577_0301872_20_1138 369
604 3300044673 Ga0453683_0000194 Ga0453683_0000194_68285_69403 369
605 3300044673 Ga0453683_0000655 Ga0453683_0000655_23633_24757 369
606 3300044673 Ga0453683_0009023 Ga0453683_0009023_4344_5462 369
607 3300044693 Ga0466961_0099692 Ga0466961_0099692_61_1233 369
608 3300044712 Ga0453684_0001215 Ga0453684_0001215_45384_46505 369
609 3300044712 Ga0453684_0045814 Ga0453684_0045814_4368_5486 369
610 3300044712 Ga0453684_0124438 Ga0453684_0124438_156_1274 369
611 3300044719 Ga0466971_0000020 Ga0466971_0000020_12742_13860 369
612 3300044765 Ga0466970_0002918 Ga0466970_0002918_1706_2821 369
613 3300044842 Ga0466957_0080447 Ga0466957_0080447_287_1405 369
614 3300045051 Ga0451576_0000135 Ga0451576_0000135_22221_23339 369
615 3300045051 Ga0451576_0005678 Ga0451576_0005678_8305_9423 369
616 3300046472 Ga0495580_0044422 Ga0495580_0044422_1673_2800 369
617 3300046512 Ga0495610_0000741 Ga0495610_0000741_14236_15351 369
618 3300046515 Ga0495620_0026522 Ga0495620_0026522_1030_2145 369
619 3300046519 Ga0495632_0019430 Ga0495632_0019430_318_1433 369
620 3300046660 Ga0495625_0012365 Ga0495625_0012365_1103_2218 369
621 3300047472 Ga0495686_0011196 Ga0495686_0011196_5070_6185 369
622 3300048905 Ga0496102_0153433 Ga0496102_0153433_75_1193 369
623 3300048907 Ga0496104_0014966 Ga0496104_0014966_3744_4871 369
624 3300048911 Ga0496108_0308875 Ga0496108_0308875_166_1284 369
625 3300048912 Ga0496109_0109004 Ga0496109_0109004_1045_2163 369
626 3300048915 Ga0496112_0038502 Ga0496112_0038502_2231_3349 369
627 3300048915 Ga0496112_0284605 Ga0496112_0284605_295_1413 369
628 3300048916 Ga0496113_0017282 Ga0496113_0017282_3700_4827 369
629 3300049568 Ga0501031_0039359 Ga0501031_0039359_1325_2440 369
630 3300049571 Ga0501034_0142646 Ga0501034_0142646_1089_2204 369
631 3300049571 Ga0501034_0239515 Ga0501034_0239515_458_1573 369
632 3300049572 Ga0501036_0030940 Ga0501036_0030940_1406_2542 369
633 3300049573 Ga0501037_0000240 Ga0501037_0000240_25964_27082 369
634 3300049574 Ga0501038_0036575 Ga0501038_0036575_3136_4251 369
635 3300049575 Ga0501039_0049676 Ga0501039_0049676_1315_2430 369
636 3300049576 Ga0501040_0069168 Ga0501040_0069168_58_1173 369
637 3300049577 Ga0501041_0003044 Ga0501041_0003044_618_1733 369
638 3300049578 Ga0501042_0005151 Ga0501042_0005151_5378_6514 369
639 3300049579 Ga0501043_0049989 Ga0501043_0049989_1647_2762 369
640 3300049580 Ga0501046_0087707 Ga0501046_0087707_274_1389 369
641 3300049581 Ga0501047_0235683 Ga0501047_0235683_475_1587 369
642 3300049582 Ga0501048_0034730 Ga0501048_0034730_1216_2331 369
643 3300049582 Ga0501048_0039381 Ga0501048_0039381_74_1210 369
644 3300049583 Ga0501067_0064111 Ga0501067_0064111_662_1780 369
645 3300049585 Ga0501069_0081649 Ga0501069_0081649_347_1456 369
646 3300049587 Ga0501071_0014009 Ga0501071_0014009_635_1750 369
647 3300049587 Ga0501071_0103433 Ga0501071_0103433_193_1302 369
648 3300049588 Ga0501072_0026890 Ga0501072_0026890_2124_3239 369
649 3300049588 Ga0501072_0183338 Ga0501072_0183338_144_1280 369
650 3300049589 Ga0501073_0135221 Ga0501073_0135221_97_1233 369
651 3300049589 Ga0501073_0228257 Ga0501073_0228257_94_1209 369
652 3300049590 Ga0501074_0051307 Ga0501074_0051307_27_1142 369
653 3300049591 Ga0501075_0029266 Ga0501075_0029266_1441_2739 369
654 3300049591 Ga0501075_0058535 Ga0501075_0058535_261_1376 369
655 3300049592 Ga0501076_0005738 Ga0501076_0005738_5164_6300 369
656 3300049592 Ga0501076_0011665 Ga0501076_0011665_1350_2465 369
657 3300049592 Ga0501076_0013165 Ga0501076_0013165_3588_4697 369
658 3300049593 Ga0501077_0000046 Ga0501077_0000046_51175_52473 369
659 3300049593 Ga0501077_0049491 Ga0501077_0049491_128_1237 369
660 3300049679 Ga0501249_024946 Ga0501249_024946_106_1224 369
661 3300049742 Ga0501080_0004063 Ga0501080_0004063_6539_7837 369
662 3300049742 Ga0501080_0047224 Ga0501080_0047224_2643_3758 369
663 3300049742 Ga0501080_0081093 Ga0501080_0081093_1764_2900 369
664 3300049742 Ga0501080_0258375 Ga0501080_0258375_284_1402 369
665 3300049822 Ga0501035_0057940 Ga0501035_0057940_594_1709 369
666 3300049822 Ga0501035_0318909 Ga0501035_0318909_142_1278 369
667 3300049823 Ga0501044_0000957 Ga0501044_0000957_25671_26789 369
668 3300049823 Ga0501044_0249872 Ga0501044_0249872_132_1253 369
669 3300049824 Ga0501045_0201832 Ga0501045_0201832_220_1335 369
670 3300050494 nmdc:mga06z11_74688_c1 nmdc:mga06z11_74688_c1_106_1224 369
671 3300050512 nmdc:mga0n895_2275_c1 nmdc:mga0n895_2275_c1_8086_9204 369
672 3300050513 nmdc:mga0rr50_29956_c1 nmdc:mga0rr50_29956_c1_2060_3187 369
673 3300050514 nmdc:mga08x19_20979_c1 nmdc:mga08x19_20979_c1_275_1402 369
674 3300050515 nmdc:mga0a205_6325_c1 nmdc:mga0a205_6325_c1_7414_8532 369
675 3300053083 Ga0495655_0031599 Ga0495655_0031599_42_1172 369
676 3300053160 Ga0500633_0000311 Ga0500633_0000311_5572_6687 369
677 3300054114 Ga0501084_0085793 Ga0501084_0085793_534_1643 369
678 3300059421 Ga0590071_000585 Ga0590071_000585_9001_10110 369
679 3300059421 Ga0590071_000919 Ga0590071_000919_1209_2327 369
680 3300059421 Ga0590071_000953 Ga0590071_000953_2567_3676 369
681 3300059421 Ga0590071_017868 Ga0590071_017868_128_1246 369
682 3300059421 Ga0590071_019247 Ga0590071_019247_428_1537 369
683 3300059421 Ga0590071_025947 Ga0590071_025947_132_1241 369
684 3300059423 Ga0590074_001496 Ga0590074_001496_1142_2251 369
685 3300059423 Ga0590074_002612 Ga0590074_002612_338_1447 369
686 3300059423 Ga0590074_007523 Ga0590074_007523_328_1446 369
687 3300059424 Ga0590075_001890 Ga0590075_001890_3814_4923 369
688 3300059426 Ga0590077_000022 Ga0590077_000022_3264_4373 369
689 3300059426 Ga0590077_000232 Ga0590077_000232_13690_14799 369
690 3300060353 Ga0501082_0000072 Ga0501082_0000072_57545_58843 369
691 3300060353 Ga0501082_0232812 Ga0501082_0232812_434_1549 369
692 3300061719 Ga0466962_0000017 Ga0466962_0000017_73699_74817 369
693 3300061734 Ga0530510_0113535 Ga0530510_0113535_46_1161 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

65

212

0.93

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

218

340

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

66

194

0.9

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

65

186

0.86

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

66

214

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

223

405

0.8

PF08659

KR

KR domain

63

191

0.8

PF05368

NmrA

NmrA-like family

65

156

0.8

PF07993

NAD_binding_4

Male sterility protein

67

322

0.79

PF13460

NAD_binding_10

NAD(P)H-binding

69

219

0.79

PF00106

adh_short

short chain dehydrogenase

64

190

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.9205 1 345
6kvc-assembly1.cif.gz_A-2 moee5 in complex with udp-glucose and nad 0.9146 1 345
6dnt-assembly1.cif.gz_A-2 udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid 0.911 2 345
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9103 1 345
6kv9-assembly1.cif.gz_A-2 moee5 in complex with udp-glucuronic acid and nad 0.9057 1 345
ID Description Score Start End Superfamily
af_L7N670_2_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.933 3 342 3.40.50.720
af_L7N670_2_342_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9251 3 342 3.40.50.720
4zrnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9103 1 277 3.40.50.720
af_P72050_1_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9079 1 350 3.40.50.720
af_A0A0R0KMW5_231_418_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9061 175 355 3.40.50.720
ID Description Score Start End GO Terms
AF-S4Y9C3-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9933 2 367
AF-A0A250KYI1-F1-model_v4 UDP-galactose 4-epimerase 0.9899 2 367
AF-S4Y9C3-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9879 2 367
AF-A0A537M5A6-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9868 184 367
AF-A0A538M237-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9864 2 367

Feature Viewer

pLDDT pTM Quality
94.8 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map