F475634

General Info

Members Datasets Scaffolds Average Seq Length
693 230 1386 235

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100000965|Ga0070707_10000096513
Length 274
Sequence MAKMRRVDNNDDETVWVTYADQRDREIRVNQRNTFGKGADMNSSNGKVKLSEKGLLTPDNCVVALIDHQPQMLFGVSNFDRQTIINNTVALAKATQVFDVPVVLTTVETKSFSGNIWPQIKAVFPNQETIERTSMNSWDDKNFVAAIERTGRKKIVLAGLWTEVCIAFPTVQAIQDGYEIYVVEDACGDVSQLNHDNAMKRVIQAGAKPVTVLSTMLEWQRDWAHKDTYDAVMDIVKTHMGAYGIGVEYAYTMVHGLPASKFAEYEVPSLLGAH

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
229 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.14
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0.14
Rhizoplane 2.74
Rhizosphere 96.25
Stem 0
Stem Tuber 0
Unclassified 3.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100000965 3300005468 Bacteria 28472
2 CNAas_1000191 3300000532 Bacteria 5622
3 LJNas_1002803 3300000546 Bacteria 2060
4 rootH2_10164078 3300003320 Bacteria 2405
5 Ga0065704_10027056 3300005289 Bacteria 1023
6 Ga0065715_10295477 3300005293 Bacteria 1053
7 Ga0065707_10092649 3300005295 Bacteria 3739
8 Ga0065707_10282111 3300005295 Bacteria 1045
9 Ga0070658_10031590 3300005327 Bacteria 4253
10 Ga0070676_10002601 3300005328 Bacteria 9288
11 Ga0070683_100017958 3300005329 Bacteria 6254
12 Ga0070670_100012430 3300005331 Bacteria 7286
13 Ga0070670_100672747 3300005331 Bacteria 930
14 Ga0068869_100002037 3300005334 Bacteria 12144
15 Ga0068869_100137613 3300005334 Bacteria 1883
16 Ga0070666_10001174 3300005335 Bacteria 15897
17 Ga0068868_100000426 3300005338 Bacteria 28337
18 Ga0068868_100018889 3300005338 Bacteria 5158
19 Ga0068868_100050812 3300005338 Bacteria 3257
20 Ga0068868_100582155 3300005338 Bacteria 990
21 Ga0068868_100679873 3300005338 Bacteria 919
22 Ga0070660_100319327 3300005339 Bacteria 1276
23 Ga0070661_100016857 3300005344 Bacteria 5171
24 Ga0070668_100007922 3300005347 Bacteria 7888
25 Ga0070668_100118264 3300005347 Bacteria 2115
26 Ga0070669_100182398 3300005353 Bacteria 1643
27 Ga0070669_100317733 3300005353 Bacteria 1257
28 Ga0070675_100000979 3300005354 Bacteria 20429
29 Ga0070675_100010950 3300005354 Bacteria 7097
30 Ga0070675_100019857 3300005354 Bacteria 5360
31 Ga0070671_100000640 3300005355 Bacteria 25051
32 Ga0070671_100025640 3300005355 Bacteria 4839
33 Ga0070674_100159349 3300005356 Bacteria 1711
34 Ga0070673_100307889 3300005364 Bacteria 1396
35 Ga0070673_100550300 3300005364 Bacteria 1048
36 Ga0070688_100189987 3300005365 Bacteria 1430
37 Ga0070688_100293109 3300005365 Bacteria 1173
38 Ga0070659_100197447 3300005366 Bacteria 1655
39 Ga0070667_100006619 3300005367 Bacteria 9631
40 Ga0070667_100017052 3300005367 Bacteria 6015
41 Ga0070667_100058621 3300005367 Bacteria 3255
42 Ga0070703_10160314 3300005406 Bacteria 853
43 Ga0070709_10323130 3300005434 Unclassified 1133
44 Ga0070709_10462046 3300005434 Bacteria 958
45 Ga0070713_100211783 3300005436 Bacteria 1755
46 Ga0070713_100399394 3300005436 Bacteria 1283
47 Ga0070713_100496939 3300005436 Bacteria 1151
48 Ga0070710_10150989 3300005437 Bacteria 1433
49 Ga0070710_10198449 3300005437 Bacteria 1265
50 Ga0070710_10226994 3300005437 Bacteria 1191
51 Ga0070711_100010796 3300005439 Bacteria 5664
52 Ga0070711_100035825 3300005439 Bacteria 3321
53 Ga0070711_100062749 3300005439 Bacteria 2591
54 Ga0070711_100110905 3300005439 Bacteria 2014
55 Ga0070711_100181893 3300005439 Bacteria 1610
56 Ga0070711_100351894 3300005439 Unclassified 1185
57 Ga0070711_100418223 3300005439 Bacteria 1092
58 Ga0070711_100448113 3300005439 Bacteria 1056
59 Ga0070705_100073239 3300005440 Bacteria 2078
60 Ga0070705_100531002 3300005440 Bacteria 898
61 Ga0070700_100015287 3300005441 Bacteria 4349
62 Ga0070694_100034789 3300005444 Bacteria 3325
63 Ga0070694_100068397 3300005444 Bacteria 2441
64 Ga0070694_100220865 3300005444 Bacteria 1421
65 Ga0070708_100000687 3300005445 Bacteria 25740
66 Ga0070708_100066222 3300005445 Bacteria 3242
67 Ga0070708_100141362 3300005445 Bacteria 2232
68 Ga0070708_100162199 3300005445 Bacteria 2083
69 Ga0070708_100238110 3300005445 Bacteria 1709
70 Ga0070708_100239987 3300005445 Bacteria 1701
71 Ga0070708_100336062 3300005445 Bacteria 1423
72 Ga0070708_100347125 3300005445 Bacteria 1398
73 Ga0070708_100355876 3300005445 Bacteria 1380
74 Ga0070708_100390954 3300005445 Bacteria 1311
75 Ga0070708_100966679 3300005445 Bacteria 799
76 Ga0070678_100001335 3300005456 Bacteria 13117
77 Ga0070678_100008008 3300005456 Bacteria 6299
78 Ga0070678_100030309 3300005456 Bacteria 3717
79 Ga0070662_100001162 3300005457 Bacteria 16146
80 Ga0070662_100089231 3300005457 Bacteria 2312
81 Ga0070662_100127108 3300005457 Bacteria 1961
82 Ga0070662_100198218 3300005457 Bacteria 1592
83 Ga0068867_100019700 3300005459 Bacteria 4806
84 Ga0068867_100029168 3300005459 Bacteria 3975
85 Ga0070706_100000252 3300005467 Bacteria 65194
86 Ga0070706_100001508 3300005467 Bacteria 24433
87 Ga0070706_100078026 3300005467 Bacteria 3066
88 Ga0070706_100129402 3300005467 Bacteria 2355
89 Ga0070706_100156973 3300005467 Bacteria 2123
90 Ga0070706_100189941 3300005467 Bacteria 1919
91 Ga0070706_100195531 3300005467 Bacteria 1889
92 Ga0070706_100210357 3300005467 Bacteria 1816
93 Ga0070706_100235983 3300005467 Bacteria 1707
94 Ga0070706_100326715 3300005467 Bacteria 1430
95 Ga0070706_100380589 3300005467 Bacteria 1314
96 Ga0070706_100590082 3300005467 Bacteria 1033
97 Ga0070706_100964469 3300005467 Unclassified 787
98 Ga0070707_100000274 3300005468 Bacteria 50831
99 Ga0070707_100012231 3300005468 Bacteria 8012
100 Ga0070707_100033905 3300005468 Bacteria 4869
101 Ga0070707_100046939 3300005468 Bacteria 4134
102 Ga0070707_100098691 3300005468 Bacteria 2829
103 Ga0070707_100120187 3300005468 Bacteria 2550
104 Ga0070707_100122546 3300005468 Bacteria 2524
105 Ga0070707_100142109 3300005468 Bacteria 2336
106 Ga0070707_100145210 3300005468 Bacteria 2309
107 Ga0070707_100173287 3300005468 Bacteria 2103
108 Ga0070707_100342407 3300005468 Bacteria 1452
109 Ga0070707_100365621 3300005468 Bacteria 1401
110 Ga0070707_100386288 3300005468 Unclassified 1360
111 Ga0070707_100638242 3300005468 Bacteria 1027
112 Ga0070707_100925526 3300005468 Bacteria 836
113 Ga0070698_100040743 3300005471 Bacteria 4772
114 Ga0070698_100181217 3300005471 Unclassified 2045
115 Ga0070698_100254471 3300005471 Bacteria 1689
116 Ga0070698_100290698 3300005471 Bacteria 1565
117 Ga0070698_100312767 3300005471 Bacteria 1501
118 Ga0070698_100378160 3300005471 Bacteria 1349
119 Ga0070698_100381798 3300005471 Bacteria 1341
120 Ga0070698_100425477 3300005471 Bacteria 1262
121 Ga0070698_100459018 3300005471 Unclassified 1210
122 Ga0070699_100029980 3300005518 Bacteria 4693
123 Ga0070699_100048432 3300005518 Bacteria 3678
124 Ga0070699_100158247 3300005518 Bacteria 2004
125 Ga0070699_100163411 3300005518 Bacteria 1971
126 Ga0070699_100173484 3300005518 Bacteria 1911
127 Ga0070699_100222627 3300005518 Bacteria 1682
128 Ga0070699_100288266 3300005518 Bacteria 1471
129 Ga0070699_100290686 3300005518 Bacteria 1465
130 Ga0070699_100328321 3300005518 Bacteria 1375
131 Ga0070699_100518487 3300005518 Bacteria 1083
132 Ga0070699_100728467 3300005518 Bacteria 906
133 Ga0070699_100815576 3300005518 Bacteria 854
134 Ga0070697_100010465 3300005536 Bacteria 7241
135 Ga0070697_100016380 3300005536 Bacteria 5828
136 Ga0070697_100155051 3300005536 Bacteria 1933
137 Ga0070697_100161749 3300005536 Bacteria 1891
138 Ga0070697_100211699 3300005536 Bacteria 1650
139 Ga0070697_100263204 3300005536 Viruses 1477
140 Ga0070697_100313317 3300005536 Unclassified 1350
141 Ga0070697_100358981 3300005536 Bacteria 1259
142 Ga0070697_100368578 3300005536 Bacteria 1242
143 Ga0070697_100380974 3300005536 Bacteria 1222
144 Ga0070697_100577685 3300005536 Bacteria 987
145 Ga0070697_100679772 3300005536 Bacteria 907
146 Ga0068853_100512753 3300005539 Bacteria 1133
147 Ga0070672_100000768 3300005543 Bacteria 19088
148 Ga0070672_100024925 3300005543 Bacteria 4428
149 Ga0070686_100044658 3300005544 Bacteria 2787
150 Ga0070686_100464907 3300005544 Bacteria 975
151 Ga0070695_100071168 3300005545 Bacteria 2277
152 Ga0070695_100113544 3300005545 Bacteria 1842
153 Ga0070695_100185870 3300005545 Bacteria 1476
154 Ga0070695_100564910 3300005545 Bacteria 889
155 Ga0070696_100333635 3300005546 Bacteria 1170
156 Ga0070696_100629562 3300005546 Bacteria 868
157 Ga0070696_100660693 3300005546 Bacteria 848
158 Ga0070665_100008044 3300005548 Bacteria 10678
159 Ga0070665_100383259 3300005548 Bacteria 1413
160 Ga0070704_100019410 3300005549 Bacteria 4367
161 Ga0070704_100039372 3300005549 Bacteria 3245
162 Ga0070704_100496328 3300005549 Bacteria 1058
163 Ga0068855_100302924 3300005563 Bacteria 1770
164 Ga0068855_100411749 3300005563 Bacteria 1480
165 Ga0070664_100009748 3300005564 Bacteria 7784
166 Ga0068854_100116803 3300005578 Bacteria 2020
167 Ga0068856_100335181 3300005614 Bacteria 1531
168 Ga0068856_100573778 3300005614 Bacteria 1149
169 Ga0068856_100680079 3300005614 Bacteria 1050
170 Ga0070702_100039357 3300005615 Bacteria 2638
171 Ga0070702_100495943 3300005615 Bacteria 896
172 Ga0068852_100001076 3300005616 Bacteria 18047
173 Ga0068852_100043907 3300005616 Bacteria 3793
174 Ga0068852_100595676 3300005616 Bacteria 1109
175 Ga0068859_100347513 3300005617 Bacteria 1578
176 Ga0068859_100427786 3300005617 Bacteria 1420
177 Ga0068859_100466816 3300005617 Bacteria 1358
178 Ga0068859_100767151 3300005617 Bacteria 1053
179 Ga0068864_100023561 3300005618 Bacteria 5171
180 Ga0068864_100114952 3300005618 Bacteria 2400
181 Ga0068864_100318394 3300005618 Bacteria 1460
182 Ga0068866_10002255 3300005718 Bacteria 7995
183 Ga0068866_10471842 3300005718 Bacteria 825
184 Ga0068861_100786045 3300005719 Unclassified 892
185 Ga0068870_10098287 3300005840 Bacteria 1649
186 Ga0068863_100003974 3300005841 Bacteria 14598
187 Ga0068863_100030587 3300005841 Bacteria 5141
188 Ga0068863_100079947 3300005841 Bacteria 3096
189 Ga0068863_100098513 3300005841 Bacteria 2777
190 Ga0068863_100150542 3300005841 Bacteria 2226
191 Ga0068863_100177695 3300005841 Bacteria 2043
192 Ga0068863_101213686 3300005841 Bacteria 760
193 Ga0068858_100015698 3300005842 Bacteria 7125
194 Ga0068858_100463527 3300005842 Bacteria 1222
195 Ga0068858_100480210 3300005842 Bacteria 1199
196 Ga0068860_100161006 3300005843 Bacteria 2164
197 Ga0068860_100284265 3300005843 Bacteria 1617
198 Ga0068860_100408727 3300005843 Bacteria 1344
199 Ga0081540_1128956 3300005983 Bacteria 1036
200 Ga0070717_10035143 3300006028 Bacteria 4054
201 Ga0070717_10157335 3300006028 Bacteria 1969
202 Ga0070717_10210878 3300006028 Bacteria 1704
203 Ga0070717_10260783 3300006028 Bacteria 1533
204 Ga0070717_10540873 3300006028 Bacteria 1054
205 Ga0070717_10927214 3300006028 Unclassified 793
206 Ga0075432_10129629 3300006058 Bacteria 954
207 Ga0075432_10135469 3300006058 Bacteria 936
208 Ga0070715_10002908 3300006163 Bacteria 5343
209 Ga0070715_10049072 3300006163 Bacteria 1807
210 Ga0070715_10112001 3300006163 Bacteria 1289
211 Ga0070715_10243940 3300006163 Bacteria 936
212 Ga0070715_10326768 3300006163 Bacteria 830
213 Ga0070716_100000727 3300006173 Bacteria 14036
214 Ga0070716_100077850 3300006173 Bacteria 1969
215 Ga0070716_100216993 3300006173 Bacteria 1282
216 Ga0070716_100282082 3300006173 Unclassified 1147
217 Ga0070712_100001116 3300006175 Bacteria 16167
218 Ga0070712_100063005 3300006175 Bacteria 2624
219 Ga0070712_100068546 3300006175 Bacteria 2528
220 Ga0070712_100079414 3300006175 Bacteria 2371
221 Ga0070712_100430873 3300006175 Bacteria 1095
222 Ga0097621_100004944 3300006237 Bacteria 9345
223 Ga0097621_100007089 3300006237 Bacteria 7991
224 Ga0068871_100007911 3300006358 Bacteria 7622
225 Ga0068871_100037366 3300006358 Bacteria 3872
226 Ga0068871_100343998 3300006358 Bacteria 1317
227 Ga0068871_100508659 3300006358 Bacteria 1086
228 Ga0075428_100026624 3300006844 Bacteria 6403
229 Ga0075428_100145153 3300006844 Bacteria 2579
230 Ga0075428_100328633 3300006844 Bacteria 1642
231 Ga0075428_100491018 3300006844 Unclassified 1314
232 Ga0075428_100657616 3300006844 Unclassified 1117
233 Ga0075430_100076096 3300006846 Bacteria 2813
234 Ga0075430_100080996 3300006846 Bacteria 2720
235 Ga0075430_100392197 3300006846 Bacteria 1146
236 Ga0075431_100000738 3300006847 Bacteria 28232
237 Ga0075431_100023088 3300006847 Bacteria 6360
238 Ga0075431_100051410 3300006847 Bacteria 4249
239 Ga0075431_100144483 3300006847 Bacteria 2451
240 Ga0075431_100165426 3300006847 Bacteria 2274
241 Ga0075433_10001290 3300006852 Bacteria 18330
242 Ga0075433_10001310 3300006852 Bacteria 18243
243 Ga0075433_10006871 3300006852 Bacteria 9017
244 Ga0075433_10016768 3300006852 Bacteria 6048
245 Ga0075433_10051117 3300006852 Bacteria 3598
246 Ga0075433_10113306 3300006852 Bacteria 2406
247 Ga0075433_10163137 3300006852 Unclassified 1983
248 Ga0075433_10172380 3300006852 Bacteria 1925
249 Ga0075433_10301223 3300006852 Bacteria 1420
250 Ga0075433_10316649 3300006852 Bacteria 1381
251 Ga0075433_10379803 3300006852 Bacteria 1247
252 Ga0075433_10481195 3300006852 Bacteria 1094
253 Ga0075433_10632529 3300006852 Bacteria 939
254 Ga0075434_100000715 3300006871 Bacteria 25962
255 Ga0075434_100001017 3300006871 Bacteria 22825
256 Ga0075434_100023492 3300006871 Bacteria 6010
257 Ga0075434_100098671 3300006871 Bacteria 2926
258 Ga0075434_100107176 3300006871 Bacteria 2804
259 Ga0075434_100171043 3300006871 Bacteria 2193
260 Ga0075434_100392426 3300006871 Bacteria 1409
261 Ga0075434_100405936 3300006871 Bacteria 1383
262 Ga0075434_100419461 3300006871 Bacteria 1359
263 Ga0075434_100579266 3300006871 Bacteria 1141
264 Ga0075429_100044188 3300006880 Bacteria 3876
265 Ga0075429_100050184 3300006880 Bacteria 3630
266 Ga0075429_100139463 3300006880 Bacteria 2122
267 Ga0075429_100574504 3300006880 Bacteria 988
268 Ga0068865_100026795 3300006881 Bacteria 3803
269 Ga0068865_100030530 3300006881 Bacteria 3586
270 Ga0068865_100118438 3300006881 Bacteria 1965
271 Ga0075436_100055237 3300006914 Bacteria 2742
272 Ga0075436_100057452 3300006914 Bacteria 2687
273 Ga0075436_100388585 3300006914 Bacteria 1010
274 Ga0075436_100406819 3300006914 Bacteria 986
275 Ga0075436_100572532 3300006914 Bacteria 830
276 Ga0097620_100347463 3300006931 Bacteria 1578
277 Ga0097620_100427761 3300006931 Bacteria 1420
278 Ga0097620_100466820 3300006931 Bacteria 1358
279 Ga0097620_100767055 3300006931 Bacteria 1053
280 Ga0075435_100002644 3300007076 Bacteria 11937
281 Ga0075435_100028594 3300007076 Bacteria 4373
282 Ga0075435_100068738 3300007076 Bacteria 2886
283 Ga0075435_100082431 3300007076 Bacteria 2644
284 Ga0075435_100145396 3300007076 Unclassified 1991
285 Ga0075435_100257594 3300007076 Bacteria 1486
286 Ga0075435_100300635 3300007076 Bacteria 1372
287 Ga0075435_100667785 3300007076 Bacteria 902
288 Ga0099794_10022050 3300007265 Bacteria 2900
289 Ga0099794_10060537 3300007265 Bacteria 1839
290 Ga0099794_10094806 3300007265 Bacteria 1484
291 Ga0099794_10105391 3300007265 Bacteria 1410
292 Ga0099794_10129518 3300007265 Bacteria 1273
293 Ga0099794_10171379 3300007265 Bacteria 1106
294 Ga0099794_10275868 3300007265 Bacteria 869
295 Ga0099795_10003507 3300007788 Bacteria 3893
296 Ga0099795_10050413 3300007788 Bacteria 1514
297 Ga0099795_10107176 3300007788 Bacteria 1103
298 Ga0099795_10110312 3300007788 Bacteria 1090
299 Ga0105250_10077109 3300009092 Bacteria 1349
300 Ga0105250_10169968 3300009092 Bacteria 912
301 Ga0111539_10027702 3300009094 Bacteria 6922
302 Ga0111539_10115622 3300009094 Bacteria 3146
303 Ga0111539_10120126 3300009094 Bacteria 3079
304 Ga0111539_10152617 3300009094 Bacteria 2703
305 Ga0111539_10188947 3300009094 Bacteria 2404
306 Ga0111539_10255820 3300009094 Bacteria 2039
307 Ga0111539_10888091 3300009094 Bacteria 1037
308 Ga0111539_11001043 3300009094 Bacteria 972
309 Ga0105245_10002126 3300009098 Bacteria 17944
310 Ga0105245_10232896 3300009098 Bacteria 1782
311 Ga0105247_10503780 3300009101 Bacteria 883
312 Ga0114129_10047270 3300009147 Bacteria 6048
313 Ga0114129_10134928 3300009147 Bacteria 3387
314 Ga0114129_10230826 3300009147 Unclassified 2492
315 Ga0114129_10240111 3300009147 Bacteria 2436
316 Ga0114129_10314739 3300009147 Bacteria 2083
317 Ga0114129_10316984 3300009147 Bacteria 2074
318 Ga0114129_10360565 3300009147 Bacteria 1923
319 Ga0114129_10442386 3300009147 Bacteria 1706
320 Ga0105243_10013230 3300009148 Bacteria 6239
321 Ga0105243_10152553 3300009148 Bacteria 1983
322 Ga0105241_10005774 3300009174 Bacteria 9135
323 Ga0105241_10474230 3300009174 Bacteria 1111
324 Ga0105242_10129424 3300009176 Bacteria 2177
325 Ga0105242_10293179 3300009176 Bacteria 1482
326 Ga0105242_10364246 3300009176 Bacteria 1339
327 Ga0105242_10842739 3300009176 Bacteria 911
328 Ga0105248_10065847 3300009177 Bacteria 4068
329 Ga0105248_10077767 3300009177 Bacteria 3730
330 Ga0105248_10109505 3300009177 Bacteria 3114
331 Ga0105248_10175242 3300009177 Bacteria 2417
332 Ga0105237_10710225 3300009545 Bacteria 1012
333 Ga0105249_10076087 3300009553 Bacteria 3110
334 Ga0105249_10187300 3300009553 Bacteria 2017
335 Ga0105249_10280588 3300009553 Bacteria 1663
336 Ga0105249_11022945 3300009553 Bacteria 895
337 Ga0099796_10009222 3300010159 Bacteria 2662
338 Ga0099796_10012618 3300010159 Bacteria 2391
339 Ga0099796_10020229 3300010159 Bacteria 2031
340 Ga0099796_10028263 3300010159 Bacteria 1799
341 Ga0099796_10071234 3300010159 Bacteria 1255
342 Ga0099796_10086174 3300010159 Bacteria 1160
343 Ga0105239_10142017 3300010375 Bacteria 2676
344 Ga0105239_10229310 3300010375 Bacteria 2084
345 Ga0105239_10512422 3300010375 Bacteria 1364
346 Ga0105246_10047801 3300011119 Bacteria 2924
347 Ga0105246_10434741 3300011119 Bacteria 1099
348 Ga0157373_10083463 3300013100 Bacteria 2252
349 Ga0157373_10137009 3300013100 Bacteria 1721
350 Ga0157373_10165231 3300013100 Bacteria 1558
351 Ga0157373_10229017 3300013100 Bacteria 1312
352 Ga0157371_10074373 3300013102 Bacteria 2406
353 Ga0157371_10556678 3300013102 Bacteria 850
354 Ga0157374_10010123 3300013296 Bacteria 8100
355 Ga0157374_10019937 3300013296 Bacteria 5944
356 Ga0157374_10324020 3300013296 Bacteria 1527
357 Ga0157378_10057262 3300013297 Bacteria 3473
358 Ga0157378_10062907 3300013297 Bacteria 3315
359 Ga0157378_10251237 3300013297 Bacteria 1693
360 Ga0157378_10497726 3300013297 Bacteria 1217
361 Ga0157378_10655878 3300013297 Bacteria 1065
362 Ga0163162_10013765 3300013306 Bacteria 7900
363 Ga0163162_10017725 3300013306 Bacteria 6967
364 Ga0163162_10109455 3300013306 Bacteria 2860
365 Ga0163162_10642288 3300013306 Bacteria 1185
366 Ga0157372_10041766 3300013307 Bacteria 5070
367 Ga0157375_10013163 3300013308 Bacteria 7353
368 Ga0157375_10060931 3300013308 Bacteria 3745
369 Ga0157375_10085383 3300013308 Bacteria 3206
370 Ga0157375_10690198 3300013308 Bacteria 1175
371 Ga0163163_10012799 3300014325 Bacteria 7655
372 Ga0163163_10086939 3300014325 Bacteria 3136
373 Ga0163163_10196926 3300014325 Bacteria 2063
374 Ga0163163_10605757 3300014325 Bacteria 1159
375 Ga0163163_10811414 3300014325 Bacteria 999
376 Ga0157380_10018653 3300014326 Bacteria 5153
377 Ga0157377_10096529 3300014745 Bacteria 1754
378 Ga0157379_10003248 3300014968 Bacteria 13778
379 Ga0157379_10098630 3300014968 Bacteria 2623
380 Ga0157379_10427073 3300014968 Bacteria 1221
381 Ga0157379_10577242 3300014968 Bacteria 1048
382 Ga0157376_10003670 3300014969 Bacteria 10601
383 Ga0157376_10129474 3300014969 Bacteria 2250
384 Ga0157376_11181019 3300014969 Bacteria 793
385 Ga0163161_10032334 3300017792 Bacteria 3734
386 Ga0163161_10196028 3300017792 Bacteria 1555
387 Ga0213873_10017917 3300021358 Bacteria 1622
388 Ga0213872_10001134 3300021361 Bacteria 18213
389 Ga0213872_10003568 3300021361 Bacteria 8566
390 Ga0213872_10104688 3300021361 Bacteria 1260
391 Ga0213872_10173156 3300021361 Bacteria 935
392 Ga0224572_1036440 3300024225 Unclassified 932
393 Ga0228598_1004031 3300024227 Bacteria 3124
394 Ga0207692_10009529 3300025898 Bacteria 4060
395 Ga0207692_10416216 3300025898 Bacteria 841
396 Ga0207642_10003083 3300025899 Bacteria 5223
397 Ga0207642_10025103 3300025899 Bacteria 2405
398 Ga0207642_10063426 3300025899 Bacteria 1728
399 Ga0207688_10163895 3300025901 Unclassified 1319
400 Ga0207680_10020873 3300025903 Bacteria 3535
401 Ga0207680_10059199 3300025903 Bacteria 2325
402 Ga0207685_10007379 3300025905 Bacteria 3060
403 Ga0207685_10084900 3300025905 Bacteria 1319
404 Ga0207685_10103660 3300025905 Bacteria 1221
405 Ga0207699_10285971 3300025906 Bacteria 1147
406 Ga0207699_10424385 3300025906 Bacteria 950
407 Ga0207645_10001760 3300025907 Bacteria 17569
408 Ga0207645_10003733 3300025907 Bacteria 11450
409 Ga0207643_10029103 3300025908 Bacteria 3072
410 Ga0207684_10000267 3300025910 Bacteria 77172
411 Ga0207684_10000295 3300025910 Bacteria 71704
412 Ga0207684_10001438 3300025910 Bacteria 25754
413 Ga0207684_10009957 3300025910 Bacteria 8381
414 Ga0207684_10011716 3300025910 Bacteria 7649
415 Ga0207684_10011728 3300025910 Bacteria 7645
416 Ga0207684_10026774 3300025910 Bacteria 4916
417 Ga0207684_10052444 3300025910 Bacteria 3461
418 Ga0207684_10079878 3300025910 Bacteria 2782
419 Ga0207684_10084948 3300025910 Bacteria 2696
420 Ga0207684_10128027 3300025910 Bacteria 2179
421 Ga0207684_10167408 3300025910 Bacteria 1894
422 Ga0207684_10245901 3300025910 Bacteria 1543
423 Ga0207684_10266120 3300025910 Bacteria 1479
424 Ga0207684_10303607 3300025910 Bacteria 1376
425 Ga0207654_10237277 3300025911 Bacteria 1217
426 Ga0207654_10350681 3300025911 Bacteria 1016
427 Ga0207693_10024087 3300025915 Bacteria 4832
428 Ga0207693_10049710 3300025915 Bacteria 3293
429 Ga0207693_10055394 3300025915 Bacteria 3111
430 Ga0207693_10162251 3300025915 Bacteria 1758
431 Ga0207693_10162449 3300025915 Bacteria 1757
432 Ga0207693_10169378 3300025915 Bacteria 1720
433 Ga0207693_10719036 3300025915 Bacteria 773
434 Ga0207663_10046257 3300025916 Bacteria 2680
435 Ga0207663_10077307 3300025916 Bacteria 2166
436 Ga0207663_10081089 3300025916 Bacteria 2124
437 Ga0207663_10217867 3300025916 Bacteria 1387
438 Ga0207663_10402882 3300025916 Unclassified 1047
439 Ga0207660_10244172 3300025917 Bacteria 1415
440 Ga0207660_10287448 3300025917 Bacteria 1307
441 Ga0207662_10056804 3300025918 Bacteria 2338
442 Ga0207662_10113808 3300025918 Bacteria 1690
443 Ga0207657_10347084 3300025919 Bacteria 1171
444 Ga0207646_10000016 3300025922 Bacteria 337048
445 Ga0207646_10000643 3300025922 Bacteria 45481
446 Ga0207646_10001829 3300025922 Bacteria 25690
447 Ga0207646_10008411 3300025922 Bacteria 10347
448 Ga0207646_10011164 3300025922 Bacteria 8720
449 Ga0207646_10016416 3300025922 Bacteria 6947
450 Ga0207646_10086472 3300025922 Bacteria 2805
451 Ga0207646_10087882 3300025922 Bacteria 2781
452 Ga0207646_10098244 3300025922 Bacteria 2624
453 Ga0207646_10131848 3300025922 Bacteria 2250
454 Ga0207646_10139444 3300025922 Bacteria 2183
455 Ga0207646_10160238 3300025922 Bacteria 2030
456 Ga0207646_10171444 3300025922 Bacteria 1959
457 Ga0207646_10341776 3300025922 Bacteria 1352
458 Ga0207646_10742343 3300025922 Bacteria 876
459 Ga0207681_10064981 3300025923 Bacteria 2521
460 Ga0207681_10065971 3300025923 Bacteria 2504
461 Ga0207681_10323802 3300025923 Bacteria 1227
462 Ga0207681_10356361 3300025923 Bacteria 1172
463 Ga0207650_10017367 3300025925 Bacteria 5038
464 Ga0207650_10689563 3300025925 Bacteria 862
465 Ga0207659_10013585 3300025926 Bacteria 5221
466 Ga0207659_10017788 3300025926 Bacteria 4649
467 Ga0207687_10520779 3300025927 Bacteria 995
468 Ga0207700_10088305 3300025928 Bacteria 2441
469 Ga0207700_10112974 3300025928 Unclassified 2189
470 Ga0207700_10560120 3300025928 Bacteria 1015
471 Ga0207664_10205444 3300025929 Bacteria 1702
472 Ga0207644_10024343 3300025931 Bacteria 4155
473 Ga0207644_10224461 3300025931 Bacteria 1490
474 Ga0207706_10002020 3300025933 Bacteria 19875
475 Ga0207706_10006128 3300025933 Bacteria 11164
476 Ga0207706_10105270 3300025933 Bacteria 2482
477 Ga0207686_10019653 3300025934 Bacteria 3846
478 Ga0207686_10089983 3300025934 Bacteria 2024
479 Ga0207686_10106672 3300025934 Bacteria 1881
480 Ga0207686_10394373 3300025934 Bacteria 1053
481 Ga0207709_10007140 3300025935 Bacteria 6234
482 Ga0207709_10033490 3300025935 Bacteria 3017
483 Ga0207704_10025998 3300025938 Bacteria 3204
484 Ga0207704_10115777 3300025938 Bacteria 1823
485 Ga0207704_10175898 3300025938 Bacteria 1541
486 Ga0207665_10065035 3300025939 Bacteria 2479
487 Ga0207665_10097098 3300025939 Bacteria 2051
488 Ga0207665_10120122 3300025939 Bacteria 1856
489 Ga0207665_10123054 3300025939 Bacteria 1834
490 Ga0207665_10190537 3300025939 Bacteria 1489
491 Ga0207665_10489659 3300025939 Bacteria 949
492 Ga0207691_10004437 3300025940 Bacteria 13603
493 Ga0207691_10007630 3300025940 Bacteria 10411
494 Ga0207691_10466063 3300025940 Bacteria 1074
495 Ga0207711_10101794 3300025941 Bacteria 2542
496 Ga0207711_10137586 3300025941 Bacteria 2195
497 Ga0207711_10140202 3300025941 Bacteria 2175
498 Ga0207711_10480271 3300025941 Bacteria 1158
499 Ga0207689_10002864 3300025942 Bacteria 15907
500 Ga0207689_10130672 3300025942 Bacteria 2067
501 Ga0207667_10359048 3300025949 Bacteria 1486
502 Ga0207651_10054768 3300025960 Bacteria 2735
503 Ga0207651_10062966 3300025960 Bacteria 2588
504 Ga0207712_10040537 3300025961 Bacteria 3197
505 Ga0207712_10082058 3300025961 Bacteria 2349
506 Ga0207712_10310539 3300025961 Bacteria 1297
507 Ga0207668_10008550 3300025972 Bacteria 6107
508 Ga0207640_10066871 3300025981 Bacteria 2403
509 Ga0207658_10014292 3300025986 Bacteria 5436
510 Ga0207658_10543844 3300025986 Bacteria 1039
511 Ga0207677_10000627 3300026023 Bacteria 21422
512 Ga0207677_10600375 3300026023 Unclassified 966
513 Ga0207703_10505973 3300026035 Bacteria 1134
514 Ga0207678_10307250 3300026067 Bacteria 1363
515 Ga0207708_10027997 3300026075 Bacteria 4268
516 Ga0207708_10087809 3300026075 Bacteria 2395
517 Ga0207708_10284996 3300026075 Bacteria 1340
518 Ga0207641_10028292 3300026088 Bacteria 4630
519 Ga0207641_10055687 3300026088 Bacteria 3358
520 Ga0207641_10530784 3300026088 Unclassified 1146
521 Ga0207648_10049140 3300026089 Bacteria 3693
522 Ga0207648_10068961 3300026089 Bacteria 3081
523 Ga0207648_10096703 3300026089 Bacteria 2584
524 Ga0207648_10112287 3300026089 Bacteria 2393
525 Ga0207648_10157984 3300026089 Bacteria 2002
526 Ga0207648_10329279 3300026089 Bacteria 1374
527 Ga0207648_10460259 3300026089 Bacteria 1159
528 Ga0207676_10169053 3300026095 Bacteria 1903
529 Ga0207674_10117974 3300026116 Bacteria 2624
530 Ga0207675_100393473 3300026118 Bacteria 1365
531 Ga0207683_10001646 3300026121 Bacteria 20009
532 Ga0207683_10002766 3300026121 Bacteria 15330
533 Ga0207683_10005267 3300026121 Bacteria 11100
534 Ga0207698_10003221 3300026142 Bacteria 9800
535 Ga0207698_10009455 3300026142 Bacteria 6218
536 Ga0209179_1010222 3300027512 Bacteria 1631
537 Ga0209179_1027754 3300027512 Bacteria 1144
538 Ga0209588_1014337 3300027671 Bacteria 2424
539 Ga0209588_1023112 3300027671 Bacteria 1959
540 Ga0209588_1032325 3300027671 Bacteria 1676
541 Ga0209588_1040813 3300027671 Bacteria 1498
542 Ga0207428_10005757 3300027907 Bacteria 11507
543 Ga0207428_10082192 3300027907 Bacteria 2514
544 Ga0207428_10157538 3300027907 Bacteria 1726
545 Ga0207428_10276522 3300027907 Bacteria 1247
546 Ga0207428_10309497 3300027907 Bacteria 1168
547 Ga0207428_10556106 3300027907 Bacteria 829
548 Ga0265354_1007733 3300028016 Bacteria 1048
549 Ga0268266_10006527 3300028379 Bacteria 10675
550 Ga0268265_10105147 3300028380 Bacteria 2290
551 Ga0268265_10126186 3300028380 Bacteria 2118
552 Ga0268264_10128379 3300028381 Unclassified 2244
553 Ga0268264_10488206 3300028381 Bacteria 1199
554 Ga0268264_11125485 3300028381 Bacteria 794
555 Ga0265319_1018437 3300028563 Bacteria 2628
556 Ga0265338_10017818 3300028800 Bacteria 7638
557 Ga0265338_10094057 3300028800 Bacteria 2467
558 Ga0265339_10033650 3300031249 Bacteria 2885
559 Ga0265316_10045404 3300031344 Bacteria 3488
560 Ga0307513_10239435 3300031456 Bacteria 1621
561 Ga0373940_0088747 3300035088 Bacteria 924
562 Ga0373961_0139662 3300035241 Bacteria 818
563 Ga0373935_0034116 3300035692 Bacteria 3171
564 Ga0373927_0068731 3300035695 Bacteria 2292
565 Ga0373947_0169026 3300035725 Unclassified 1418
566 Ga0373937_0058967 3300036401 Bacteria 3527
567 Ga0373925_0177499 3300037068 Bacteria 1684
568 Ga0373925_0734897 3300037068 Bacteria 814
569 Ga0242420_021035 3300038996 Bacteria 1165
570 Ga0436365_1871017 3300039437 Bacteria 1812
571 Ga0436360_0292659 3300039438 Bacteria 1151
572 Ga0436360_0851782 3300039438 Bacteria 1710
573 Ga0436361_0154262 3300039447 Bacteria 1054
574 Ga0436361_0355376 3300039447 Bacteria 5690
575 Ga0436361_0750856 3300039447 Bacteria 2148
576 Ga0436361_1118965 3300039447 Bacteria 2430
577 Ga0436363_0493345 3300039450 Bacteria 1935
578 Ga0436362_0408017 3300039453 Bacteria 1057
579 Ga0436362_0946969 3300039453 Bacteria 1192
580 Ga0436362_1224121 3300039453 Bacteria 1514
581 Ga0451577_0132660 3300042876 Bacteria 2235
582 Ga0451577_0339421 3300042876 Bacteria 1363
583 Ga0451577_0352688 3300042876 Bacteria 1335
584 Ga0453683_0000255 3300044673 Bacteria 70114
585 Ga0453683_0037729 3300044673 Bacteria 3039
586 Ga0453683_0065657 3300044673 Bacteria 2268
587 Ga0453684_0099409 3300044712 Bacteria 3564
588 Ga0453684_0411453 3300044712 Bacteria 1512
589 Ga0451576_0260976 3300045051 Bacteria 1811
590 Ga0495580_0211380 3300046472 Bacteria 1335
591 Ga0495605_0081569 3300046474 Bacteria 1512
592 Ga0495594_0000607 3300046499 Bacteria 18448
593 Ga0495630_0441567 3300046517 Bacteria 997
594 Ga0495644_0002766 3300046523 Bacteria 6951
595 Ga0495644_0084915 3300046523 Bacteria 1193
596 Ga0495609_0032709 3300046538 Bacteria 2362
597 Ga0495634_0193114 3300046642 Bacteria 1269
598 Ga0495647_0019420 3300046681 Bacteria 2430
599 Ga0495669_0002279 3300046684 Bacteria 7870
600 Ga0495589_0154223 3300046794 Bacteria 1096
601 Ga0495636_0001130 3300047318 Bacteria 10044
602 Ga0495674_0049353 3300047319 Bacteria 3720
603 Ga0495674_0306636 3300047319 Bacteria 1296
604 Ga0495684_0019950 3300047471 Bacteria 5165
605 Ga0496101_0351953 3300048904 Bacteria 1158
606 Ga0496104_0255317 3300048907 Bacteria 1666
607 Ga0496104_0721096 3300048907 Bacteria 905
608 Ga0496105_0111632 3300048908 Bacteria 2256
609 Ga0496106_0048209 3300048909 Bacteria 3208
610 Ga0496106_0158864 3300048909 Bacteria 1787
611 Ga0496107_0108182 3300048910 Bacteria 2042
612 Ga0496108_0010425 3300048911 Bacteria 7546
613 Ga0496109_0001358 3300048912 Bacteria 20269
614 Ga0496110_0008554 3300048913 Bacteria 8240
615 Ga0496111_0012064 3300048914 Bacteria 5842
616 Ga0496111_0358635 3300048914 Bacteria 1079
617 Ga0496112_0511506 3300048915 Bacteria 1136
618 Ga0496113_0134274 3300048916 Bacteria 1944
619 Ga0496114_0180570 3300048917 Bacteria 1843
620 Ga0496115_0040282 3300048918 Bacteria 3713
621 Ga0496115_0098564 3300048918 Bacteria 2394
622 Ga0496115_0406206 3300048918 Unclassified 1105
623 Ga0496115_0496729 3300048918 Bacteria 981
624 Ga0496117_0004801 3300048920 Bacteria 14648
625 nmdc:mga05p37_129122_c1 3300050507 Bacteria 3102
626 nmdc:mga05p37_224137_c1 3300050507 Bacteria 2268
627 nmdc:mga05p37_228440_c1 3300050507 Bacteria 2243
628 nmdc:mga05p37_319963_c1 3300050507 Bacteria 1836
629 nmdc:mga05p37_38292_c1 3300050507 Bacteria 5882
630 nmdc:mga05p37_402085_c1 3300050507 Bacteria 1599
631 nmdc:mga05p37_405029_c1 3300050507 Bacteria 1592
632 nmdc:mga05p37_420771_c1 3300050507 Bacteria 1555
633 nmdc:mga05p37_4610_c1 3300050507 Bacteria 16112
634 nmdc:mga05p37_498319_c1 3300050507 Bacteria 1399
635 nmdc:mga05p37_6036_c1 3300050507 Bacteria 14264
636 nmdc:mga05p37_676_c3 3300050507 Bacteria 29757
637 nmdc:mga05p37_770585_c1 3300050507 Bacteria 1057
638 nmdc:mga05p37_91300_c1 3300050507 Bacteria 3753
639 nmdc:mga05p37_91848_c1 3300050507 Bacteria 3741
640 nmdc:mga09592_163363_c1 3300050508 Bacteria 1924
641 nmdc:mga09592_223169_c1 3300050508 Bacteria 1633
642 nmdc:mga09592_322710_c1 3300050508 Bacteria 1338
643 nmdc:mga09592_7177_c1 3300050508 Bacteria 9059
644 nmdc:mga09592_848452_c1 3300050508 Bacteria 770
645 nmdc:mga09592_9491_c1 3300050508 Bacteria 6939
646 nmdc:mga0qj67_4497_c1 3300050509 Bacteria 10105
647 nmdc:mga06r32_204_c1 3300050510 Bacteria 47691
648 nmdc:mga06r32_44349_c1 3300050510 Bacteria 4235
649 nmdc:mga06r32_521446_c1 3300050510 Bacteria 1164
650 nmdc:mga06r32_637583_c1 3300050510 Unclassified 1034
651 nmdc:mga08y16_141373_c1 3300050511 Bacteria 2502
652 nmdc:mga08y16_187386_c1 3300050511 Bacteria 2147
653 nmdc:mga08y16_215115_c1 3300050511 Bacteria 1990
654 nmdc:mga08y16_224911_c1 3300050511 Bacteria 1942
655 nmdc:mga08y16_236733_c1 3300050511 Bacteria 1888
656 nmdc:mga08y16_292245_c1 3300050511 Bacteria 1680
657 nmdc:mga08y16_39095_c1 3300050511 Bacteria 4978
658 nmdc:mga0n895_1287_c1 3300050512 Bacteria 18556
659 nmdc:mga0n895_150447_c1 3300050512 Bacteria 2358
660 nmdc:mga0n895_164151_c1 3300050512 Bacteria 2253
661 nmdc:mga0n895_195875_c1 3300050512 Bacteria 2052
662 nmdc:mga0n895_335109_c1 3300050512 Bacteria 1533
663 nmdc:mga0n895_5296_c1 3300050512 Bacteria 10744
664 nmdc:mga0n895_615131_c1 3300050512 Bacteria 1088
665 nmdc:mga0n895_755_c1 3300050512 Bacteria 22891
666 nmdc:mga0n895_9141_c1 3300050512 Bacteria 8653
667 nmdc:mga0rr50_49270_c1 3300050513 Bacteria 3118
668 nmdc:mga0rr50_49587_c1 3300050513 Bacteria 3108
669 nmdc:mga0rr50_628764_c1 3300050513 Bacteria 916
670 nmdc:mga0rr50_7589_c1 3300050513 Bacteria 6704
671 nmdc:mga0rr50_849443_c1 3300050513 Bacteria 779
672 nmdc:mga0rr50_98876_c1 3300050513 Bacteria 2288
673 nmdc:mga08x19_1290_c1 3300050514 Bacteria 15580
674 nmdc:mga08x19_205_c1 3300050514 Bacteria 45381
675 nmdc:mga08x19_2886_c1 3300050514 Bacteria 10348
676 nmdc:mga08x19_41194_c1 3300050514 Bacteria 2941
677 nmdc:mga0a205_10973_c1 3300050515 Bacteria 8338
678 nmdc:mga0a205_185336_c1 3300050515 Bacteria 1974
679 nmdc:mga0a205_2365_c1 3300050515 Bacteria 16629
680 nmdc:mga0a205_260268_c1 3300050515 Bacteria 1613
681 nmdc:mga0a205_278913_c1 3300050515 Bacteria 1547
682 nmdc:mga0a205_285276_c1 3300050515 Bacteria 1526
683 nmdc:mga0a205_382949_c1 3300050515 Bacteria 1272
684 nmdc:mga0a205_393120_c1 3300050515 Bacteria 1251
685 nmdc:mga0a205_482589_c1 3300050515 Bacteria 1098
686 nmdc:mga0a205_521452_c1 3300050515 Bacteria 1045
687 nmdc:mga0a205_590965_c1 3300050515 Bacteria 964
688 nmdc:mga0a205_98638_c1 3300050515 Bacteria 2820
689 Ga0495619_0027266 3300053085 Bacteria 3678
690 Ga0495619_0502538 3300053085 Unclassified 834
691 Ga0500555_006993 3300053103 Bacteria 3208
692 Ga0587071_041728 3300060344 Unclassified 921
693 2617380782 2617270742 Bacteria 6808054
694 Ga0070707_100000965
695 CNAas_1000191
696 LJNas_1002803
697 rootH2_10164078
698 Ga0065704_10027056
699 Ga0065715_10295477
700 Ga0065707_10092649
701 Ga0065707_10282111
702 Ga0070658_10031590
703 Ga0070676_10002601
704 Ga0070683_100017958
705 Ga0070670_100012430
706 Ga0070670_100672747
707 Ga0068869_100002037
708 Ga0068869_100137613
709 Ga0070666_10001174
710 Ga0068868_100000426
711 Ga0068868_100018889
712 Ga0068868_100050812
713 Ga0068868_100582155
714 Ga0068868_100679873
715 Ga0070660_100319327
716 Ga0070661_100016857
717 Ga0070668_100007922
718 Ga0070668_100118264
719 Ga0070669_100182398
720 Ga0070669_100317733
721 Ga0070675_100000979
722 Ga0070675_100010950
723 Ga0070675_100019857
724 Ga0070671_100000640
725 Ga0070671_100025640
726 Ga0070674_100159349
727 Ga0070673_100307889
728 Ga0070673_100550300
729 Ga0070688_100189987
730 Ga0070688_100293109
731 Ga0070659_100197447
732 Ga0070667_100006619
733 Ga0070667_100017052
734 Ga0070667_100058621
735 Ga0070703_10160314
736 Ga0070709_10323130
737 Ga0070709_10462046
738 Ga0070713_100211783
739 Ga0070713_100399394
740 Ga0070713_100496939
741 Ga0070710_10150989
742 Ga0070710_10198449
743 Ga0070710_10226994
744 Ga0070711_100010796
745 Ga0070711_100035825
746 Ga0070711_100062749
747 Ga0070711_100110905
748 Ga0070711_100181893
749 Ga0070711_100351894
750 Ga0070711_100418223
751 Ga0070711_100448113
752 Ga0070705_100073239
753 Ga0070705_100531002
754 Ga0070700_100015287
755 Ga0070694_100034789
756 Ga0070694_100068397
757 Ga0070694_100220865
758 Ga0070708_100000687
759 Ga0070708_100066222
760 Ga0070708_100141362
761 Ga0070708_100162199
762 Ga0070708_100238110
763 Ga0070708_100239987
764 Ga0070708_100336062
765 Ga0070708_100347125
766 Ga0070708_100355876
767 Ga0070708_100390954
768 Ga0070708_100966679
769 Ga0070678_100001335
770 Ga0070678_100008008
771 Ga0070678_100030309
772 Ga0070662_100001162
773 Ga0070662_100089231
774 Ga0070662_100127108
775 Ga0070662_100198218
776 Ga0068867_100019700
777 Ga0068867_100029168
778 Ga0070706_100000252
779 Ga0070706_100001508
780 Ga0070706_100078026
781 Ga0070706_100129402
782 Ga0070706_100156973
783 Ga0070706_100189941
784 Ga0070706_100195531
785 Ga0070706_100210357
786 Ga0070706_100235983
787 Ga0070706_100326715
788 Ga0070706_100380589
789 Ga0070706_100590082
790 Ga0070706_100964469
791 Ga0070707_100000274
792 Ga0070707_100012231
793 Ga0070707_100033905
794 Ga0070707_100046939
795 Ga0070707_100098691
796 Ga0070707_100120187
797 Ga0070707_100122546
798 Ga0070707_100142109
799 Ga0070707_100145210
800 Ga0070707_100173287
801 Ga0070707_100342407
802 Ga0070707_100365621
803 Ga0070707_100386288
804 Ga0070707_100638242
805 Ga0070707_100925526
806 Ga0070698_100040743
807 Ga0070698_100181217
808 Ga0070698_100254471
809 Ga0070698_100290698
810 Ga0070698_100312767
811 Ga0070698_100378160
812 Ga0070698_100381798
813 Ga0070698_100425477
814 Ga0070698_100459018
815 Ga0070699_100029980
816 Ga0070699_100048432
817 Ga0070699_100158247
818 Ga0070699_100163411
819 Ga0070699_100173484
820 Ga0070699_100222627
821 Ga0070699_100288266
822 Ga0070699_100290686
823 Ga0070699_100328321
824 Ga0070699_100518487
825 Ga0070699_100728467
826 Ga0070699_100815576
827 Ga0070697_100010465
828 Ga0070697_100016380
829 Ga0070697_100155051
830 Ga0070697_100161749
831 Ga0070697_100211699
832 Ga0070697_100263204
833 Ga0070697_100313317
834 Ga0070697_100358981
835 Ga0070697_100368578
836 Ga0070697_100380974
837 Ga0070697_100577685
838 Ga0070697_100679772
839 Ga0068853_100512753
840 Ga0070672_100000768
841 Ga0070672_100024925
842 Ga0070686_100044658
843 Ga0070686_100464907
844 Ga0070695_100071168
845 Ga0070695_100113544
846 Ga0070695_100185870
847 Ga0070695_100564910
848 Ga0070696_100333635
849 Ga0070696_100629562
850 Ga0070696_100660693
851 Ga0070665_100008044
852 Ga0070665_100383259
853 Ga0070704_100019410
854 Ga0070704_100039372
855 Ga0070704_100496328
856 Ga0068855_100302924
857 Ga0068855_100411749
858 Ga0070664_100009748
859 Ga0068854_100116803
860 Ga0068856_100335181
861 Ga0068856_100573778
862 Ga0068856_100680079
863 Ga0070702_100039357
864 Ga0070702_100495943
865 Ga0068852_100001076
866 Ga0068852_100043907
867 Ga0068852_100595676
868 Ga0068859_100347513
869 Ga0068859_100427786
870 Ga0068859_100466816
871 Ga0068859_100767151
872 Ga0068864_100023561
873 Ga0068864_100114952
874 Ga0068864_100318394
875 Ga0068866_10002255
876 Ga0068866_10471842
877 Ga0068861_100786045
878 Ga0068870_10098287
879 Ga0068863_100003974
880 Ga0068863_100030587
881 Ga0068863_100079947
882 Ga0068863_100098513
883 Ga0068863_100150542
884 Ga0068863_100177695
885 Ga0068863_101213686
886 Ga0068858_100015698
887 Ga0068858_100463527
888 Ga0068858_100480210
889 Ga0068860_100161006
890 Ga0068860_100284265
891 Ga0068860_100408727
892 Ga0081540_1128956
893 Ga0070717_10035143
894 Ga0070717_10157335
895 Ga0070717_10210878
896 Ga0070717_10260783
897 Ga0070717_10540873
898 Ga0070717_10927214
899 Ga0075432_10129629
900 Ga0075432_10135469
901 Ga0070715_10002908
902 Ga0070715_10049072
903 Ga0070715_10112001
904 Ga0070715_10243940
905 Ga0070715_10326768
906 Ga0070716_100000727
907 Ga0070716_100077850
908 Ga0070716_100216993
909 Ga0070716_100282082
910 Ga0070712_100001116
911 Ga0070712_100063005
912 Ga0070712_100068546
913 Ga0070712_100079414
914 Ga0070712_100430873
915 Ga0097621_100004944
916 Ga0097621_100007089
917 Ga0068871_100007911
918 Ga0068871_100037366
919 Ga0068871_100343998
920 Ga0068871_100508659
921 Ga0075428_100026624
922 Ga0075428_100145153
923 Ga0075428_100328633
924 Ga0075428_100491018
925 Ga0075428_100657616
926 Ga0075430_100076096
927 Ga0075430_100080996
928 Ga0075430_100392197
929 Ga0075431_100000738
930 Ga0075431_100023088
931 Ga0075431_100051410
932 Ga0075431_100144483
933 Ga0075431_100165426
934 Ga0075433_10001290
935 Ga0075433_10001310
936 Ga0075433_10006871
937 Ga0075433_10016768
938 Ga0075433_10051117
939 Ga0075433_10113306
940 Ga0075433_10163137
941 Ga0075433_10172380
942 Ga0075433_10301223
943 Ga0075433_10316649
944 Ga0075433_10379803
945 Ga0075433_10481195
946 Ga0075433_10632529
947 Ga0075434_100000715
948 Ga0075434_100001017
949 Ga0075434_100023492
950 Ga0075434_100098671
951 Ga0075434_100107176
952 Ga0075434_100171043
953 Ga0075434_100392426
954 Ga0075434_100405936
955 Ga0075434_100419461
956 Ga0075434_100579266
957 Ga0075429_100044188
958 Ga0075429_100050184
959 Ga0075429_100139463
960 Ga0075429_100574504
961 Ga0068865_100026795
962 Ga0068865_100030530
963 Ga0068865_100118438
964 Ga0075436_100055237
965 Ga0075436_100057452
966 Ga0075436_100388585
967 Ga0075436_100406819
968 Ga0075436_100572532
969 Ga0097620_100347463
970 Ga0097620_100427761
971 Ga0097620_100466820
972 Ga0097620_100767055
973 Ga0075435_100002644
974 Ga0075435_100028594
975 Ga0075435_100068738
976 Ga0075435_100082431
977 Ga0075435_100145396
978 Ga0075435_100257594
979 Ga0075435_100300635
980 Ga0075435_100667785
981 Ga0099794_10022050
982 Ga0099794_10060537
983 Ga0099794_10094806
984 Ga0099794_10105391
985 Ga0099794_10129518
986 Ga0099794_10171379
987 Ga0099794_10275868
988 Ga0099795_10003507
989 Ga0099795_10050413
990 Ga0099795_10107176
991 Ga0099795_10110312
992 Ga0105250_10077109
993 Ga0105250_10169968
994 Ga0111539_10027702
995 Ga0111539_10115622
996 Ga0111539_10120126
997 Ga0111539_10152617
998 Ga0111539_10188947
999 Ga0111539_10255820
1000 Ga0111539_10888091
1001 Ga0111539_11001043
1002 Ga0105245_10002126
1003 Ga0105245_10232896
1004 Ga0105247_10503780
1005 Ga0114129_10047270
1006 Ga0114129_10134928
1007 Ga0114129_10230826
1008 Ga0114129_10240111
1009 Ga0114129_10314739
1010 Ga0114129_10316984
1011 Ga0114129_10360565
1012 Ga0114129_10442386
1013 Ga0105243_10013230
1014 Ga0105243_10152553
1015 Ga0105241_10005774
1016 Ga0105241_10474230
1017 Ga0105242_10129424
1018 Ga0105242_10293179
1019 Ga0105242_10364246
1020 Ga0105242_10842739
1021 Ga0105248_10065847
1022 Ga0105248_10077767
1023 Ga0105248_10109505
1024 Ga0105248_10175242
1025 Ga0105237_10710225
1026 Ga0105249_10076087
1027 Ga0105249_10187300
1028 Ga0105249_10280588
1029 Ga0105249_11022945
1030 Ga0099796_10009222
1031 Ga0099796_10012618
1032 Ga0099796_10020229
1033 Ga0099796_10028263
1034 Ga0099796_10071234
1035 Ga0099796_10086174
1036 Ga0105239_10142017
1037 Ga0105239_10229310
1038 Ga0105239_10512422
1039 Ga0105246_10047801
1040 Ga0105246_10434741
1041 Ga0157373_10083463
1042 Ga0157373_10137009
1043 Ga0157373_10165231
1044 Ga0157373_10229017
1045 Ga0157371_10074373
1046 Ga0157371_10556678
1047 Ga0157374_10010123
1048 Ga0157374_10019937
1049 Ga0157374_10324020
1050 Ga0157378_10057262
1051 Ga0157378_10062907
1052 Ga0157378_10251237
1053 Ga0157378_10497726
1054 Ga0157378_10655878
1055 Ga0163162_10013765
1056 Ga0163162_10017725
1057 Ga0163162_10109455
1058 Ga0163162_10642288
1059 Ga0157372_10041766
1060 Ga0157375_10013163
1061 Ga0157375_10060931
1062 Ga0157375_10085383
1063 Ga0157375_10690198
1064 Ga0163163_10012799
1065 Ga0163163_10086939
1066 Ga0163163_10196926
1067 Ga0163163_10605757
1068 Ga0163163_10811414
1069 Ga0157380_10018653
1070 Ga0157377_10096529
1071 Ga0157379_10003248
1072 Ga0157379_10098630
1073 Ga0157379_10427073
1074 Ga0157379_10577242
1075 Ga0157376_10003670
1076 Ga0157376_10129474
1077 Ga0157376_11181019
1078 Ga0163161_10032334
1079 Ga0163161_10196028
1080 Ga0213873_10017917
1081 Ga0213872_10001134
1082 Ga0213872_10003568
1083 Ga0213872_10104688
1084 Ga0213872_10173156
1085 Ga0224572_1036440
1086 Ga0228598_1004031
1087 Ga0207692_10009529
1088 Ga0207692_10416216
1089 Ga0207642_10003083
1090 Ga0207642_10025103
1091 Ga0207642_10063426
1092 Ga0207688_10163895
1093 Ga0207680_10020873
1094 Ga0207680_10059199
1095 Ga0207685_10007379
1096 Ga0207685_10084900
1097 Ga0207685_10103660
1098 Ga0207699_10285971
1099 Ga0207699_10424385
1100 Ga0207645_10001760
1101 Ga0207645_10003733
1102 Ga0207643_10029103
1103 Ga0207684_10000267
1104 Ga0207684_10000295
1105 Ga0207684_10001438
1106 Ga0207684_10009957
1107 Ga0207684_10011716
1108 Ga0207684_10011728
1109 Ga0207684_10026774
1110 Ga0207684_10052444
1111 Ga0207684_10079878
1112 Ga0207684_10084948
1113 Ga0207684_10128027
1114 Ga0207684_10167408
1115 Ga0207684_10245901
1116 Ga0207684_10266120
1117 Ga0207684_10303607
1118 Ga0207654_10237277
1119 Ga0207654_10350681
1120 Ga0207693_10024087
1121 Ga0207693_10049710
1122 Ga0207693_10055394
1123 Ga0207693_10162251
1124 Ga0207693_10162449
1125 Ga0207693_10169378
1126 Ga0207693_10719036
1127 Ga0207663_10046257
1128 Ga0207663_10077307
1129 Ga0207663_10081089
1130 Ga0207663_10217867
1131 Ga0207663_10402882
1132 Ga0207660_10244172
1133 Ga0207660_10287448
1134 Ga0207662_10056804
1135 Ga0207662_10113808
1136 Ga0207657_10347084
1137 Ga0207646_10000016
1138 Ga0207646_10000643
1139 Ga0207646_10001829
1140 Ga0207646_10008411
1141 Ga0207646_10011164
1142 Ga0207646_10016416
1143 Ga0207646_10086472
1144 Ga0207646_10087882
1145 Ga0207646_10098244
1146 Ga0207646_10131848
1147 Ga0207646_10139444
1148 Ga0207646_10160238
1149 Ga0207646_10171444
1150 Ga0207646_10341776
1151 Ga0207646_10742343
1152 Ga0207681_10064981
1153 Ga0207681_10065971
1154 Ga0207681_10323802
1155 Ga0207681_10356361
1156 Ga0207650_10017367
1157 Ga0207650_10689563
1158 Ga0207659_10013585
1159 Ga0207659_10017788
1160 Ga0207687_10520779
1161 Ga0207700_10088305
1162 Ga0207700_10112974
1163 Ga0207700_10560120
1164 Ga0207664_10205444
1165 Ga0207644_10024343
1166 Ga0207644_10224461
1167 Ga0207706_10002020
1168 Ga0207706_10006128
1169 Ga0207706_10105270
1170 Ga0207686_10019653
1171 Ga0207686_10089983
1172 Ga0207686_10106672
1173 Ga0207686_10394373
1174 Ga0207709_10007140
1175 Ga0207709_10033490
1176 Ga0207704_10025998
1177 Ga0207704_10115777
1178 Ga0207704_10175898
1179 Ga0207665_10065035
1180 Ga0207665_10097098
1181 Ga0207665_10120122
1182 Ga0207665_10123054
1183 Ga0207665_10190537
1184 Ga0207665_10489659
1185 Ga0207691_10004437
1186 Ga0207691_10007630
1187 Ga0207691_10466063
1188 Ga0207711_10101794
1189 Ga0207711_10137586
1190 Ga0207711_10140202
1191 Ga0207711_10480271
1192 Ga0207689_10002864
1193 Ga0207689_10130672
1194 Ga0207667_10359048
1195 Ga0207651_10054768
1196 Ga0207651_10062966
1197 Ga0207712_10040537
1198 Ga0207712_10082058
1199 Ga0207712_10310539
1200 Ga0207668_10008550
1201 Ga0207640_10066871
1202 Ga0207658_10014292
1203 Ga0207658_10543844
1204 Ga0207677_10000627
1205 Ga0207677_10600375
1206 Ga0207703_10505973
1207 Ga0207678_10307250
1208 Ga0207708_10027997
1209 Ga0207708_10087809
1210 Ga0207708_10284996
1211 Ga0207641_10028292
1212 Ga0207641_10055687
1213 Ga0207641_10530784
1214 Ga0207648_10049140
1215 Ga0207648_10068961
1216 Ga0207648_10096703
1217 Ga0207648_10112287
1218 Ga0207648_10157984
1219 Ga0207648_10329279
1220 Ga0207648_10460259
1221 Ga0207676_10169053
1222 Ga0207674_10117974
1223 Ga0207675_100393473
1224 Ga0207683_10001646
1225 Ga0207683_10002766
1226 Ga0207683_10005267
1227 Ga0207698_10003221
1228 Ga0207698_10009455
1229 Ga0209179_1010222
1230 Ga0209179_1027754
1231 Ga0209588_1014337
1232 Ga0209588_1023112
1233 Ga0209588_1032325
1234 Ga0209588_1040813
1235 Ga0207428_10005757
1236 Ga0207428_10082192
1237 Ga0207428_10157538
1238 Ga0207428_10276522
1239 Ga0207428_10309497
1240 Ga0207428_10556106
1241 Ga0265354_1007733
1242 Ga0268266_10006527
1243 Ga0268265_10105147
1244 Ga0268265_10126186
1245 Ga0268264_10128379
1246 Ga0268264_10488206
1247 Ga0268264_11125485
1248 Ga0265319_1018437
1249 Ga0265338_10017818
1250 Ga0265338_10094057
1251 Ga0265339_10033650
1252 Ga0265316_10045404
1253 Ga0307513_10239435
1254 Ga0373940_0088747
1255 Ga0373961_0139662
1256 Ga0373935_0034116
1257 Ga0373927_0068731
1258 Ga0373947_0169026
1259 Ga0373937_0058967
1260 Ga0373925_0177499
1261 Ga0373925_0734897
1262 Ga0242420_021035
1263 Ga0436365_1871017
1264 Ga0436360_0292659
1265 Ga0436360_0851782
1266 Ga0436361_0154262
1267 Ga0436361_0355376
1268 Ga0436361_0750856
1269 Ga0436361_1118965
1270 Ga0436363_0493345
1271 Ga0436362_0408017
1272 Ga0436362_0946969
1273 Ga0436362_1224121
1274 Ga0451577_0132660
1275 Ga0451577_0339421
1276 Ga0451577_0352688
1277 Ga0453683_0000255
1278 Ga0453683_0037729
1279 Ga0453683_0065657
1280 Ga0453684_0099409
1281 Ga0453684_0411453
1282 Ga0451576_0260976
1283 Ga0495580_0211380
1284 Ga0495605_0081569
1285 Ga0495594_0000607
1286 Ga0495630_0441567
1287 Ga0495644_0002766
1288 Ga0495644_0084915
1289 Ga0495609_0032709
1290 Ga0495634_0193114
1291 Ga0495647_0019420
1292 Ga0495669_0002279
1293 Ga0495589_0154223
1294 Ga0495636_0001130
1295 Ga0495674_0049353
1296 Ga0495674_0306636
1297 Ga0495684_0019950
1298 Ga0496101_0351953
1299 Ga0496104_0255317
1300 Ga0496104_0721096
1301 Ga0496105_0111632
1302 Ga0496106_0048209
1303 Ga0496106_0158864
1304 Ga0496107_0108182
1305 Ga0496108_0010425
1306 Ga0496109_0001358
1307 Ga0496110_0008554
1308 Ga0496111_0012064
1309 Ga0496111_0358635
1310 Ga0496112_0511506
1311 Ga0496113_0134274
1312 Ga0496114_0180570
1313 Ga0496115_0040282
1314 Ga0496115_0098564
1315 Ga0496115_0406206
1316 Ga0496115_0496729
1317 Ga0496117_0004801
1318 nmdc:mga05p37_129122_c1
1319 nmdc:mga05p37_224137_c1
1320 nmdc:mga05p37_228440_c1
1321 nmdc:mga05p37_319963_c1
1322 nmdc:mga05p37_38292_c1
1323 nmdc:mga05p37_402085_c1
1324 nmdc:mga05p37_405029_c1
1325 nmdc:mga05p37_420771_c1
1326 nmdc:mga05p37_4610_c1
1327 nmdc:mga05p37_498319_c1
1328 nmdc:mga05p37_6036_c1
1329 nmdc:mga05p37_676_c3
1330 nmdc:mga05p37_770585_c1
1331 nmdc:mga05p37_91300_c1
1332 nmdc:mga05p37_91848_c1
1333 nmdc:mga09592_163363_c1
1334 nmdc:mga09592_223169_c1
1335 nmdc:mga09592_322710_c1
1336 nmdc:mga09592_7177_c1
1337 nmdc:mga09592_848452_c1
1338 nmdc:mga09592_9491_c1
1339 nmdc:mga0qj67_4497_c1
1340 nmdc:mga06r32_204_c1
1341 nmdc:mga06r32_44349_c1
1342 nmdc:mga06r32_521446_c1
1343 nmdc:mga06r32_637583_c1
1344 nmdc:mga08y16_141373_c1
1345 nmdc:mga08y16_187386_c1
1346 nmdc:mga08y16_215115_c1
1347 nmdc:mga08y16_224911_c1
1348 nmdc:mga08y16_236733_c1
1349 nmdc:mga08y16_292245_c1
1350 nmdc:mga08y16_39095_c1
1351 nmdc:mga0n895_1287_c1
1352 nmdc:mga0n895_150447_c1
1353 nmdc:mga0n895_164151_c1
1354 nmdc:mga0n895_195875_c1
1355 nmdc:mga0n895_335109_c1
1356 nmdc:mga0n895_5296_c1
1357 nmdc:mga0n895_615131_c1
1358 nmdc:mga0n895_755_c1
1359 nmdc:mga0n895_9141_c1
1360 nmdc:mga0rr50_49270_c1
1361 nmdc:mga0rr50_49587_c1
1362 nmdc:mga0rr50_628764_c1
1363 nmdc:mga0rr50_7589_c1
1364 nmdc:mga0rr50_849443_c1
1365 nmdc:mga0rr50_98876_c1
1366 nmdc:mga08x19_1290_c1
1367 nmdc:mga08x19_205_c1
1368 nmdc:mga08x19_2886_c1
1369 nmdc:mga08x19_41194_c1
1370 nmdc:mga0a205_10973_c1
1371 nmdc:mga0a205_185336_c1
1372 nmdc:mga0a205_2365_c1
1373 nmdc:mga0a205_260268_c1
1374 nmdc:mga0a205_278913_c1
1375 nmdc:mga0a205_285276_c1
1376 nmdc:mga0a205_382949_c1
1377 nmdc:mga0a205_393120_c1
1378 nmdc:mga0a205_482589_c1
1379 nmdc:mga0a205_521452_c1
1380 nmdc:mga0a205_590965_c1
1381 nmdc:mga0a205_98638_c1
1382 Ga0495619_0027266
1383 Ga0495619_0502538
1384 Ga0500555_006993
1385 Ga0587071_041728
1386 2617380782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

61

214

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9157 8 216
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.915 8 216
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9113 8 216
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.9106 8 216
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9101 5 213
ID Description Score Start End Superfamily
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9136 8 216 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9094 11 195 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9092 8 216 3.40.50.850
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8939 10 206 3.40.50.850
af_B0G192_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8866 19 175 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2V9X485-F1-model_v4 Hydrolase 0.9802 1 194 GO:0016787
AF-A0A2V9RL31-F1-model_v4 Hydrolase 0.9792 7 202 GO:0016787
AF-A0A6N9Q8P7-F1-model_v4 Hydrolase 0.9777 32 206 GO:0016787
AF-A0A3N8FKG7-F1-model_v4 Hydrolase 0.9773 15 165 GO:0016787
AF-A0A812S2X5-F1-model_v4 YhhW protein 0.977 10 182

Map