F475588

General Info

Members Datasets Scaffolds Average Seq Length
692 402 1385 369

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10051463|Ga0316576_100514633
Length 341
Sequence LTLNDSFNRPLRDLRISVTDLCNFRCPYCMPKEVFGSEHRFLPKSELLKFEEITRLASIFIGFGVRKIRLTGGEPLIRHQVEVLVSMLRALSNVNGQHKGIEIAMTTNGSLLAEKALTLKEAGLDRLTISLDSIDDATFRRMNDVNFPLEKVLESVKAAEAAGFETLKFNTVVKRGWNDHQILDLATHFRGTKHILRFIEYMDVGTTNGWRLDQIVPAKEIIETIHAKYPLVPVSSNYRGEVARRWHYQDGSGEIGVIASVTQPFCGDCSRARLSATGQLYTCLFATNGQDLRAMLRSGASDDQIRAQIHSVWRERNDHYSEIRSANTSDLQKIEMSYIGG

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
176 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
186 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
190 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
191 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
192 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
207 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
208 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
216 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
217 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
245 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
277 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
291 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
332 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
333 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
334 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
338 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
339 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
340 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
344 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
346 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
347 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
348 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
349 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
350 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
351 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
352 2643221585 Pelomonas sp. Root662 Isolate Unclassified
353 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
354 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
355 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
356 2643221645 Massilia sp. Root351 Isolate Unclassified
357 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
358 2643221656 Pelomonas sp. Root405 Isolate Unclassified
359 2643221664 Massilia sp. Root418 Isolate Unclassified
360 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
361 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
362 2738541280 Massilia sp. GV090 Isolate Unclassified
363 2738541297 Duganella sp. GV083 Isolate Unclassified
364 2738541300 Massilia sp. GV016 Isolate Unclassified
365 2738541337 Pelomonas sp. BT06 Isolate Unclassified
366 2738541357 Duganella sp. GV053 Isolate Unclassified
367 2738543003 Duganella sp. GV066 Isolate Unclassified
368 2738543018 Massilia sp. GV045 Isolate Unclassified
369 2738543026 Duganella sp. GV089 Isolate Unclassified
370 2738543029 Duganella sp. GV039 Isolate Unclassified
371 2738543030 Massilia sp. GV097 Isolate Unclassified
372 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
373 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
374 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
375 2818991436 Collimonas arenae 515 Isolate Unclassified
376 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
377 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
378 2821131069 Duganella sp. 1224 Isolate Unclassified
379 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
380 2842711865 Duganella sp. R-73148 Isolate Unclassified
381 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
382 2857553236 Duganella sp. R-74557 Isolate Unclassified
383 2857558681 Duganella sp. R-74565 Isolate Unclassified
384 2857564685 Duganella sp. R-74599 Isolate Unclassified
385 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
386 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
387 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
388 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
389 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
390 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
391 2904424332 Duganella sp. 1411 Isolate Rhizosphere
392 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
393 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
394 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
395 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
396 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
397 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
398 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
399 2919476304 Duganella sp. 3397 Isolate Unclassified
400 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
401 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
402 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.62
Metatranscriptomes 0
Isolates 8.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.76
Nodule 0.87
Rhizoplane 2.46
Rhizosphere 64.88
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10051463 3300031727 Bacteria 2998
2 JGI25155J39150_1000049 3300002704 Bacteria 78961
3 JGI25155J39150_1000174 3300002704 Bacteria 28283
4 JGI25156J39149_1000023 3300002705 Bacteria 146831
5 JGI25156J39149_1000168 3300002705 Bacteria 47907
6 JGI25154J39366_1000036 3300002738 Bacteria 161697
7 JGI25154J39366_1000185 3300002738 Bacteria 47907
8 JGI25154J39366_1000239 3300002738 Bacteria 36143
9 JGI25154J39366_1005780 3300002738 Bacteria 1912
10 JGI25157J39369_1000023 3300002741 Bacteria 161697
11 JGI25157J39369_1000429 3300002741 Bacteria 27371
12 JGI25159J45721_1001259 3300002987 Bacteria 10686
13 JGI25151J46595_10033349 3300003187 Bacteria 1984
14 JGI25165J46597_1000022 3300003214 Bacteria 357959
15 JGI25153J46596_10009345 3300003215 Bacteria 4573
16 rootL2_10002393 3300003322 Bacteria 3871
17 rootL2_10035151 3300003322 Bacteria 5421
18 rootH1_10003102 3300003316 Bacteria 65144
19 rootH1_10003102 3300003323 Bacteria 6079
20 JGI25160J50197_1000260 3300003354 Bacteria 39829
21 JGI25161J50226_1000015 3300003374 Bacteria 183773
22 Ga0055538_1000002 3300003751 Bacteria 999437
23 Ga0055538_1000011 3300003751 Bacteria 357959
24 Ga0055539_1000002 3300003752 Bacteria 999437
25 Ga0055539_1000016 3300003752 Bacteria 358248
26 Ga0055533_1000004 3300003756 Bacteria 999437
27 Ga0055533_1000019 3300003756 Bacteria 357959
28 Ga0055532_1000050 3300003758 Bacteria 169240
29 Ga0055525_1000002 3300003759 Bacteria 999437
30 Ga0055525_1000042 3300003759 Bacteria 279804
31 Ga0055529_1000154 3300003763 Bacteria 94292
32 Ga0055526_1000166 3300003771 Bacteria 57918
33 Ga0055526_1001297 3300003771 Bacteria 17923
34 Ga0055526_1003006 3300003771 Bacteria 11012
35 Ga0055526_1004954 3300003771 Bacteria 7820
36 Ga0055537_1000135 3300003773 Bacteria 55914
37 Ga0055524_1000016 3300003775 Bacteria 244926
38 Ga0055524_1000094 3300003775 Bacteria 110394
39 Ga0055534_1006054 3300003784 Bacteria 3115
40 Ga0055528_1001624 3300003790 Bacteria 13258
41 Ga0055528_1002120 3300003790 Bacteria 10952
42 Ga0055530_10003682 3300003791 Bacteria 8558
43 Ga0055540_1000004 3300003792 Bacteria 395545
44 Ga0055531_10000011 3300003794 Bacteria 195010
45 Ga0055531_10033161 3300003794 Bacteria 1669
46 Ga0055541_1000002 3300003841 Bacteria 896405
47 Ga0055541_1000017 3300003841 Bacteria 286811
48 Ga0055541_1000043 3300003841 Bacteria 161703
49 Ga0055543_1000634 3300004625 Bacteria 18881
50 Ga0065707_10091325 3300005295 Bacteria 3966
51 Ga0070676_10038754 3300005328 Bacteria 2753
52 Ga0070683_100015504 3300005329 Bacteria 6697
53 Ga0070683_100042472 3300005329 Bacteria 4186
54 Ga0070683_100123716 3300005329 Bacteria 2444
55 Ga0070690_100008898 3300005330 Bacteria 5797
56 Ga0070677_10038511 3300005333 Bacteria 1871
57 Ga0068869_100006980 3300005334 Bacteria 7190
58 Ga0070666_10002851 3300005335 Bacteria 10447
59 Ga0068868_100008007 3300005338 Bacteria 7552
60 Ga0070660_100049748 3300005339 Bacteria 3223
61 Ga0070660_100121905 3300005339 Bacteria 2081
62 Ga0070661_100001791 3300005344 Bacteria 14900
63 Ga0070661_100033553 3300005344 Bacteria 3718
64 Ga0070669_100050989 3300005353 Bacteria 3024
65 Ga0070669_100109499 3300005353 Bacteria 2094
66 Ga0070675_100015977 3300005354 Bacteria 5947
67 Ga0070671_100005541 3300005355 Bacteria 10057
68 Ga0070673_100003452 3300005364 Bacteria 9847
69 Ga0070673_100046418 3300005364 Bacteria 3374
70 Ga0070659_100001056 3300005366 Bacteria 20135
71 Ga0070659_100334610 3300005366 Bacteria 1268
72 Ga0070667_100000729 3300005367 Bacteria 31575
73 Ga0070667_100005018 3300005367 Bacteria 11078
74 Ga0070663_100001214 3300005455 Bacteria 14143
75 Ga0070662_100003372 3300005457 Bacteria 9951
76 Ga0070681_10002456 3300005458 Bacteria 16978
77 Ga0068867_100002085 3300005459 Bacteria 14010
78 Ga0068867_100002621 3300005459 Bacteria 12684
79 Ga0068867_100047485 3300005459 Bacteria 3156
80 Ga0068867_100185450 3300005459 Bacteria 1657
81 Ga0070706_100000212 3300005467 Bacteria 71525
82 Ga0070699_100007930 3300005518 Bacteria 9222
83 Ga0070679_100003476 3300005530 Bacteria 14425
84 Ga0070684_100007991 3300005535 Bacteria 8258
85 Ga0070684_100009951 3300005535 Bacteria 7517
86 Ga0070672_100046830 3300005543 Bacteria 3352
87 Ga0070672_100153205 3300005543 Bacteria 1908
88 Ga0070672_100231428 3300005543 Bacteria 1553
89 Ga0070696_100003597 3300005546 Bacteria 10319
90 Ga0068855_100000065 3300005563 Bacteria 129307
91 Ga0068855_100005948 3300005563 Bacteria 14875
92 Ga0068855_100015197 3300005563 Bacteria 9270
93 Ga0070664_100024067 3300005564 Bacteria 5034
94 Ga0068854_100100315 3300005578 Bacteria 2169
95 Ga0068854_100126436 3300005578 Bacteria 1947
96 Ga0068856_100107829 3300005614 Bacteria 2781
97 Ga0068852_100021759 3300005616 Bacteria 5129
98 Ga0068852_100028333 3300005616 Bacteria 4582
99 Ga0068859_100002750 3300005617 Bacteria 17837
100 Ga0068859_100205172 3300005617 Bacteria 2056
101 Ga0068864_100000758 3300005618 Bacteria 27158
102 Ga0068864_100199308 3300005618 Bacteria 1838
103 Ga0068861_100005840 3300005719 Bacteria 8360
104 Ga0068863_100002927 3300005841 Bacteria 16897
105 Ga0068863_100315211 3300005841 Bacteria 1519
106 Ga0068858_100002564 3300005842 Bacteria 18309
107 Ga0068860_100001303 3300005843 Bacteria 27104
108 Ga0075365_10068318 3300006038 Bacteria 2387
109 Ga0075364_10035858 3300006051 Bacteria 3205
110 Ga0075366_10000553 3300006195 Bacteria 17456
111 Ga0075366_10033366 3300006195 Bacteria 3032
112 Ga0075366_10065133 3300006195 Bacteria 2167
113 Ga0097621_100006649 3300006237 Bacteria 8216
114 Ga0075370_10003313 3300006353 Bacteria 7648
115 Ga0075370_10062443 3300006353 Bacteria 2123
116 Ga0075370_10089373 3300006353 Bacteria 1776
117 Ga0075429_100001804 3300006880 Bacteria 17739
118 Ga0097620_100002750 3300006931 Bacteria 17837
119 Ga0097620_100205185 3300006931 Bacteria 2056
120 Ga0079104_1000252 3300006946 Bacteria 71332
121 Ga0079104_1013466 3300006946 Bacteria 2517
122 Ga0105244_10002725 3300009036 Bacteria 13214
123 Ga0105244_10003271 3300009036 Bacteria 11671
124 Ga0105244_10060741 3300009036 Bacteria 1904
125 Ga0105240_10001127 3300009093 Bacteria 46930
126 Ga0105240_10008631 3300009093 Bacteria 14560
127 Ga0105240_10021557 3300009093 Bacteria 8568
128 Ga0105240_10176843 3300009093 Bacteria 2522
129 Ga0105243_10000970 3300009148 Bacteria 26739
130 Ga0105241_10038237 3300009174 Bacteria 3617
131 Ga0105242_10198623 3300009176 Bacteria 1780
132 Ga0105248_10543857 3300009177 Bacteria 1310
133 Ga0105237_10000045 3300009545 Bacteria 171156
134 Ga0105237_10024607 3300009545 Bacteria 6157
135 Ga0105238_10068539 3300009551 Bacteria 3549
136 Ga0105238_10125895 3300009551 Bacteria 2541
137 Ga0105249_10101094 3300009553 Bacteria 2711
138 Ga0105239_10051413 3300010375 Bacteria 4517
139 Ga0105239_10109837 3300010375 Bacteria 3057
140 Ga0157370_10001801 3300013104 Bacteria 26425
141 Ga0157369_10000499 3300013105 Bacteria 51849
142 Ga0157369_10060326 3300013105 Bacteria 4090
143 Ga0157374_10191144 3300013296 Bacteria 2002
144 Ga0157378_10001723 3300013297 Bacteria 19644
145 Ga0157378_10029766 3300013297 Bacteria 4821
146 Ga0163162_10001695 3300013306 Bacteria 20665
147 Ga0163162_10002613 3300013306 Bacteria 17080
148 Ga0163162_10015896 3300013306 Bacteria 7355
149 Ga0163162_10055825 3300013306 Bacteria 3977
150 Ga0163162_10106129 3300013306 Bacteria 2904
151 Ga0157372_10010791 3300013307 Bacteria 9726
152 Ga0157375_10022368 3300013308 Bacteria 5819
153 Ga0157375_10071046 3300013308 Bacteria 3493
154 Ga0157375_10238854 3300013308 Bacteria 1976
155 Ga0157375_10455459 3300013308 Bacteria 1445
156 Ga0163163_10195298 3300014325 Bacteria 2072
157 Ga0182008_10017982 3300014497 Bacteria 3662
158 Ga0182008_10056288 3300014497 Bacteria 1944
159 Ga0157377_10000206 3300014745 Bacteria 32358
160 Ga0157377_10044082 3300014745 Bacteria 2486
161 Ga0157379_10015979 3300014968 Bacteria 6599
162 Ga0157379_10083827 3300014968 Bacteria 2857
163 Ga0157379_10350928 3300014968 Bacteria 1350
164 Ga0157376_10157266 3300014969 Bacteria 2056
165 Ga0182006_1000619 3300015261 Bacteria 25523
166 Ga0182006_1004496 3300015261 Bacteria 6866
167 Ga0182007_10001487 3300015262 Bacteria 12536
168 Ga0182007_10005597 3300015262 Bacteria 5491
169 Ga0182007_10041142 3300015262 Bacteria 1541
170 Ga0182005_1000020 3300015265 Bacteria 278671
171 Ga0182005_1000307 3300015265 Bacteria 29530
172 Ga0183362_10001 3300015683 Bacteria 2046624
173 Ga0163161_10028579 3300017792 Bacteria 3961
174 Ga0163161_10061753 3300017792 Bacteria 2728
175 Ga0163161_10109882 3300017792 Bacteria 2060
176 Ga0213872_10000002 3300021361 Bacteria 554092
177 Ga0213872_10000196 3300021361 Bacteria 53649
178 Ga0213872_10000245 3300021361 Bacteria 48030
179 Ga0213872_10001039 3300021361 Bacteria 19352
180 Ga0213872_10002223 3300021361 Bacteria 11609
181 Ga0213872_10002318 3300021361 Bacteria 11353
182 Ga0213872_10052686 3300021361 Bacteria 1846
183 Ga0209435_100001 3300025206 Bacteria 1424171
184 Ga0209435_100029 3300025206 Bacteria 176358
185 Ga0209435_100100 3300025206 Bacteria 35665
186 Ga0209760_102646 3300025207 Bacteria 1653
187 Ga0209784_100002 3300025224 Bacteria 1753105
188 Ga0209784_100019 3300025224 Bacteria 453558
189 Ga0209566_100003 3300025225 Bacteria 1753105
190 Ga0209566_100017 3300025225 Bacteria 453558
191 Ga0209674_100004 3300025226 Bacteria 1753105
192 Ga0209674_100031 3300025226 Bacteria 453558
193 Ga0209147_100004 3300025229 Bacteria 1371850
194 Ga0209563_100006 3300025230 Bacteria 1753105
195 Ga0209563_100035 3300025230 Bacteria 453558
196 Ga0207427_100255 3300025231 Bacteria 41856
197 Ga0209437_100038 3300025233 Bacteria 453558
198 Ga0209258_100396 3300025242 Bacteria 54877
199 Ga0207425_1006266 3300025245 Bacteria 3273
200 Ga0207425_1007047 3300025245 Bacteria 3009
201 Ga0209646_1000001 3300025246 Bacteria 3092932
202 Ga0209646_1000028 3300025246 Bacteria 387986
203 Ga0209646_1000073 3300025246 Bacteria 224301
204 Ga0209646_1000109 3300025246 Bacteria 158348
205 Ga0209026_1000003 3300025250 Bacteria 1060571
206 Ga0209026_1000124 3300025250 Bacteria 125673
207 Ga0209026_1004094 3300025250 Bacteria 4494
208 Ga0209677_100003 3300025253 Bacteria 1753105
209 Ga0209677_100020 3300025253 Bacteria 453558
210 Ga0209759_1000001 3300025256 Bacteria 2799452
211 Ga0209759_1000108 3300025256 Bacteria 146393
212 Ga0209759_1000199 3300025256 Bacteria 94643
213 Ga0209233_1000049 3300025261 Bacteria 453558
214 Ga0209565_1000004 3300025263 Bacteria 983150
215 Ga0209565_1000365 3300025263 Bacteria 38942
216 Ga0209455_1000049 3300025272 Bacteria 374414
217 Ga0209673_1000045 3300025273 Bacteria 290531
218 Ga0209675_1006109 3300025291 Bacteria 4904
219 Ga0209676_1009416 3300025292 Bacteria 4217
220 Ga0209025_1003445 3300025294 Bacteria 14972
221 Ga0209025_1015346 3300025294 Bacteria 4628
222 Ga0209564_1000006 3300025295 Bacteria 1100927
223 Ga0209564_1000514 3300025295 Bacteria 63392
224 Ga0209564_1000772 3300025295 Bacteria 44476
225 Ga0209564_1001593 3300025295 Bacteria 22188
226 Ga0209758_1000149 3300025297 Bacteria 163504
227 Ga0209758_1000731 3300025297 Bacteria 48032
228 Ga0209050_1000312 3300025298 Bacteria 98756
229 Ga0209050_1001248 3300025298 Bacteria 29381
230 Ga0209050_1007135 3300025298 Bacteria 6373
231 Ga0209050_1016999 3300025298 Bacteria 2935
232 Ga0209256_1000001 3300025299 Bacteria 2166974
233 Ga0209256_1000071 3300025299 Bacteria 242618
234 Ga0209051_1000016 3300025303 Bacteria 541891
235 Ga0209051_1023432 3300025303 Bacteria 2567
236 Ga0209257_1000012 3300025304 Bacteria 1111138
237 Ga0209257_1000017 3300025304 Bacteria 866287
238 Ga0209257_1000045 3300025304 Bacteria 484429
239 Ga0209257_1000115 3300025304 Bacteria 230858
240 Ga0207655_1005097 3300025728 Bacteria 9076
241 Ga0207655_1005150 3300025728 Bacteria 8998
242 Ga0207680_10002123 3300025903 Bacteria 9278
243 Ga0207645_10004821 3300025907 Bacteria 9910
244 Ga0207645_10011352 3300025907 Bacteria 6086
245 Ga0207645_10029647 3300025907 Bacteria 3526
246 Ga0207643_10096175 3300025908 Bacteria 1732
247 Ga0207684_10003587 3300025910 Bacteria 15107
248 Ga0207707_10003135 3300025912 Bacteria 14682
249 Ga0207695_10000475 3300025913 Bacteria 86957
250 Ga0207695_10009018 3300025913 Bacteria 12401
251 Ga0207695_10125772 3300025913 Bacteria 2526
252 Ga0207671_10047776 3300025914 Bacteria 3167
253 Ga0207660_10004817 3300025917 Bacteria 8780
254 Ga0207649_10153947 3300025920 Bacteria 1586
255 Ga0207652_10069143 3300025921 Bacteria 3065
256 Ga0207694_10041422 3300025924 Bacteria 3549
257 Ga0207659_10010680 3300025926 Bacteria 5774
258 Ga0207644_10005163 3300025931 Bacteria 8528
259 Ga0207690_10001069 3300025932 Bacteria 17533
260 Ga0207706_10001732 3300025933 Bacteria 21456
261 Ga0207709_10000722 3300025935 Bacteria 26492
262 Ga0207691_10071778 3300025940 Bacteria 3124
263 Ga0207711_10019345 3300025941 Bacteria 5670
264 Ga0207711_10044578 3300025941 Bacteria 3787
265 Ga0207711_10397681 3300025941 Bacteria 1280
266 Ga0207661_10004060 3300025944 Bacteria 10222
267 Ga0207679_10136894 3300025945 Bacteria 1973
268 Ga0207667_10000025 3300025949 Bacteria 350159
269 Ga0207667_10031962 3300025949 Bacteria 5677
270 Ga0207667_10040648 3300025949 Bacteria 4952
271 Ga0207651_10000549 3300025960 Bacteria 15732
272 Ga0207651_10023356 3300025960 Bacteria 3802
273 Ga0207712_10100921 3300025961 Bacteria 2145
274 Ga0207668_10035893 3300025972 Bacteria 3306
275 Ga0207658_10000754 3300025986 Bacteria 27858
276 Ga0207658_10002122 3300025986 Bacteria 14738
277 Ga0207677_10002505 3300026023 Bacteria 9628
278 Ga0207703_10013704 3300026035 Bacteria 6319
279 Ga0207678_10032302 3300026067 Bacteria 4561
280 Ga0207708_10049450 3300026075 Bacteria 3201
281 Ga0207702_10122741 3300026078 Bacteria 2327
282 Ga0207641_10011842 3300026088 Bacteria 7157
283 Ga0207641_10038381 3300026088 Bacteria 4004
284 Ga0207648_10000142 3300026089 Bacteria 71593
285 Ga0207648_10002265 3300026089 Bacteria 20825
286 Ga0207648_10008041 3300026089 Bacteria 10277
287 Ga0207648_10079664 3300026089 Bacteria 2858
288 Ga0207676_10001768 3300026095 Bacteria 15832
289 Ga0207676_10167827 3300026095 Bacteria 1909
290 Ga0207674_10070052 3300026116 Bacteria 3526
291 Ga0207675_100000910 3300026118 Bacteria 29549
292 Ga0207683_10023727 3300026121 Bacteria 5277
293 Ga0207698_10046542 3300026142 Bacteria 3277
294 Ga0209281_1000196 3300027111 Bacteria 137908
295 Ga0209281_1006108 3300027111 Bacteria 3196
296 Ga0209974_10010459 3300027876 Bacteria 3130
297 Ga0268265_10187154 3300028380 Bacteria 1784
298 Ga0268264_10002772 3300028381 Bacteria 15287
299 Ga0307517_10003477 3300028786 Bacteria 24480
300 Ga0307515_10000428 3300028794 Bacteria 101247
301 Ga0307515_10105774 3300028794 Bacteria 3346
302 Ga0307515_10108387 3300028794 Bacteria 3272
303 Ga0307512_10078938 3300030522 Bacteria 2381
304 Ga0316182_1425617 3300030745 Bacteria 2040
305 Ga0265328_10007485 3300031239 Bacteria 4549
306 Ga0265331_10022266 3300031250 Bacteria 3234
307 Ga0265327_10000120 3300031251 Bacteria 171108
308 Ga0265327_10000689 3300031251 Bacteria 54050
309 Ga0265327_10025410 3300031251 Bacteria 3453
310 Ga0307513_10000010 3300031456 Bacteria 360812
311 Ga0307513_10000121 3300031456 Bacteria 109551
312 Ga0307513_10335186 3300031456 Bacteria 1265
313 Ga0307509_10000120 3300031507 Bacteria 114238
314 Ga0307509_10010566 3300031507 Bacteria 11292
315 Ga0307509_10013191 3300031507 Bacteria 9806
316 Ga0307509_10172684 3300031507 Bacteria 2038
317 Ga0307508_10000094 3300031616 Bacteria 104107
318 Ga0307514_10020110 3300031649 Bacteria 5454
319 Ga0307514_10089187 3300031649 Bacteria 2254
320 Ga0265314_10051576 3300031711 Bacteria 2865
321 Ga0316578_10002384 3300031728 Bacteria 8217
322 Ga0307516_10002590 3300031730 Bacteria 24022
323 Ga0307516_10020562 3300031730 Bacteria 6816
324 Ga0307516_10161410 3300031730 Bacteria 1991
325 Ga0307516_10208254 3300031730 Bacteria 1671
326 Ga0307416_100217368 3300032002 Bacteria 1829
327 Ga0307416_100335284 3300032002 Bacteria 1522
328 Ga0307416_100394523 3300032002 Bacteria 1419
329 Ga0307411_10039870 3300032005 Bacteria 2975
330 Ga0307411_10244191 3300032005 Bacteria 1408
331 Ga0307510_10018226 3300033180 Bacteria 8266
332 Ga0307510_10020396 3300033180 Bacteria 7746
333 Ga0307510_10062199 3300033180 Bacteria 3817
334 Ga0373950_0004559 3300034818 Bacteria 2033
335 Ga0373959_0010704 3300034820 Bacteria 1608
336 Ga0373960_0001500 3300035121 Bacteria 5188
337 Ga0373961_0032485 3300035241 Bacteria 1464
338 Ga0316574_0055178 3300035398 Bacteria 2483
339 Ga0373931_0000478 3300035691 Bacteria 16299
340 Ga0373937_0506550 3300036401 Bacteria 1147
341 Ga0316584_0065115 3300036712 Unclassified 2730
342 Ga0316584_0125588 3300036712 Bacteria 1916
343 Ga0373925_0027565 3300037068 Bacteria 4157
344 Ga0373925_0129907 3300037068 Bacteria 1963
345 Ga0395900_0006543 3300037418 Bacteria 12134
346 Ga0395900_0012541 3300037418 Bacteria 8671
347 Ga0395900_0017455 3300037418 Bacteria 7327
348 Ga0395900_0044155 3300037418 Bacteria 4593
349 Ga0395900_0044524 3300037418 Bacteria 4572
350 Ga0395898_0002485 3300037466 Bacteria 21682
351 Ga0395898_0021948 3300037466 Bacteria 6466
352 Ga0395898_0062080 3300037466 Bacteria 3630
353 Ga0395898_0165067 3300037466 Bacteria 2118
354 Ga0395898_0328594 3300037466 Bacteria 1458
355 Ga0395905_0001291 3300037471 Bacteria 30780
356 Ga0395905_0049775 3300037471 Bacteria 3927
357 Ga0395905_0075445 3300037471 Bacteria 3160
358 Ga0395905_0291146 3300037471 Bacteria 1519
359 Ga0395901_0003007 3300038443 Bacteria 17001
360 Ga0395901_0020218 3300038443 Bacteria 6815
361 Ga0395901_0088864 3300038443 Bacteria 3232
362 Ga0395901_0176114 3300038443 Bacteria 2244
363 Ga0400490_48285 3300038726 Unclassified 1488
364 Ga0436361_0324341 3300039447 Bacteria 73428
365 Ga0436361_0325909 3300039447 Bacteria 18443
366 Ga0436361_0391022 3300039447 Bacteria 9038
367 Ga0436361_0536051 3300039447 Bacteria 3555
368 Ga0436361_0626985 3300039447 Bacteria 51406
369 Ga0436361_0684212 3300039447 Bacteria 74853
370 Ga0436361_0925876 3300039447 Bacteria 15009
371 Ga0436363_0683349 3300039450 Bacteria 1471
372 Ga0439436_0000271 3300041404 Bacteria 12488
373 Ga0439447_014964 3300041407 Bacteria 2163
374 Ga0439461_0005003 3300041410 Bacteria 2240
375 Ga0439465_0000180 3300041413 Bacteria 16199
376 Ga0439431_0000113 3300041997 Bacteria 13938
377 Ga0439445_0000101 3300042004 Bacteria 14009
378 Ga0439432_009440 3300042006 Bacteria 3401
379 Ga0439449_0000486 3300042007 Bacteria 14892
380 Ga0439452_002555 3300042010 Bacteria 6684
381 Ga0439462_0009984 3300042015 Bacteria 2403
382 Ga0450919_000975 3300042121 Bacteria 3704
383 Ga0439434_0001146 3300042435 Bacteria 7668
384 Ga0439464_0008243 3300042439 Bacteria 2731
385 Ga0450918_000074 3300042531 Bacteria 20766
386 Ga0466969_0020269 3300044656 Bacteria 3445
387 Ga0466972_0000005 3300044658 Bacteria 289640
388 Ga0466972_0000323 3300044658 Bacteria 27151
389 Ga0466972_0005646 3300044658 Bacteria 6276
390 Ga0466977_0000251 3300044666 Bacteria 15079
391 Ga0466965_0011250 3300044683 Bacteria 4190
392 Ga0466966_0005559 3300044684 Bacteria 8285
393 Ga0466966_0006944 3300044684 Bacteria 7498
394 Ga0466964_0006578 3300044706 Bacteria 4335
395 Ga0466964_0007499 3300044706 Bacteria 4083
396 Ga0466968_0002113 3300044735 Bacteria 7230
397 Ga0466970_0009910 3300044765 Bacteria 4824
398 Ga0466959_0019390 3300045049 Bacteria 5002
399 Ga0466959_0038621 3300045049 Bacteria 3528
400 Ga0466967_0239055 3300045976 Bacteria 1732
401 Ga0495617_000006 3300046452 Bacteria 398279
402 Ga0495617_000852 3300046452 Bacteria 14479
403 Ga0495617_001340 3300046452 Bacteria 10931
404 Ga0495627_000005 3300046453 Bacteria 630805
405 Ga0495592_0010851 3300046454 Bacteria 6871
406 Ga0495592_0016149 3300046454 Bacteria 5664
407 Ga0495590_0000052 3300046457 Bacteria 103480
408 Ga0495638_0000066 3300046460 Bacteria 168673
409 Ga0495638_0024865 3300046460 Bacteria 3898
410 Ga0495641_0045268 3300046461 Bacteria 2027
411 Ga0495651_0013281 3300046462 Bacteria 6369
412 Ga0495651_0038851 3300046462 Bacteria 3706
413 Ga0495653_0000011 3300046463 Bacteria 272314
414 Ga0495653_0001619 3300046463 Bacteria 17685
415 Ga0495650_0000352 3300046471 Bacteria 81351
416 Ga0495650_0000773 3300046471 Bacteria 39442
417 Ga0495650_0001907 3300046471 Bacteria 18489
418 Ga0495650_0004408 3300046471 Bacteria 9673
419 Ga0495580_0014737 3300046472 Bacteria 5925
420 Ga0495605_0000003 3300046474 Bacteria 491502
421 Ga0495605_0021292 3300046474 Bacteria 3436
422 Ga0495639_0014582 3300046475 Bacteria 3404
423 Ga0495584_0003531 3300046491 Bacteria 8574
424 Ga0495585_0006322 3300046492 Bacteria 7360
425 Ga0495585_0043062 3300046492 Bacteria 2526
426 Ga0495607_0000177 3300046501 Bacteria 67452
427 Ga0495607_0003723 3300046501 Bacteria 11545
428 Ga0495607_0007312 3300046501 Bacteria 7656
429 Ga0495607_0017937 3300046501 Bacteria 4527
430 Ga0495607_0025953 3300046501 Bacteria 3639
431 Ga0495607_0107676 3300046501 Bacteria 1482
432 Ga0495583_0000056 3300046506 Bacteria 200858
433 Ga0495583_0000320 3300046506 Bacteria 76050
434 Ga0495606_0000024 3300046507 Bacteria 262080
435 Ga0495606_0001440 3300046507 Bacteria 31925
436 Ga0495606_0001995 3300046507 Bacteria 25166
437 Ga0495606_0002197 3300046507 Bacteria 23396
438 Ga0495606_0002956 3300046507 Bacteria 18721
439 Ga0495606_0004256 3300046507 Bacteria 14449
440 Ga0495606_0018994 3300046507 Bacteria 5135
441 Ga0495606_0027849 3300046507 Bacteria 3998
442 Ga0495608_0001471 3300046511 Bacteria 16736
443 Ga0495608_0034191 3300046511 Bacteria 3433
444 Ga0495608_0070057 3300046511 Bacteria 2289
445 Ga0495610_0002290 3300046512 Bacteria 16177
446 Ga0495610_0013441 3300046512 Bacteria 4864
447 Ga0495610_0044003 3300046512 Bacteria 2220
448 Ga0495618_0020035 3300046514 Bacteria 4117
449 Ga0495618_0124132 3300046514 Bacteria 1653
450 Ga0495628_0001674 3300046516 Bacteria 20237
451 Ga0495628_0003473 3300046516 Bacteria 14096
452 Ga0495628_0049345 3300046516 Bacteria 3333
453 Ga0495628_0133082 3300046516 Bacteria 1901
454 Ga0495632_0013311 3300046519 Bacteria 4700
455 Ga0495637_0000537 3300046520 Bacteria 27246
456 Ga0495637_0001788 3300046520 Bacteria 12301
457 Ga0495643_0001115 3300046522 Bacteria 26600
458 Ga0495643_0005028 3300046522 Bacteria 9056
459 Ga0495644_0002336 3300046523 Bacteria 7570
460 Ga0495644_0003135 3300046523 Bacteria 6538
461 Ga0495648_0003350 3300046524 Bacteria 14122
462 Ga0495648_0003511 3300046524 Bacteria 13743
463 Ga0495648_0006065 3300046524 Bacteria 9920
464 Ga0495648_0006696 3300046524 Bacteria 9329
465 Ga0495648_0026972 3300046524 Bacteria 3855
466 Ga0495642_0000708 3300046528 Bacteria 16600
467 Ga0495642_0011407 3300046528 Bacteria 3415
468 Ga0495652_0015550 3300046529 Bacteria 6812
469 Ga0495652_0020026 3300046529 Bacteria 5950
470 Ga0495652_0025365 3300046529 Bacteria 5245
471 Ga0495654_0000004 3300046530 Bacteria 515304
472 Ga0495654_0009485 3300046530 Bacteria 5334
473 Ga0495609_0001896 3300046538 Bacteria 13328
474 Ga0495609_0004176 3300046538 Bacteria 8016
475 Ga0495609_0028551 3300046538 Bacteria 2545
476 Ga0495597_0001233 3300046542 Bacteria 19045
477 Ga0495597_0023206 3300046542 Bacteria 2871
478 Ga0495597_0036890 3300046542 Bacteria 2198
479 Ga0495645_0027513 3300046543 Bacteria 4132
480 Ga0495622_0000658 3300046557 Bacteria 19569
481 Ga0495622_0002912 3300046557 Bacteria 8168
482 Ga0495633_0000230 3300046558 Bacteria 68204
483 Ga0495633_0001406 3300046558 Bacteria 18774
484 Ga0495633_0005224 3300046558 Bacteria 8008
485 Ga0495633_0010766 3300046558 Bacteria 4974
486 Ga0495633_0011084 3300046558 Bacteria 4889
487 Ga0495633_0042514 3300046558 Bacteria 2157
488 Ga0495656_0000075 3300046615 Bacteria 44355
489 Ga0495656_0002866 3300046615 Bacteria 5779
490 Ga0495668_0001363 3300046616 Bacteria 23963
491 Ga0495668_0001523 3300046616 Bacteria 22005
492 Ga0495668_0004803 3300046616 Bacteria 9408
493 Ga0495668_0004853 3300046616 Bacteria 9346
494 Ga0495668_0170515 3300046616 Bacteria 1192
495 Ga0495611_0012522 3300046648 Bacteria 3606
496 Ga0495625_0001266 3300046660 Bacteria 31745
497 Ga0495625_0002652 3300046660 Bacteria 19076
498 Ga0495625_0002694 3300046660 Bacteria 18878
499 Ga0495625_0004914 3300046660 Bacteria 12441
500 Ga0495625_0023096 3300046660 Bacteria 4755
501 Ga0495625_0042214 3300046660 Bacteria 3316
502 Ga0495635_0046468 3300046663 Bacteria 2995
503 Ga0495659_0000032 3300046664 Bacteria 65104
504 Ga0495659_0000563 3300046664 Bacteria 13635
505 Ga0495661_0031403 3300046665 Bacteria 3371
506 Ga0495661_0050839 3300046665 Bacteria 2506
507 Ga0495599_0005226 3300046678 Bacteria 7742
508 Ga0495623_0012368 3300046679 Bacteria 5525
509 Ga0495623_0019066 3300046679 Bacteria 4430
510 Ga0495623_0021275 3300046679 Bacteria 4189
511 Ga0495646_0012420 3300046680 Bacteria 5415
512 Ga0495646_0016153 3300046680 Bacteria 4738
513 Ga0495669_0065725 3300046684 Bacteria 1647
514 Ga0495670_0001909 3300046691 Bacteria 10266
515 Ga0495670_0003680 3300046691 Bacteria 7538
516 Ga0495670_0026582 3300046691 Bacteria 2865
517 Ga0495671_0000001 3300046692 Bacteria 1169494
518 Ga0495671_0001893 3300046692 Bacteria 13433
519 Ga0495671_0093350 3300046692 Bacteria 1472
520 Ga0495649_0004672 3300046694 Bacteria 8899
521 Ga0495600_0004879 3300046809 Bacteria 8058
522 Ga0495660_0001414 3300046810 Bacteria 16450
523 Ga0495660_0003077 3300046810 Bacteria 10402
524 Ga0495660_0006536 3300046810 Bacteria 6889
525 Ga0495660_0011740 3300046810 Bacteria 5080
526 Ga0495660_0014403 3300046810 Bacteria 4576
527 Ga0495660_0026746 3300046810 Bacteria 3268
528 Ga0495660_0070618 3300046810 Bacteria 1853
529 Ga0495604_0004580 3300047317 Bacteria 10953
530 Ga0495636_0017489 3300047318 Bacteria 2870
531 Ga0495636_0021714 3300047318 Bacteria 2593
532 Ga0495672_0000744 3300047320 Bacteria 35683
533 Ga0495672_0000755 3300047320 Bacteria 35389
534 Ga0495683_0001730 3300047323 Bacteria 13805
535 Ga0495683_0017288 3300047323 Bacteria 3740
536 Ga0495687_001135 3300047443 Bacteria 25805
537 Ga0495687_001350 3300047443 Bacteria 22806
538 Ga0495687_007877 3300047443 Bacteria 6195
539 Ga0495677_0003783 3300047445 Bacteria 5851
540 Ga0495677_0026631 3300047445 Bacteria 2097
541 Ga0495679_022404 3300047446 Bacteria 2161
542 Ga0495685_000023 3300047447 Bacteria 68601
543 Ga0495685_062381 3300047447 Bacteria 1255
544 Ga0495673_0000006 3300047469 Bacteria 908691
545 Ga0495673_0000014 3300047469 Bacteria 599202
546 Ga0495673_0000090 3300047469 Bacteria 188187
547 Ga0495673_0015552 3300047469 Bacteria 3917
548 Ga0495686_0015016 3300047472 Bacteria 5308
549 Ga0495686_0018794 3300047472 Bacteria 4628
550 Ga0495602_0024320 3300048088 Bacteria 5878
551 Ga0495602_0033777 3300048088 Bacteria 4794
552 Ga0495615_0002608 3300048090 Bacteria 2913
553 Ga0496100_0012895 3300048903 Bacteria 4805
554 Ga0496101_0001350 3300048904 Bacteria 14712
555 Ga0496102_0025151 3300048905 Bacteria 5296
556 Ga0496102_0103628 3300048905 Bacteria 2646
557 Ga0496103_0077759 3300048906 Bacteria 2083
558 Ga0496103_0171378 3300048906 Bacteria 1394
559 Ga0496104_0021258 3300048907 Bacteria 5954
560 Ga0496104_0373547 3300048907 Bacteria 1338
561 Ga0496105_0003513 3300048908 Bacteria 11613
562 Ga0496106_0121468 3300048909 Bacteria 2042
563 Ga0496108_0105048 3300048911 Bacteria 2411
564 Ga0496108_0172974 3300048911 Bacteria 1869
565 Ga0496109_0035546 3300048912 Bacteria 4496
566 Ga0496111_0018203 3300048914 Bacteria 4864
567 Ga0496112_0225721 3300048915 Bacteria 1828
568 Ga0496114_0086879 3300048917 Bacteria 2651
569 Ga0496114_0181516 3300048917 Bacteria 1838
570 Ga0496116_0003419 3300048919 Bacteria 15693
571 Ga0496116_0024659 3300048919 Bacteria 4441
572 Ga0496116_0031146 3300048919 Bacteria 3824
573 Ga0496121_0008910 3300048924 Bacteria 11651
574 Ga0496122_0000472 3300048925 Bacteria 83803
575 Ga0496122_0030668 3300048925 Bacteria 4498
576 Ga0496123_0000361 3300048926 Bacteria 85609
577 Ga0496123_0004632 3300048926 Bacteria 14287
578 Ga0496124_0065554 3300048927 Bacteria 3028
579 Ga0496124_0121231 3300048927 Bacteria 2089
580 Ga0496125_0000717 3300048928 Bacteria 54887
581 Ga0496125_0006462 3300048928 Bacteria 12667
582 Ga0496125_0028847 3300048928 Bacteria 5000
583 Ga0496126_0074291 3300048929 Bacteria 3020
584 Ga0495678_000016 3300049459 Bacteria 303426
585 Ga0495678_000096 3300049459 Bacteria 109474
586 Ga0495678_004440 3300049459 Bacteria 8106
587 Ga0495682_0001281 3300049460 Bacteria 14052
588 Ga0495682_0002033 3300049460 Bacteria 9935
589 Ga0501034_0404693 3300049571 Bacteria 1287
590 Ga0501040_0006336 3300049576 Bacteria 7684
591 Ga0501042_0000875 3300049578 Bacteria 16835
592 Ga0501043_0000097 3300049579 Bacteria 79736
593 Ga0501046_0000047 3300049580 Bacteria 140344
594 Ga0501046_0025002 3300049580 Bacteria 4892
595 Ga0501047_0000058 3300049581 Bacteria 139202
596 Ga0501048_0015359 3300049582 Bacteria 5654
597 Ga0501080_0249830 3300049742 Bacteria 1617
598 Ga0501044_0192356 3300049823 Bacteria 2002
599 Ga0501044_0288112 3300049823 Bacteria 1574
600 Ga0501045_0011193 3300049824 Bacteria 6291
601 nmdc:mga03683_31632_c1 3300050489 Bacteria 2124
602 nmdc:mga00v17_44089_c1 3300050491 Bacteria 2688
603 nmdc:mga0yw44_59055_c1 3300050492 Bacteria 2345
604 nmdc:mga0k408_114237_c1 3300050493 Bacteria 1597
605 nmdc:mga0k408_160762_c1 3300050493 Bacteria 1338
606 nmdc:mga0k408_380_c1 3300050493 Bacteria 3795
607 nmdc:mga0k408_8396_c1 3300050493 Bacteria 5541
608 nmdc:mga07m45_1006_c1 3300050496 Bacteria 12461
609 nmdc:mga07m45_14148_c1 3300050496 Bacteria 4244
610 nmdc:mga07m45_15030_c1 3300050496 Bacteria 4134
611 nmdc:mga07m45_59968_c1 3300050496 Bacteria 2153
612 nmdc:mga09592_19951_c1 3300050508 Bacteria 5506
613 nmdc:mga0rr50_275708_c1 3300050513 Bacteria 1402
614 Ga0495601_0025697 3300053077 Bacteria 3633
615 Ga0495601_0041847 3300053077 Bacteria 2873
616 Ga0500578_0001591 3300053086 Bacteria 22016
617 Ga0500578_0070517 3300053086 Bacteria 2228
618 Ga0500594_0003750 3300053118 Bacteria 3347
619 Ga0500595_001402 3300053119 Bacteria 12939
620 Ga0500618_000275 3300053125 Bacteria 39513
621 Ga0500618_001021 3300053125 Bacteria 14018
622 Ga0500618_010431 3300053125 Bacteria 2493
623 Ga0500658_0002746 3300053134 Bacteria 6770
624 Ga0500559_0001885 3300053136 Bacteria 11382
625 Ga0500559_0007805 3300053136 Bacteria 4726
626 Ga0500573_0131774 3300053140 Bacteria 1384
627 Ga0500574_030194 3300053141 Bacteria 1451
628 Ga0500586_000892 3300053145 Bacteria 6149
629 Ga0500619_000212 3300053154 Bacteria 13317
630 Ga0500622_0004245 3300053156 Bacteria 9115
631 Ga0500622_0050455 3300053156 Bacteria 2144
632 Ga0500645_000340 3300053730 Bacteria 33322
633 Ga0500645_004312 3300053730 Bacteria 5480
634 Ga0500587_001066 3300053739 Bacteria 3747
635 Ga0590071_001461 3300059421 Bacteria 6237
636 2511245820 2511231002 Bacteria 5042903
637 2511249440 2511231003 Bacteria 5606035
638 2511387865 2511231026 Bacteria 5225445
639 2521557844 2521172590 Bacteria 5047645
640 2550695552 2548876994 Bacteria 4904866
641 2553002963 2551306416 Bacteria 6152985
642 2555230294 2554235227 Bacteria 3637389
643 2643933629 2643221585 Bacteria 5812563
644 2644030656 2643221603 Bacteria 6147767
645 2644222006 2643221639 Bacteria 6649903
646 2644244314 2643221644 Bacteria 6865017
647 2644253907 2643221645 Bacteria 7207331
648 2644304817 2643221654 Bacteria 5273570
649 2644315129 2643221656 Bacteria 5809961
650 2644356688 2643221664 Bacteria 7272945
651 2655031310 2654587600 Bacteria 3911798
652 2723876558 2721755763 Bacteria 4464185
653 2738742123 2738541280 Bacteria 6630198
654 2738825082 2738541297 Bacteria 6549566
655 2738844577 2738541300 Bacteria 6675882
656 2739055233 2738541337 Bacteria 6183410
657 2739148879 2738541357 Bacteria 6549408
658 2739190798 2738543003 Bacteria 6549560
659 2739276087 2738543018 Bacteria 6718814
660 2739317275 2738543026 Bacteria 6549408
661 2739335516 2738543029 Bacteria 6549249
662 2739345389 2738543030 Bacteria 6719714
663 2808984524 2808606386 Bacteria 4471946
664 2809128145 2808606415 Bacteria 4576710
665 2809151882 2808606419 Bacteria 4576925
666 2819542555 2818991436 Bacteria 5376622
667 2819593390 2818991445 Bacteria 4955017
668 2819615014 2818991449 Bacteria 5518009
669 2821133682 2821131069 Bacteria 6108407
670 2837187476 2837183177 Bacteria 4637169
671 2842717256 2842711865 Bacteria 7155354
672 2852619902 2852618963 Bacteria 4577824
673 2857553793 2857553236 Bacteria 6166726
674 2857560420 2857558681 Bacteria 6617694
675 2857565476 2857564685 Bacteria 6290584
676 2881101706 2881101125 Bacteria 4590519
677 2884814010 2884811622 Bacteria 5552861
678 2884839918 2884836552 Bacteria 5219991
679 2884857314 2884852848 Bacteria 5221161
680 2885192350 2885192300 Bacteria 5882526
681 2896157901 2896154374 Bacteria 5221518
682 2904430530 2904424332 Bacteria 7633521
683 2904441395 2904439833 Bacteria 5931679
684 2904531668 2904530477 Bacteria 5876334
685 2904586692 2904584206 Bacteria 6028872
686 2904593275 2904589729 Bacteria 6113573
687 2904602881 2904601388 Bacteria 5884906
688 2919046308 2919046199 Bacteria 5567169
689 2919079615 2919079590 Bacteria 5946433
690 2919480417 2919476304 Bacteria 5888696
691 2923511062 2923510766 Bacteria 5926163
692 2928131014 2928130867 Bacteria 5467269
693 2954768340 2954767861 Bacteria 5535784
694 Ga0316576_10051463
695 JGI25155J39150_1000049
696 JGI25155J39150_1000174
697 JGI25156J39149_1000023
698 JGI25156J39149_1000168
699 JGI25154J39366_1000036
700 JGI25154J39366_1000185
701 JGI25154J39366_1000239
702 JGI25154J39366_1005780
703 JGI25157J39369_1000023
704 JGI25157J39369_1000429
705 JGI25159J45721_1001259
706 JGI25151J46595_10033349
707 JGI25165J46597_1000022
708 JGI25153J46596_10009345
709 rootL2_10002393
710 rootL2_10035151
711 rootH1_10003102
712 JGI25160J50197_1000260
713 JGI25161J50226_1000015
714 Ga0055538_1000002
715 Ga0055538_1000011
716 Ga0055539_1000002
717 Ga0055539_1000016
718 Ga0055533_1000004
719 Ga0055533_1000019
720 Ga0055532_1000050
721 Ga0055525_1000002
722 Ga0055525_1000042
723 Ga0055529_1000154
724 Ga0055526_1000166
725 Ga0055526_1001297
726 Ga0055526_1003006
727 Ga0055526_1004954
728 Ga0055537_1000135
729 Ga0055524_1000016
730 Ga0055524_1000094
731 Ga0055534_1006054
732 Ga0055528_1001624
733 Ga0055528_1002120
734 Ga0055530_10003682
735 Ga0055540_1000004
736 Ga0055531_10000011
737 Ga0055531_10033161
738 Ga0055541_1000002
739 Ga0055541_1000017
740 Ga0055541_1000043
741 Ga0055543_1000634
742 Ga0065707_10091325
743 Ga0070676_10038754
744 Ga0070683_100015504
745 Ga0070683_100042472
746 Ga0070683_100123716
747 Ga0070690_100008898
748 Ga0070677_10038511
749 Ga0068869_100006980
750 Ga0070666_10002851
751 Ga0068868_100008007
752 Ga0070660_100049748
753 Ga0070660_100121905
754 Ga0070661_100001791
755 Ga0070661_100033553
756 Ga0070669_100050989
757 Ga0070669_100109499
758 Ga0070675_100015977
759 Ga0070671_100005541
760 Ga0070673_100003452
761 Ga0070673_100046418
762 Ga0070659_100001056
763 Ga0070659_100334610
764 Ga0070667_100000729
765 Ga0070667_100005018
766 Ga0070663_100001214
767 Ga0070662_100003372
768 Ga0070681_10002456
769 Ga0068867_100002085
770 Ga0068867_100002621
771 Ga0068867_100047485
772 Ga0068867_100185450
773 Ga0070706_100000212
774 Ga0070699_100007930
775 Ga0070679_100003476
776 Ga0070684_100007991
777 Ga0070684_100009951
778 Ga0070672_100046830
779 Ga0070672_100153205
780 Ga0070672_100231428
781 Ga0070696_100003597
782 Ga0068855_100000065
783 Ga0068855_100005948
784 Ga0068855_100015197
785 Ga0070664_100024067
786 Ga0068854_100100315
787 Ga0068854_100126436
788 Ga0068856_100107829
789 Ga0068852_100021759
790 Ga0068852_100028333
791 Ga0068859_100002750
792 Ga0068859_100205172
793 Ga0068864_100000758
794 Ga0068864_100199308
795 Ga0068861_100005840
796 Ga0068863_100002927
797 Ga0068863_100315211
798 Ga0068858_100002564
799 Ga0068860_100001303
800 Ga0075365_10068318
801 Ga0075364_10035858
802 Ga0075366_10000553
803 Ga0075366_10033366
804 Ga0075366_10065133
805 Ga0097621_100006649
806 Ga0075370_10003313
807 Ga0075370_10062443
808 Ga0075370_10089373
809 Ga0075429_100001804
810 Ga0097620_100002750
811 Ga0097620_100205185
812 Ga0079104_1000252
813 Ga0079104_1013466
814 Ga0105244_10002725
815 Ga0105244_10003271
816 Ga0105244_10060741
817 Ga0105240_10001127
818 Ga0105240_10008631
819 Ga0105240_10021557
820 Ga0105240_10176843
821 Ga0105243_10000970
822 Ga0105241_10038237
823 Ga0105242_10198623
824 Ga0105248_10543857
825 Ga0105237_10000045
826 Ga0105237_10024607
827 Ga0105238_10068539
828 Ga0105238_10125895
829 Ga0105249_10101094
830 Ga0105239_10051413
831 Ga0105239_10109837
832 Ga0157370_10001801
833 Ga0157369_10000499
834 Ga0157369_10060326
835 Ga0157374_10191144
836 Ga0157378_10001723
837 Ga0157378_10029766
838 Ga0163162_10001695
839 Ga0163162_10002613
840 Ga0163162_10015896
841 Ga0163162_10055825
842 Ga0163162_10106129
843 Ga0157372_10010791
844 Ga0157375_10022368
845 Ga0157375_10071046
846 Ga0157375_10238854
847 Ga0157375_10455459
848 Ga0163163_10195298
849 Ga0182008_10017982
850 Ga0182008_10056288
851 Ga0157377_10000206
852 Ga0157377_10044082
853 Ga0157379_10015979
854 Ga0157379_10083827
855 Ga0157379_10350928
856 Ga0157376_10157266
857 Ga0182006_1000619
858 Ga0182006_1004496
859 Ga0182007_10001487
860 Ga0182007_10005597
861 Ga0182007_10041142
862 Ga0182005_1000020
863 Ga0182005_1000307
864 Ga0183362_10001
865 Ga0163161_10028579
866 Ga0163161_10061753
867 Ga0163161_10109882
868 Ga0213872_10000002
869 Ga0213872_10000196
870 Ga0213872_10000245
871 Ga0213872_10001039
872 Ga0213872_10002223
873 Ga0213872_10002318
874 Ga0213872_10052686
875 Ga0209435_100001
876 Ga0209435_100029
877 Ga0209435_100100
878 Ga0209760_102646
879 Ga0209784_100002
880 Ga0209784_100019
881 Ga0209566_100003
882 Ga0209566_100017
883 Ga0209674_100004
884 Ga0209674_100031
885 Ga0209147_100004
886 Ga0209563_100006
887 Ga0209563_100035
888 Ga0207427_100255
889 Ga0209437_100038
890 Ga0209258_100396
891 Ga0207425_1006266
892 Ga0207425_1007047
893 Ga0209646_1000001
894 Ga0209646_1000028
895 Ga0209646_1000073
896 Ga0209646_1000109
897 Ga0209026_1000003
898 Ga0209026_1000124
899 Ga0209026_1004094
900 Ga0209677_100003
901 Ga0209677_100020
902 Ga0209759_1000001
903 Ga0209759_1000108
904 Ga0209759_1000199
905 Ga0209233_1000049
906 Ga0209565_1000004
907 Ga0209565_1000365
908 Ga0209455_1000049
909 Ga0209673_1000045
910 Ga0209675_1006109
911 Ga0209676_1009416
912 Ga0209025_1003445
913 Ga0209025_1015346
914 Ga0209564_1000006
915 Ga0209564_1000514
916 Ga0209564_1000772
917 Ga0209564_1001593
918 Ga0209758_1000149
919 Ga0209758_1000731
920 Ga0209050_1000312
921 Ga0209050_1001248
922 Ga0209050_1007135
923 Ga0209050_1016999
924 Ga0209256_1000001
925 Ga0209256_1000071
926 Ga0209051_1000016
927 Ga0209051_1023432
928 Ga0209257_1000012
929 Ga0209257_1000017
930 Ga0209257_1000045
931 Ga0209257_1000115
932 Ga0207655_1005097
933 Ga0207655_1005150
934 Ga0207680_10002123
935 Ga0207645_10004821
936 Ga0207645_10011352
937 Ga0207645_10029647
938 Ga0207643_10096175
939 Ga0207684_10003587
940 Ga0207707_10003135
941 Ga0207695_10000475
942 Ga0207695_10009018
943 Ga0207695_10125772
944 Ga0207671_10047776
945 Ga0207660_10004817
946 Ga0207649_10153947
947 Ga0207652_10069143
948 Ga0207694_10041422
949 Ga0207659_10010680
950 Ga0207644_10005163
951 Ga0207690_10001069
952 Ga0207706_10001732
953 Ga0207709_10000722
954 Ga0207691_10071778
955 Ga0207711_10019345
956 Ga0207711_10044578
957 Ga0207711_10397681
958 Ga0207661_10004060
959 Ga0207679_10136894
960 Ga0207667_10000025
961 Ga0207667_10031962
962 Ga0207667_10040648
963 Ga0207651_10000549
964 Ga0207651_10023356
965 Ga0207712_10100921
966 Ga0207668_10035893
967 Ga0207658_10000754
968 Ga0207658_10002122
969 Ga0207677_10002505
970 Ga0207703_10013704
971 Ga0207678_10032302
972 Ga0207708_10049450
973 Ga0207702_10122741
974 Ga0207641_10011842
975 Ga0207641_10038381
976 Ga0207648_10000142
977 Ga0207648_10002265
978 Ga0207648_10008041
979 Ga0207648_10079664
980 Ga0207676_10001768
981 Ga0207676_10167827
982 Ga0207674_10070052
983 Ga0207675_100000910
984 Ga0207683_10023727
985 Ga0207698_10046542
986 Ga0209281_1000196
987 Ga0209281_1006108
988 Ga0209974_10010459
989 Ga0268265_10187154
990 Ga0268264_10002772
991 Ga0307517_10003477
992 Ga0307515_10000428
993 Ga0307515_10105774
994 Ga0307515_10108387
995 Ga0307512_10078938
996 Ga0316182_1425617
997 Ga0265328_10007485
998 Ga0265331_10022266
999 Ga0265327_10000120
1000 Ga0265327_10000689
1001 Ga0265327_10025410
1002 Ga0307513_10000010
1003 Ga0307513_10000121
1004 Ga0307513_10335186
1005 Ga0307509_10000120
1006 Ga0307509_10010566
1007 Ga0307509_10013191
1008 Ga0307509_10172684
1009 Ga0307508_10000094
1010 Ga0307514_10020110
1011 Ga0307514_10089187
1012 Ga0265314_10051576
1013 Ga0316578_10002384
1014 Ga0307516_10002590
1015 Ga0307516_10020562
1016 Ga0307516_10161410
1017 Ga0307516_10208254
1018 Ga0307416_100217368
1019 Ga0307416_100335284
1020 Ga0307416_100394523
1021 Ga0307411_10039870
1022 Ga0307411_10244191
1023 Ga0307510_10018226
1024 Ga0307510_10020396
1025 Ga0307510_10062199
1026 Ga0373950_0004559
1027 Ga0373959_0010704
1028 Ga0373960_0001500
1029 Ga0373961_0032485
1030 Ga0316574_0055178
1031 Ga0373931_0000478
1032 Ga0373937_0506550
1033 Ga0316584_0065115
1034 Ga0316584_0125588
1035 Ga0373925_0027565
1036 Ga0373925_0129907
1037 Ga0395900_0006543
1038 Ga0395900_0012541
1039 Ga0395900_0017455
1040 Ga0395900_0044155
1041 Ga0395900_0044524
1042 Ga0395898_0002485
1043 Ga0395898_0021948
1044 Ga0395898_0062080
1045 Ga0395898_0165067
1046 Ga0395898_0328594
1047 Ga0395905_0001291
1048 Ga0395905_0049775
1049 Ga0395905_0075445
1050 Ga0395905_0291146
1051 Ga0395901_0003007
1052 Ga0395901_0020218
1053 Ga0395901_0088864
1054 Ga0395901_0176114
1055 Ga0400490_48285
1056 Ga0436361_0324341
1057 Ga0436361_0325909
1058 Ga0436361_0391022
1059 Ga0436361_0536051
1060 Ga0436361_0626985
1061 Ga0436361_0684212
1062 Ga0436361_0925876
1063 Ga0436363_0683349
1064 Ga0439436_0000271
1065 Ga0439447_014964
1066 Ga0439461_0005003
1067 Ga0439465_0000180
1068 Ga0439431_0000113
1069 Ga0439445_0000101
1070 Ga0439432_009440
1071 Ga0439449_0000486
1072 Ga0439452_002555
1073 Ga0439462_0009984
1074 Ga0450919_000975
1075 Ga0439434_0001146
1076 Ga0439464_0008243
1077 Ga0450918_000074
1078 Ga0466969_0020269
1079 Ga0466972_0000005
1080 Ga0466972_0000323
1081 Ga0466972_0005646
1082 Ga0466977_0000251
1083 Ga0466965_0011250
1084 Ga0466966_0005559
1085 Ga0466966_0006944
1086 Ga0466964_0006578
1087 Ga0466964_0007499
1088 Ga0466968_0002113
1089 Ga0466970_0009910
1090 Ga0466959_0019390
1091 Ga0466959_0038621
1092 Ga0466967_0239055
1093 Ga0495617_000006
1094 Ga0495617_000852
1095 Ga0495617_001340
1096 Ga0495627_000005
1097 Ga0495592_0010851
1098 Ga0495592_0016149
1099 Ga0495590_0000052
1100 Ga0495638_0000066
1101 Ga0495638_0024865
1102 Ga0495641_0045268
1103 Ga0495651_0013281
1104 Ga0495651_0038851
1105 Ga0495653_0000011
1106 Ga0495653_0001619
1107 Ga0495650_0000352
1108 Ga0495650_0000773
1109 Ga0495650_0001907
1110 Ga0495650_0004408
1111 Ga0495580_0014737
1112 Ga0495605_0000003
1113 Ga0495605_0021292
1114 Ga0495639_0014582
1115 Ga0495584_0003531
1116 Ga0495585_0006322
1117 Ga0495585_0043062
1118 Ga0495607_0000177
1119 Ga0495607_0003723
1120 Ga0495607_0007312
1121 Ga0495607_0017937
1122 Ga0495607_0025953
1123 Ga0495607_0107676
1124 Ga0495583_0000056
1125 Ga0495583_0000320
1126 Ga0495606_0000024
1127 Ga0495606_0001440
1128 Ga0495606_0001995
1129 Ga0495606_0002197
1130 Ga0495606_0002956
1131 Ga0495606_0004256
1132 Ga0495606_0018994
1133 Ga0495606_0027849
1134 Ga0495608_0001471
1135 Ga0495608_0034191
1136 Ga0495608_0070057
1137 Ga0495610_0002290
1138 Ga0495610_0013441
1139 Ga0495610_0044003
1140 Ga0495618_0020035
1141 Ga0495618_0124132
1142 Ga0495628_0001674
1143 Ga0495628_0003473
1144 Ga0495628_0049345
1145 Ga0495628_0133082
1146 Ga0495632_0013311
1147 Ga0495637_0000537
1148 Ga0495637_0001788
1149 Ga0495643_0001115
1150 Ga0495643_0005028
1151 Ga0495644_0002336
1152 Ga0495644_0003135
1153 Ga0495648_0003350
1154 Ga0495648_0003511
1155 Ga0495648_0006065
1156 Ga0495648_0006696
1157 Ga0495648_0026972
1158 Ga0495642_0000708
1159 Ga0495642_0011407
1160 Ga0495652_0015550
1161 Ga0495652_0020026
1162 Ga0495652_0025365
1163 Ga0495654_0000004
1164 Ga0495654_0009485
1165 Ga0495609_0001896
1166 Ga0495609_0004176
1167 Ga0495609_0028551
1168 Ga0495597_0001233
1169 Ga0495597_0023206
1170 Ga0495597_0036890
1171 Ga0495645_0027513
1172 Ga0495622_0000658
1173 Ga0495622_0002912
1174 Ga0495633_0000230
1175 Ga0495633_0001406
1176 Ga0495633_0005224
1177 Ga0495633_0010766
1178 Ga0495633_0011084
1179 Ga0495633_0042514
1180 Ga0495656_0000075
1181 Ga0495656_0002866
1182 Ga0495668_0001363
1183 Ga0495668_0001523
1184 Ga0495668_0004803
1185 Ga0495668_0004853
1186 Ga0495668_0170515
1187 Ga0495611_0012522
1188 Ga0495625_0001266
1189 Ga0495625_0002652
1190 Ga0495625_0002694
1191 Ga0495625_0004914
1192 Ga0495625_0023096
1193 Ga0495625_0042214
1194 Ga0495635_0046468
1195 Ga0495659_0000032
1196 Ga0495659_0000563
1197 Ga0495661_0031403
1198 Ga0495661_0050839
1199 Ga0495599_0005226
1200 Ga0495623_0012368
1201 Ga0495623_0019066
1202 Ga0495623_0021275
1203 Ga0495646_0012420
1204 Ga0495646_0016153
1205 Ga0495669_0065725
1206 Ga0495670_0001909
1207 Ga0495670_0003680
1208 Ga0495670_0026582
1209 Ga0495671_0000001
1210 Ga0495671_0001893
1211 Ga0495671_0093350
1212 Ga0495649_0004672
1213 Ga0495600_0004879
1214 Ga0495660_0001414
1215 Ga0495660_0003077
1216 Ga0495660_0006536
1217 Ga0495660_0011740
1218 Ga0495660_0014403
1219 Ga0495660_0026746
1220 Ga0495660_0070618
1221 Ga0495604_0004580
1222 Ga0495636_0017489
1223 Ga0495636_0021714
1224 Ga0495672_0000744
1225 Ga0495672_0000755
1226 Ga0495683_0001730
1227 Ga0495683_0017288
1228 Ga0495687_001135
1229 Ga0495687_001350
1230 Ga0495687_007877
1231 Ga0495677_0003783
1232 Ga0495677_0026631
1233 Ga0495679_022404
1234 Ga0495685_000023
1235 Ga0495685_062381
1236 Ga0495673_0000006
1237 Ga0495673_0000014
1238 Ga0495673_0000090
1239 Ga0495673_0015552
1240 Ga0495686_0015016
1241 Ga0495686_0018794
1242 Ga0495602_0024320
1243 Ga0495602_0033777
1244 Ga0495615_0002608
1245 Ga0496100_0012895
1246 Ga0496101_0001350
1247 Ga0496102_0025151
1248 Ga0496102_0103628
1249 Ga0496103_0077759
1250 Ga0496103_0171378
1251 Ga0496104_0021258
1252 Ga0496104_0373547
1253 Ga0496105_0003513
1254 Ga0496106_0121468
1255 Ga0496108_0105048
1256 Ga0496108_0172974
1257 Ga0496109_0035546
1258 Ga0496111_0018203
1259 Ga0496112_0225721
1260 Ga0496114_0086879
1261 Ga0496114_0181516
1262 Ga0496116_0003419
1263 Ga0496116_0024659
1264 Ga0496116_0031146
1265 Ga0496121_0008910
1266 Ga0496122_0000472
1267 Ga0496122_0030668
1268 Ga0496123_0000361
1269 Ga0496123_0004632
1270 Ga0496124_0065554
1271 Ga0496124_0121231
1272 Ga0496125_0000717
1273 Ga0496125_0006462
1274 Ga0496125_0028847
1275 Ga0496126_0074291
1276 Ga0495678_000016
1277 Ga0495678_000096
1278 Ga0495678_004440
1279 Ga0495682_0001281
1280 Ga0495682_0002033
1281 Ga0501034_0404693
1282 Ga0501040_0006336
1283 Ga0501042_0000875
1284 Ga0501043_0000097
1285 Ga0501046_0000047
1286 Ga0501046_0025002
1287 Ga0501047_0000058
1288 Ga0501048_0015359
1289 Ga0501080_0249830
1290 Ga0501044_0192356
1291 Ga0501044_0288112
1292 Ga0501045_0011193
1293 nmdc:mga03683_31632_c1
1294 nmdc:mga00v17_44089_c1
1295 nmdc:mga0yw44_59055_c1
1296 nmdc:mga0k408_114237_c1
1297 nmdc:mga0k408_160762_c1
1298 nmdc:mga0k408_380_c1
1299 nmdc:mga0k408_8396_c1
1300 nmdc:mga07m45_1006_c1
1301 nmdc:mga07m45_14148_c1
1302 nmdc:mga07m45_15030_c1
1303 nmdc:mga07m45_59968_c1
1304 nmdc:mga09592_19951_c1
1305 nmdc:mga0rr50_275708_c1
1306 Ga0495601_0025697
1307 Ga0495601_0041847
1308 Ga0500578_0001591
1309 Ga0500578_0070517
1310 Ga0500594_0003750
1311 Ga0500595_001402
1312 Ga0500618_000275
1313 Ga0500618_001021
1314 Ga0500618_010431
1315 Ga0500658_0002746
1316 Ga0500559_0001885
1317 Ga0500559_0007805
1318 Ga0500573_0131774
1319 Ga0500574_030194
1320 Ga0500586_000892
1321 Ga0500619_000212
1322 Ga0500622_0004245
1323 Ga0500622_0050455
1324 Ga0500645_000340
1325 Ga0500645_004312
1326 Ga0500587_001066
1327 Ga0590071_001461
1328 2511245820
1329 2511249440
1330 2511387865
1331 2521557844
1332 2550695552
1333 2553002963
1334 2555230294
1335 2643933629
1336 2644030656
1337 2644222006
1338 2644244314
1339 2644253907
1340 2644304817
1341 2644315129
1342 2644356688
1343 2655031310
1344 2723876558
1345 2738742123
1346 2738825082
1347 2738844577
1348 2739055233
1349 2739148879
1350 2739190798
1351 2739276087
1352 2739317275
1353 2739335516
1354 2739345389
1355 2808984524
1356 2809128145
1357 2809151882
1358 2819542555
1359 2819593390
1360 2819615014
1361 2821133682
1362 2837187476
1363 2842717256
1364 2852619902
1365 2857553793
1366 2857560420
1367 2857565476
1368 2881101706
1369 2884814010
1370 2884839918
1371 2884857314
1372 2885192350
1373 2896157901
1374 2904430530
1375 2904441395
1376 2904531668
1377 2904586692
1378 2904593275
1379 2904602881
1380 2919046308
1381 2919079615
1382 2919480417
1383 2923511062
1384 2928131014
1385 2954768340

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

16

189

0.97

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

194

322

0.97

PF13353

Fer4_12

4Fe-4S single cluster domain

14

139

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9511 32 354
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.947 33 354
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9257 32 354
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9217 33 354
6b4c-assembly4.cif.gz_D structure of viperin from trichoderma virens 0.8164 38 227
ID Description Score Start End Superfamily
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9511 32 354 3.20.20.70
af_P9WJS3_16_359_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9337 32 364 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9257 32 354 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9158 31 376 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9078 31 376 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2N0KGT5-F1-model_v4 Cyclic pyranopterin phosphate synthase MoaA 0.9803 60 333 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A3B9VX85-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9781 30 353 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-X1CHU4-F1-model_v4 Molybdenum cofactor biosynthesis protein A-like twitch domain-containing protein 0.974 156 283 GO:0006777
GO:0051539
GO:0061798
GO:0061799
AF-A0A7W1BPM9-F1-model_v4 GTP 3',8-cyclase (EC 4.1.99.22) 0.9736 32 321 GO:0005525
GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A382M3B8-F1-model_v4 Radical SAM core domain-containing protein 0.9715 32 281 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799

Map