F475588
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 402 | 1385 | 369 |
Family's Representative Sequence
| Representative Sequence | 3300031727|Ga0316576_10051463|Ga0316576_100514633 |
| Length | 341 |
| Sequence | LTLNDSFNRPLRDLRISVTDLCNFRCPYCMPKEVFGSEHRFLPKSELLKFEEITRLASIFIGFGVRKIRLTGGEPLIRHQVEVLVSMLRALSNVNGQHKGIEIAMTTNGSLLAEKALTLKEAGLDRLTISLDSIDDATFRRMNDVNFPLEKVLESVKAAEAAGFETLKFNTVVKRGWNDHQILDLATHFRGTKHILRFIEYMDVGTTNGWRLDQIVPAKEIIETIHAKYPLVPVSSNYRGEVARRWHYQDGSGEIGVIASVTQPFCGDCSRARLSATGQLYTCLFATNGQDLRAMLRSGASDDQIRAQIHSVWRERNDHYSEIRSANTSDLQKIEMSYIGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 176 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 182 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 183 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 190 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 204 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 207 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 208 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 209 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 212 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 213 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 214 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 215 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 216 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 217 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 220 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 221 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 222 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 307 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 308 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 309 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 332 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 334 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 338 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 339 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 340 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 344 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 345 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 346 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 347 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 348 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 349 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 350 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 351 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 352 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 353 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 354 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 355 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 356 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 357 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 358 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 359 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 360 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 361 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 362 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 363 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 364 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 365 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 366 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 367 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 368 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 369 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 370 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 371 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 372 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 373 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 374 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 375 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 376 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 377 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 378 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 379 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 380 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 381 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 382 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 383 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 384 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 385 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 386 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 387 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 388 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 389 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 390 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 391 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 392 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 393 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 394 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 395 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 396 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 397 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 398 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 399 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 400 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 401 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 402 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.62 |
| Metatranscriptomes | 0 |
| Isolates | 8.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.76 |
| Nodule | 0.87 |
| Rhizoplane | 2.46 |
| Rhizosphere | 64.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316576_10051463 | 3300031727 | Bacteria | 2998 |
| 2 | JGI25155J39150_1000049 | 3300002704 | Bacteria | 78961 |
| 3 | JGI25155J39150_1000174 | 3300002704 | Bacteria | 28283 |
| 4 | JGI25156J39149_1000023 | 3300002705 | Bacteria | 146831 |
| 5 | JGI25156J39149_1000168 | 3300002705 | Bacteria | 47907 |
| 6 | JGI25154J39366_1000036 | 3300002738 | Bacteria | 161697 |
| 7 | JGI25154J39366_1000185 | 3300002738 | Bacteria | 47907 |
| 8 | JGI25154J39366_1000239 | 3300002738 | Bacteria | 36143 |
| 9 | JGI25154J39366_1005780 | 3300002738 | Bacteria | 1912 |
| 10 | JGI25157J39369_1000023 | 3300002741 | Bacteria | 161697 |
| 11 | JGI25157J39369_1000429 | 3300002741 | Bacteria | 27371 |
| 12 | JGI25159J45721_1001259 | 3300002987 | Bacteria | 10686 |
| 13 | JGI25151J46595_10033349 | 3300003187 | Bacteria | 1984 |
| 14 | JGI25165J46597_1000022 | 3300003214 | Bacteria | 357959 |
| 15 | JGI25153J46596_10009345 | 3300003215 | Bacteria | 4573 |
| 16 | rootL2_10002393 | 3300003322 | Bacteria | 3871 |
| 17 | rootL2_10035151 | 3300003322 | Bacteria | 5421 |
| 18 | rootH1_10003102 | 3300003316 | Bacteria | 65144 |
| 19 | rootH1_10003102 | 3300003323 | Bacteria | 6079 |
| 20 | JGI25160J50197_1000260 | 3300003354 | Bacteria | 39829 |
| 21 | JGI25161J50226_1000015 | 3300003374 | Bacteria | 183773 |
| 22 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 23 | Ga0055538_1000011 | 3300003751 | Bacteria | 357959 |
| 24 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 25 | Ga0055539_1000016 | 3300003752 | Bacteria | 358248 |
| 26 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 27 | Ga0055533_1000019 | 3300003756 | Bacteria | 357959 |
| 28 | Ga0055532_1000050 | 3300003758 | Bacteria | 169240 |
| 29 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 30 | Ga0055525_1000042 | 3300003759 | Bacteria | 279804 |
| 31 | Ga0055529_1000154 | 3300003763 | Bacteria | 94292 |
| 32 | Ga0055526_1000166 | 3300003771 | Bacteria | 57918 |
| 33 | Ga0055526_1001297 | 3300003771 | Bacteria | 17923 |
| 34 | Ga0055526_1003006 | 3300003771 | Bacteria | 11012 |
| 35 | Ga0055526_1004954 | 3300003771 | Bacteria | 7820 |
| 36 | Ga0055537_1000135 | 3300003773 | Bacteria | 55914 |
| 37 | Ga0055524_1000016 | 3300003775 | Bacteria | 244926 |
| 38 | Ga0055524_1000094 | 3300003775 | Bacteria | 110394 |
| 39 | Ga0055534_1006054 | 3300003784 | Bacteria | 3115 |
| 40 | Ga0055528_1001624 | 3300003790 | Bacteria | 13258 |
| 41 | Ga0055528_1002120 | 3300003790 | Bacteria | 10952 |
| 42 | Ga0055530_10003682 | 3300003791 | Bacteria | 8558 |
| 43 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 44 | Ga0055531_10000011 | 3300003794 | Bacteria | 195010 |
| 45 | Ga0055531_10033161 | 3300003794 | Bacteria | 1669 |
| 46 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 47 | Ga0055541_1000017 | 3300003841 | Bacteria | 286811 |
| 48 | Ga0055541_1000043 | 3300003841 | Bacteria | 161703 |
| 49 | Ga0055543_1000634 | 3300004625 | Bacteria | 18881 |
| 50 | Ga0065707_10091325 | 3300005295 | Bacteria | 3966 |
| 51 | Ga0070676_10038754 | 3300005328 | Bacteria | 2753 |
| 52 | Ga0070683_100015504 | 3300005329 | Bacteria | 6697 |
| 53 | Ga0070683_100042472 | 3300005329 | Bacteria | 4186 |
| 54 | Ga0070683_100123716 | 3300005329 | Bacteria | 2444 |
| 55 | Ga0070690_100008898 | 3300005330 | Bacteria | 5797 |
| 56 | Ga0070677_10038511 | 3300005333 | Bacteria | 1871 |
| 57 | Ga0068869_100006980 | 3300005334 | Bacteria | 7190 |
| 58 | Ga0070666_10002851 | 3300005335 | Bacteria | 10447 |
| 59 | Ga0068868_100008007 | 3300005338 | Bacteria | 7552 |
| 60 | Ga0070660_100049748 | 3300005339 | Bacteria | 3223 |
| 61 | Ga0070660_100121905 | 3300005339 | Bacteria | 2081 |
| 62 | Ga0070661_100001791 | 3300005344 | Bacteria | 14900 |
| 63 | Ga0070661_100033553 | 3300005344 | Bacteria | 3718 |
| 64 | Ga0070669_100050989 | 3300005353 | Bacteria | 3024 |
| 65 | Ga0070669_100109499 | 3300005353 | Bacteria | 2094 |
| 66 | Ga0070675_100015977 | 3300005354 | Bacteria | 5947 |
| 67 | Ga0070671_100005541 | 3300005355 | Bacteria | 10057 |
| 68 | Ga0070673_100003452 | 3300005364 | Bacteria | 9847 |
| 69 | Ga0070673_100046418 | 3300005364 | Bacteria | 3374 |
| 70 | Ga0070659_100001056 | 3300005366 | Bacteria | 20135 |
| 71 | Ga0070659_100334610 | 3300005366 | Bacteria | 1268 |
| 72 | Ga0070667_100000729 | 3300005367 | Bacteria | 31575 |
| 73 | Ga0070667_100005018 | 3300005367 | Bacteria | 11078 |
| 74 | Ga0070663_100001214 | 3300005455 | Bacteria | 14143 |
| 75 | Ga0070662_100003372 | 3300005457 | Bacteria | 9951 |
| 76 | Ga0070681_10002456 | 3300005458 | Bacteria | 16978 |
| 77 | Ga0068867_100002085 | 3300005459 | Bacteria | 14010 |
| 78 | Ga0068867_100002621 | 3300005459 | Bacteria | 12684 |
| 79 | Ga0068867_100047485 | 3300005459 | Bacteria | 3156 |
| 80 | Ga0068867_100185450 | 3300005459 | Bacteria | 1657 |
| 81 | Ga0070706_100000212 | 3300005467 | Bacteria | 71525 |
| 82 | Ga0070699_100007930 | 3300005518 | Bacteria | 9222 |
| 83 | Ga0070679_100003476 | 3300005530 | Bacteria | 14425 |
| 84 | Ga0070684_100007991 | 3300005535 | Bacteria | 8258 |
| 85 | Ga0070684_100009951 | 3300005535 | Bacteria | 7517 |
| 86 | Ga0070672_100046830 | 3300005543 | Bacteria | 3352 |
| 87 | Ga0070672_100153205 | 3300005543 | Bacteria | 1908 |
| 88 | Ga0070672_100231428 | 3300005543 | Bacteria | 1553 |
| 89 | Ga0070696_100003597 | 3300005546 | Bacteria | 10319 |
| 90 | Ga0068855_100000065 | 3300005563 | Bacteria | 129307 |
| 91 | Ga0068855_100005948 | 3300005563 | Bacteria | 14875 |
| 92 | Ga0068855_100015197 | 3300005563 | Bacteria | 9270 |
| 93 | Ga0070664_100024067 | 3300005564 | Bacteria | 5034 |
| 94 | Ga0068854_100100315 | 3300005578 | Bacteria | 2169 |
| 95 | Ga0068854_100126436 | 3300005578 | Bacteria | 1947 |
| 96 | Ga0068856_100107829 | 3300005614 | Bacteria | 2781 |
| 97 | Ga0068852_100021759 | 3300005616 | Bacteria | 5129 |
| 98 | Ga0068852_100028333 | 3300005616 | Bacteria | 4582 |
| 99 | Ga0068859_100002750 | 3300005617 | Bacteria | 17837 |
| 100 | Ga0068859_100205172 | 3300005617 | Bacteria | 2056 |
| 101 | Ga0068864_100000758 | 3300005618 | Bacteria | 27158 |
| 102 | Ga0068864_100199308 | 3300005618 | Bacteria | 1838 |
| 103 | Ga0068861_100005840 | 3300005719 | Bacteria | 8360 |
| 104 | Ga0068863_100002927 | 3300005841 | Bacteria | 16897 |
| 105 | Ga0068863_100315211 | 3300005841 | Bacteria | 1519 |
| 106 | Ga0068858_100002564 | 3300005842 | Bacteria | 18309 |
| 107 | Ga0068860_100001303 | 3300005843 | Bacteria | 27104 |
| 108 | Ga0075365_10068318 | 3300006038 | Bacteria | 2387 |
| 109 | Ga0075364_10035858 | 3300006051 | Bacteria | 3205 |
| 110 | Ga0075366_10000553 | 3300006195 | Bacteria | 17456 |
| 111 | Ga0075366_10033366 | 3300006195 | Bacteria | 3032 |
| 112 | Ga0075366_10065133 | 3300006195 | Bacteria | 2167 |
| 113 | Ga0097621_100006649 | 3300006237 | Bacteria | 8216 |
| 114 | Ga0075370_10003313 | 3300006353 | Bacteria | 7648 |
| 115 | Ga0075370_10062443 | 3300006353 | Bacteria | 2123 |
| 116 | Ga0075370_10089373 | 3300006353 | Bacteria | 1776 |
| 117 | Ga0075429_100001804 | 3300006880 | Bacteria | 17739 |
| 118 | Ga0097620_100002750 | 3300006931 | Bacteria | 17837 |
| 119 | Ga0097620_100205185 | 3300006931 | Bacteria | 2056 |
| 120 | Ga0079104_1000252 | 3300006946 | Bacteria | 71332 |
| 121 | Ga0079104_1013466 | 3300006946 | Bacteria | 2517 |
| 122 | Ga0105244_10002725 | 3300009036 | Bacteria | 13214 |
| 123 | Ga0105244_10003271 | 3300009036 | Bacteria | 11671 |
| 124 | Ga0105244_10060741 | 3300009036 | Bacteria | 1904 |
| 125 | Ga0105240_10001127 | 3300009093 | Bacteria | 46930 |
| 126 | Ga0105240_10008631 | 3300009093 | Bacteria | 14560 |
| 127 | Ga0105240_10021557 | 3300009093 | Bacteria | 8568 |
| 128 | Ga0105240_10176843 | 3300009093 | Bacteria | 2522 |
| 129 | Ga0105243_10000970 | 3300009148 | Bacteria | 26739 |
| 130 | Ga0105241_10038237 | 3300009174 | Bacteria | 3617 |
| 131 | Ga0105242_10198623 | 3300009176 | Bacteria | 1780 |
| 132 | Ga0105248_10543857 | 3300009177 | Bacteria | 1310 |
| 133 | Ga0105237_10000045 | 3300009545 | Bacteria | 171156 |
| 134 | Ga0105237_10024607 | 3300009545 | Bacteria | 6157 |
| 135 | Ga0105238_10068539 | 3300009551 | Bacteria | 3549 |
| 136 | Ga0105238_10125895 | 3300009551 | Bacteria | 2541 |
| 137 | Ga0105249_10101094 | 3300009553 | Bacteria | 2711 |
| 138 | Ga0105239_10051413 | 3300010375 | Bacteria | 4517 |
| 139 | Ga0105239_10109837 | 3300010375 | Bacteria | 3057 |
| 140 | Ga0157370_10001801 | 3300013104 | Bacteria | 26425 |
| 141 | Ga0157369_10000499 | 3300013105 | Bacteria | 51849 |
| 142 | Ga0157369_10060326 | 3300013105 | Bacteria | 4090 |
| 143 | Ga0157374_10191144 | 3300013296 | Bacteria | 2002 |
| 144 | Ga0157378_10001723 | 3300013297 | Bacteria | 19644 |
| 145 | Ga0157378_10029766 | 3300013297 | Bacteria | 4821 |
| 146 | Ga0163162_10001695 | 3300013306 | Bacteria | 20665 |
| 147 | Ga0163162_10002613 | 3300013306 | Bacteria | 17080 |
| 148 | Ga0163162_10015896 | 3300013306 | Bacteria | 7355 |
| 149 | Ga0163162_10055825 | 3300013306 | Bacteria | 3977 |
| 150 | Ga0163162_10106129 | 3300013306 | Bacteria | 2904 |
| 151 | Ga0157372_10010791 | 3300013307 | Bacteria | 9726 |
| 152 | Ga0157375_10022368 | 3300013308 | Bacteria | 5819 |
| 153 | Ga0157375_10071046 | 3300013308 | Bacteria | 3493 |
| 154 | Ga0157375_10238854 | 3300013308 | Bacteria | 1976 |
| 155 | Ga0157375_10455459 | 3300013308 | Bacteria | 1445 |
| 156 | Ga0163163_10195298 | 3300014325 | Bacteria | 2072 |
| 157 | Ga0182008_10017982 | 3300014497 | Bacteria | 3662 |
| 158 | Ga0182008_10056288 | 3300014497 | Bacteria | 1944 |
| 159 | Ga0157377_10000206 | 3300014745 | Bacteria | 32358 |
| 160 | Ga0157377_10044082 | 3300014745 | Bacteria | 2486 |
| 161 | Ga0157379_10015979 | 3300014968 | Bacteria | 6599 |
| 162 | Ga0157379_10083827 | 3300014968 | Bacteria | 2857 |
| 163 | Ga0157379_10350928 | 3300014968 | Bacteria | 1350 |
| 164 | Ga0157376_10157266 | 3300014969 | Bacteria | 2056 |
| 165 | Ga0182006_1000619 | 3300015261 | Bacteria | 25523 |
| 166 | Ga0182006_1004496 | 3300015261 | Bacteria | 6866 |
| 167 | Ga0182007_10001487 | 3300015262 | Bacteria | 12536 |
| 168 | Ga0182007_10005597 | 3300015262 | Bacteria | 5491 |
| 169 | Ga0182007_10041142 | 3300015262 | Bacteria | 1541 |
| 170 | Ga0182005_1000020 | 3300015265 | Bacteria | 278671 |
| 171 | Ga0182005_1000307 | 3300015265 | Bacteria | 29530 |
| 172 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 173 | Ga0163161_10028579 | 3300017792 | Bacteria | 3961 |
| 174 | Ga0163161_10061753 | 3300017792 | Bacteria | 2728 |
| 175 | Ga0163161_10109882 | 3300017792 | Bacteria | 2060 |
| 176 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 177 | Ga0213872_10000196 | 3300021361 | Bacteria | 53649 |
| 178 | Ga0213872_10000245 | 3300021361 | Bacteria | 48030 |
| 179 | Ga0213872_10001039 | 3300021361 | Bacteria | 19352 |
| 180 | Ga0213872_10002223 | 3300021361 | Bacteria | 11609 |
| 181 | Ga0213872_10002318 | 3300021361 | Bacteria | 11353 |
| 182 | Ga0213872_10052686 | 3300021361 | Bacteria | 1846 |
| 183 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 184 | Ga0209435_100029 | 3300025206 | Bacteria | 176358 |
| 185 | Ga0209435_100100 | 3300025206 | Bacteria | 35665 |
| 186 | Ga0209760_102646 | 3300025207 | Bacteria | 1653 |
| 187 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 188 | Ga0209784_100019 | 3300025224 | Bacteria | 453558 |
| 189 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 190 | Ga0209566_100017 | 3300025225 | Bacteria | 453558 |
| 191 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 192 | Ga0209674_100031 | 3300025226 | Bacteria | 453558 |
| 193 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 194 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 195 | Ga0209563_100035 | 3300025230 | Bacteria | 453558 |
| 196 | Ga0207427_100255 | 3300025231 | Bacteria | 41856 |
| 197 | Ga0209437_100038 | 3300025233 | Bacteria | 453558 |
| 198 | Ga0209258_100396 | 3300025242 | Bacteria | 54877 |
| 199 | Ga0207425_1006266 | 3300025245 | Bacteria | 3273 |
| 200 | Ga0207425_1007047 | 3300025245 | Bacteria | 3009 |
| 201 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 202 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 203 | Ga0209646_1000073 | 3300025246 | Bacteria | 224301 |
| 204 | Ga0209646_1000109 | 3300025246 | Bacteria | 158348 |
| 205 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 206 | Ga0209026_1000124 | 3300025250 | Bacteria | 125673 |
| 207 | Ga0209026_1004094 | 3300025250 | Bacteria | 4494 |
| 208 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 209 | Ga0209677_100020 | 3300025253 | Bacteria | 453558 |
| 210 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 211 | Ga0209759_1000108 | 3300025256 | Bacteria | 146393 |
| 212 | Ga0209759_1000199 | 3300025256 | Bacteria | 94643 |
| 213 | Ga0209233_1000049 | 3300025261 | Bacteria | 453558 |
| 214 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 215 | Ga0209565_1000365 | 3300025263 | Bacteria | 38942 |
| 216 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 217 | Ga0209673_1000045 | 3300025273 | Bacteria | 290531 |
| 218 | Ga0209675_1006109 | 3300025291 | Bacteria | 4904 |
| 219 | Ga0209676_1009416 | 3300025292 | Bacteria | 4217 |
| 220 | Ga0209025_1003445 | 3300025294 | Bacteria | 14972 |
| 221 | Ga0209025_1015346 | 3300025294 | Bacteria | 4628 |
| 222 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 223 | Ga0209564_1000514 | 3300025295 | Bacteria | 63392 |
| 224 | Ga0209564_1000772 | 3300025295 | Bacteria | 44476 |
| 225 | Ga0209564_1001593 | 3300025295 | Bacteria | 22188 |
| 226 | Ga0209758_1000149 | 3300025297 | Bacteria | 163504 |
| 227 | Ga0209758_1000731 | 3300025297 | Bacteria | 48032 |
| 228 | Ga0209050_1000312 | 3300025298 | Bacteria | 98756 |
| 229 | Ga0209050_1001248 | 3300025298 | Bacteria | 29381 |
| 230 | Ga0209050_1007135 | 3300025298 | Bacteria | 6373 |
| 231 | Ga0209050_1016999 | 3300025298 | Bacteria | 2935 |
| 232 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 233 | Ga0209256_1000071 | 3300025299 | Bacteria | 242618 |
| 234 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 235 | Ga0209051_1023432 | 3300025303 | Bacteria | 2567 |
| 236 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 237 | Ga0209257_1000017 | 3300025304 | Bacteria | 866287 |
| 238 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 239 | Ga0209257_1000115 | 3300025304 | Bacteria | 230858 |
| 240 | Ga0207655_1005097 | 3300025728 | Bacteria | 9076 |
| 241 | Ga0207655_1005150 | 3300025728 | Bacteria | 8998 |
| 242 | Ga0207680_10002123 | 3300025903 | Bacteria | 9278 |
| 243 | Ga0207645_10004821 | 3300025907 | Bacteria | 9910 |
| 244 | Ga0207645_10011352 | 3300025907 | Bacteria | 6086 |
| 245 | Ga0207645_10029647 | 3300025907 | Bacteria | 3526 |
| 246 | Ga0207643_10096175 | 3300025908 | Bacteria | 1732 |
| 247 | Ga0207684_10003587 | 3300025910 | Bacteria | 15107 |
| 248 | Ga0207707_10003135 | 3300025912 | Bacteria | 14682 |
| 249 | Ga0207695_10000475 | 3300025913 | Bacteria | 86957 |
| 250 | Ga0207695_10009018 | 3300025913 | Bacteria | 12401 |
| 251 | Ga0207695_10125772 | 3300025913 | Bacteria | 2526 |
| 252 | Ga0207671_10047776 | 3300025914 | Bacteria | 3167 |
| 253 | Ga0207660_10004817 | 3300025917 | Bacteria | 8780 |
| 254 | Ga0207649_10153947 | 3300025920 | Bacteria | 1586 |
| 255 | Ga0207652_10069143 | 3300025921 | Bacteria | 3065 |
| 256 | Ga0207694_10041422 | 3300025924 | Bacteria | 3549 |
| 257 | Ga0207659_10010680 | 3300025926 | Bacteria | 5774 |
| 258 | Ga0207644_10005163 | 3300025931 | Bacteria | 8528 |
| 259 | Ga0207690_10001069 | 3300025932 | Bacteria | 17533 |
| 260 | Ga0207706_10001732 | 3300025933 | Bacteria | 21456 |
| 261 | Ga0207709_10000722 | 3300025935 | Bacteria | 26492 |
| 262 | Ga0207691_10071778 | 3300025940 | Bacteria | 3124 |
| 263 | Ga0207711_10019345 | 3300025941 | Bacteria | 5670 |
| 264 | Ga0207711_10044578 | 3300025941 | Bacteria | 3787 |
| 265 | Ga0207711_10397681 | 3300025941 | Bacteria | 1280 |
| 266 | Ga0207661_10004060 | 3300025944 | Bacteria | 10222 |
| 267 | Ga0207679_10136894 | 3300025945 | Bacteria | 1973 |
| 268 | Ga0207667_10000025 | 3300025949 | Bacteria | 350159 |
| 269 | Ga0207667_10031962 | 3300025949 | Bacteria | 5677 |
| 270 | Ga0207667_10040648 | 3300025949 | Bacteria | 4952 |
| 271 | Ga0207651_10000549 | 3300025960 | Bacteria | 15732 |
| 272 | Ga0207651_10023356 | 3300025960 | Bacteria | 3802 |
| 273 | Ga0207712_10100921 | 3300025961 | Bacteria | 2145 |
| 274 | Ga0207668_10035893 | 3300025972 | Bacteria | 3306 |
| 275 | Ga0207658_10000754 | 3300025986 | Bacteria | 27858 |
| 276 | Ga0207658_10002122 | 3300025986 | Bacteria | 14738 |
| 277 | Ga0207677_10002505 | 3300026023 | Bacteria | 9628 |
| 278 | Ga0207703_10013704 | 3300026035 | Bacteria | 6319 |
| 279 | Ga0207678_10032302 | 3300026067 | Bacteria | 4561 |
| 280 | Ga0207708_10049450 | 3300026075 | Bacteria | 3201 |
| 281 | Ga0207702_10122741 | 3300026078 | Bacteria | 2327 |
| 282 | Ga0207641_10011842 | 3300026088 | Bacteria | 7157 |
| 283 | Ga0207641_10038381 | 3300026088 | Bacteria | 4004 |
| 284 | Ga0207648_10000142 | 3300026089 | Bacteria | 71593 |
| 285 | Ga0207648_10002265 | 3300026089 | Bacteria | 20825 |
| 286 | Ga0207648_10008041 | 3300026089 | Bacteria | 10277 |
| 287 | Ga0207648_10079664 | 3300026089 | Bacteria | 2858 |
| 288 | Ga0207676_10001768 | 3300026095 | Bacteria | 15832 |
| 289 | Ga0207676_10167827 | 3300026095 | Bacteria | 1909 |
| 290 | Ga0207674_10070052 | 3300026116 | Bacteria | 3526 |
| 291 | Ga0207675_100000910 | 3300026118 | Bacteria | 29549 |
| 292 | Ga0207683_10023727 | 3300026121 | Bacteria | 5277 |
| 293 | Ga0207698_10046542 | 3300026142 | Bacteria | 3277 |
| 294 | Ga0209281_1000196 | 3300027111 | Bacteria | 137908 |
| 295 | Ga0209281_1006108 | 3300027111 | Bacteria | 3196 |
| 296 | Ga0209974_10010459 | 3300027876 | Bacteria | 3130 |
| 297 | Ga0268265_10187154 | 3300028380 | Bacteria | 1784 |
| 298 | Ga0268264_10002772 | 3300028381 | Bacteria | 15287 |
| 299 | Ga0307517_10003477 | 3300028786 | Bacteria | 24480 |
| 300 | Ga0307515_10000428 | 3300028794 | Bacteria | 101247 |
| 301 | Ga0307515_10105774 | 3300028794 | Bacteria | 3346 |
| 302 | Ga0307515_10108387 | 3300028794 | Bacteria | 3272 |
| 303 | Ga0307512_10078938 | 3300030522 | Bacteria | 2381 |
| 304 | Ga0316182_1425617 | 3300030745 | Bacteria | 2040 |
| 305 | Ga0265328_10007485 | 3300031239 | Bacteria | 4549 |
| 306 | Ga0265331_10022266 | 3300031250 | Bacteria | 3234 |
| 307 | Ga0265327_10000120 | 3300031251 | Bacteria | 171108 |
| 308 | Ga0265327_10000689 | 3300031251 | Bacteria | 54050 |
| 309 | Ga0265327_10025410 | 3300031251 | Bacteria | 3453 |
| 310 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 311 | Ga0307513_10000121 | 3300031456 | Bacteria | 109551 |
| 312 | Ga0307513_10335186 | 3300031456 | Bacteria | 1265 |
| 313 | Ga0307509_10000120 | 3300031507 | Bacteria | 114238 |
| 314 | Ga0307509_10010566 | 3300031507 | Bacteria | 11292 |
| 315 | Ga0307509_10013191 | 3300031507 | Bacteria | 9806 |
| 316 | Ga0307509_10172684 | 3300031507 | Bacteria | 2038 |
| 317 | Ga0307508_10000094 | 3300031616 | Bacteria | 104107 |
| 318 | Ga0307514_10020110 | 3300031649 | Bacteria | 5454 |
| 319 | Ga0307514_10089187 | 3300031649 | Bacteria | 2254 |
| 320 | Ga0265314_10051576 | 3300031711 | Bacteria | 2865 |
| 321 | Ga0316578_10002384 | 3300031728 | Bacteria | 8217 |
| 322 | Ga0307516_10002590 | 3300031730 | Bacteria | 24022 |
| 323 | Ga0307516_10020562 | 3300031730 | Bacteria | 6816 |
| 324 | Ga0307516_10161410 | 3300031730 | Bacteria | 1991 |
| 325 | Ga0307516_10208254 | 3300031730 | Bacteria | 1671 |
| 326 | Ga0307416_100217368 | 3300032002 | Bacteria | 1829 |
| 327 | Ga0307416_100335284 | 3300032002 | Bacteria | 1522 |
| 328 | Ga0307416_100394523 | 3300032002 | Bacteria | 1419 |
| 329 | Ga0307411_10039870 | 3300032005 | Bacteria | 2975 |
| 330 | Ga0307411_10244191 | 3300032005 | Bacteria | 1408 |
| 331 | Ga0307510_10018226 | 3300033180 | Bacteria | 8266 |
| 332 | Ga0307510_10020396 | 3300033180 | Bacteria | 7746 |
| 333 | Ga0307510_10062199 | 3300033180 | Bacteria | 3817 |
| 334 | Ga0373950_0004559 | 3300034818 | Bacteria | 2033 |
| 335 | Ga0373959_0010704 | 3300034820 | Bacteria | 1608 |
| 336 | Ga0373960_0001500 | 3300035121 | Bacteria | 5188 |
| 337 | Ga0373961_0032485 | 3300035241 | Bacteria | 1464 |
| 338 | Ga0316574_0055178 | 3300035398 | Bacteria | 2483 |
| 339 | Ga0373931_0000478 | 3300035691 | Bacteria | 16299 |
| 340 | Ga0373937_0506550 | 3300036401 | Bacteria | 1147 |
| 341 | Ga0316584_0065115 | 3300036712 | Unclassified | 2730 |
| 342 | Ga0316584_0125588 | 3300036712 | Bacteria | 1916 |
| 343 | Ga0373925_0027565 | 3300037068 | Bacteria | 4157 |
| 344 | Ga0373925_0129907 | 3300037068 | Bacteria | 1963 |
| 345 | Ga0395900_0006543 | 3300037418 | Bacteria | 12134 |
| 346 | Ga0395900_0012541 | 3300037418 | Bacteria | 8671 |
| 347 | Ga0395900_0017455 | 3300037418 | Bacteria | 7327 |
| 348 | Ga0395900_0044155 | 3300037418 | Bacteria | 4593 |
| 349 | Ga0395900_0044524 | 3300037418 | Bacteria | 4572 |
| 350 | Ga0395898_0002485 | 3300037466 | Bacteria | 21682 |
| 351 | Ga0395898_0021948 | 3300037466 | Bacteria | 6466 |
| 352 | Ga0395898_0062080 | 3300037466 | Bacteria | 3630 |
| 353 | Ga0395898_0165067 | 3300037466 | Bacteria | 2118 |
| 354 | Ga0395898_0328594 | 3300037466 | Bacteria | 1458 |
| 355 | Ga0395905_0001291 | 3300037471 | Bacteria | 30780 |
| 356 | Ga0395905_0049775 | 3300037471 | Bacteria | 3927 |
| 357 | Ga0395905_0075445 | 3300037471 | Bacteria | 3160 |
| 358 | Ga0395905_0291146 | 3300037471 | Bacteria | 1519 |
| 359 | Ga0395901_0003007 | 3300038443 | Bacteria | 17001 |
| 360 | Ga0395901_0020218 | 3300038443 | Bacteria | 6815 |
| 361 | Ga0395901_0088864 | 3300038443 | Bacteria | 3232 |
| 362 | Ga0395901_0176114 | 3300038443 | Bacteria | 2244 |
| 363 | Ga0400490_48285 | 3300038726 | Unclassified | 1488 |
| 364 | Ga0436361_0324341 | 3300039447 | Bacteria | 73428 |
| 365 | Ga0436361_0325909 | 3300039447 | Bacteria | 18443 |
| 366 | Ga0436361_0391022 | 3300039447 | Bacteria | 9038 |
| 367 | Ga0436361_0536051 | 3300039447 | Bacteria | 3555 |
| 368 | Ga0436361_0626985 | 3300039447 | Bacteria | 51406 |
| 369 | Ga0436361_0684212 | 3300039447 | Bacteria | 74853 |
| 370 | Ga0436361_0925876 | 3300039447 | Bacteria | 15009 |
| 371 | Ga0436363_0683349 | 3300039450 | Bacteria | 1471 |
| 372 | Ga0439436_0000271 | 3300041404 | Bacteria | 12488 |
| 373 | Ga0439447_014964 | 3300041407 | Bacteria | 2163 |
| 374 | Ga0439461_0005003 | 3300041410 | Bacteria | 2240 |
| 375 | Ga0439465_0000180 | 3300041413 | Bacteria | 16199 |
| 376 | Ga0439431_0000113 | 3300041997 | Bacteria | 13938 |
| 377 | Ga0439445_0000101 | 3300042004 | Bacteria | 14009 |
| 378 | Ga0439432_009440 | 3300042006 | Bacteria | 3401 |
| 379 | Ga0439449_0000486 | 3300042007 | Bacteria | 14892 |
| 380 | Ga0439452_002555 | 3300042010 | Bacteria | 6684 |
| 381 | Ga0439462_0009984 | 3300042015 | Bacteria | 2403 |
| 382 | Ga0450919_000975 | 3300042121 | Bacteria | 3704 |
| 383 | Ga0439434_0001146 | 3300042435 | Bacteria | 7668 |
| 384 | Ga0439464_0008243 | 3300042439 | Bacteria | 2731 |
| 385 | Ga0450918_000074 | 3300042531 | Bacteria | 20766 |
| 386 | Ga0466969_0020269 | 3300044656 | Bacteria | 3445 |
| 387 | Ga0466972_0000005 | 3300044658 | Bacteria | 289640 |
| 388 | Ga0466972_0000323 | 3300044658 | Bacteria | 27151 |
| 389 | Ga0466972_0005646 | 3300044658 | Bacteria | 6276 |
| 390 | Ga0466977_0000251 | 3300044666 | Bacteria | 15079 |
| 391 | Ga0466965_0011250 | 3300044683 | Bacteria | 4190 |
| 392 | Ga0466966_0005559 | 3300044684 | Bacteria | 8285 |
| 393 | Ga0466966_0006944 | 3300044684 | Bacteria | 7498 |
| 394 | Ga0466964_0006578 | 3300044706 | Bacteria | 4335 |
| 395 | Ga0466964_0007499 | 3300044706 | Bacteria | 4083 |
| 396 | Ga0466968_0002113 | 3300044735 | Bacteria | 7230 |
| 397 | Ga0466970_0009910 | 3300044765 | Bacteria | 4824 |
| 398 | Ga0466959_0019390 | 3300045049 | Bacteria | 5002 |
| 399 | Ga0466959_0038621 | 3300045049 | Bacteria | 3528 |
| 400 | Ga0466967_0239055 | 3300045976 | Bacteria | 1732 |
| 401 | Ga0495617_000006 | 3300046452 | Bacteria | 398279 |
| 402 | Ga0495617_000852 | 3300046452 | Bacteria | 14479 |
| 403 | Ga0495617_001340 | 3300046452 | Bacteria | 10931 |
| 404 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 405 | Ga0495592_0010851 | 3300046454 | Bacteria | 6871 |
| 406 | Ga0495592_0016149 | 3300046454 | Bacteria | 5664 |
| 407 | Ga0495590_0000052 | 3300046457 | Bacteria | 103480 |
| 408 | Ga0495638_0000066 | 3300046460 | Bacteria | 168673 |
| 409 | Ga0495638_0024865 | 3300046460 | Bacteria | 3898 |
| 410 | Ga0495641_0045268 | 3300046461 | Bacteria | 2027 |
| 411 | Ga0495651_0013281 | 3300046462 | Bacteria | 6369 |
| 412 | Ga0495651_0038851 | 3300046462 | Bacteria | 3706 |
| 413 | Ga0495653_0000011 | 3300046463 | Bacteria | 272314 |
| 414 | Ga0495653_0001619 | 3300046463 | Bacteria | 17685 |
| 415 | Ga0495650_0000352 | 3300046471 | Bacteria | 81351 |
| 416 | Ga0495650_0000773 | 3300046471 | Bacteria | 39442 |
| 417 | Ga0495650_0001907 | 3300046471 | Bacteria | 18489 |
| 418 | Ga0495650_0004408 | 3300046471 | Bacteria | 9673 |
| 419 | Ga0495580_0014737 | 3300046472 | Bacteria | 5925 |
| 420 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 421 | Ga0495605_0021292 | 3300046474 | Bacteria | 3436 |
| 422 | Ga0495639_0014582 | 3300046475 | Bacteria | 3404 |
| 423 | Ga0495584_0003531 | 3300046491 | Bacteria | 8574 |
| 424 | Ga0495585_0006322 | 3300046492 | Bacteria | 7360 |
| 425 | Ga0495585_0043062 | 3300046492 | Bacteria | 2526 |
| 426 | Ga0495607_0000177 | 3300046501 | Bacteria | 67452 |
| 427 | Ga0495607_0003723 | 3300046501 | Bacteria | 11545 |
| 428 | Ga0495607_0007312 | 3300046501 | Bacteria | 7656 |
| 429 | Ga0495607_0017937 | 3300046501 | Bacteria | 4527 |
| 430 | Ga0495607_0025953 | 3300046501 | Bacteria | 3639 |
| 431 | Ga0495607_0107676 | 3300046501 | Bacteria | 1482 |
| 432 | Ga0495583_0000056 | 3300046506 | Bacteria | 200858 |
| 433 | Ga0495583_0000320 | 3300046506 | Bacteria | 76050 |
| 434 | Ga0495606_0000024 | 3300046507 | Bacteria | 262080 |
| 435 | Ga0495606_0001440 | 3300046507 | Bacteria | 31925 |
| 436 | Ga0495606_0001995 | 3300046507 | Bacteria | 25166 |
| 437 | Ga0495606_0002197 | 3300046507 | Bacteria | 23396 |
| 438 | Ga0495606_0002956 | 3300046507 | Bacteria | 18721 |
| 439 | Ga0495606_0004256 | 3300046507 | Bacteria | 14449 |
| 440 | Ga0495606_0018994 | 3300046507 | Bacteria | 5135 |
| 441 | Ga0495606_0027849 | 3300046507 | Bacteria | 3998 |
| 442 | Ga0495608_0001471 | 3300046511 | Bacteria | 16736 |
| 443 | Ga0495608_0034191 | 3300046511 | Bacteria | 3433 |
| 444 | Ga0495608_0070057 | 3300046511 | Bacteria | 2289 |
| 445 | Ga0495610_0002290 | 3300046512 | Bacteria | 16177 |
| 446 | Ga0495610_0013441 | 3300046512 | Bacteria | 4864 |
| 447 | Ga0495610_0044003 | 3300046512 | Bacteria | 2220 |
| 448 | Ga0495618_0020035 | 3300046514 | Bacteria | 4117 |
| 449 | Ga0495618_0124132 | 3300046514 | Bacteria | 1653 |
| 450 | Ga0495628_0001674 | 3300046516 | Bacteria | 20237 |
| 451 | Ga0495628_0003473 | 3300046516 | Bacteria | 14096 |
| 452 | Ga0495628_0049345 | 3300046516 | Bacteria | 3333 |
| 453 | Ga0495628_0133082 | 3300046516 | Bacteria | 1901 |
| 454 | Ga0495632_0013311 | 3300046519 | Bacteria | 4700 |
| 455 | Ga0495637_0000537 | 3300046520 | Bacteria | 27246 |
| 456 | Ga0495637_0001788 | 3300046520 | Bacteria | 12301 |
| 457 | Ga0495643_0001115 | 3300046522 | Bacteria | 26600 |
| 458 | Ga0495643_0005028 | 3300046522 | Bacteria | 9056 |
| 459 | Ga0495644_0002336 | 3300046523 | Bacteria | 7570 |
| 460 | Ga0495644_0003135 | 3300046523 | Bacteria | 6538 |
| 461 | Ga0495648_0003350 | 3300046524 | Bacteria | 14122 |
| 462 | Ga0495648_0003511 | 3300046524 | Bacteria | 13743 |
| 463 | Ga0495648_0006065 | 3300046524 | Bacteria | 9920 |
| 464 | Ga0495648_0006696 | 3300046524 | Bacteria | 9329 |
| 465 | Ga0495648_0026972 | 3300046524 | Bacteria | 3855 |
| 466 | Ga0495642_0000708 | 3300046528 | Bacteria | 16600 |
| 467 | Ga0495642_0011407 | 3300046528 | Bacteria | 3415 |
| 468 | Ga0495652_0015550 | 3300046529 | Bacteria | 6812 |
| 469 | Ga0495652_0020026 | 3300046529 | Bacteria | 5950 |
| 470 | Ga0495652_0025365 | 3300046529 | Bacteria | 5245 |
| 471 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 472 | Ga0495654_0009485 | 3300046530 | Bacteria | 5334 |
| 473 | Ga0495609_0001896 | 3300046538 | Bacteria | 13328 |
| 474 | Ga0495609_0004176 | 3300046538 | Bacteria | 8016 |
| 475 | Ga0495609_0028551 | 3300046538 | Bacteria | 2545 |
| 476 | Ga0495597_0001233 | 3300046542 | Bacteria | 19045 |
| 477 | Ga0495597_0023206 | 3300046542 | Bacteria | 2871 |
| 478 | Ga0495597_0036890 | 3300046542 | Bacteria | 2198 |
| 479 | Ga0495645_0027513 | 3300046543 | Bacteria | 4132 |
| 480 | Ga0495622_0000658 | 3300046557 | Bacteria | 19569 |
| 481 | Ga0495622_0002912 | 3300046557 | Bacteria | 8168 |
| 482 | Ga0495633_0000230 | 3300046558 | Bacteria | 68204 |
| 483 | Ga0495633_0001406 | 3300046558 | Bacteria | 18774 |
| 484 | Ga0495633_0005224 | 3300046558 | Bacteria | 8008 |
| 485 | Ga0495633_0010766 | 3300046558 | Bacteria | 4974 |
| 486 | Ga0495633_0011084 | 3300046558 | Bacteria | 4889 |
| 487 | Ga0495633_0042514 | 3300046558 | Bacteria | 2157 |
| 488 | Ga0495656_0000075 | 3300046615 | Bacteria | 44355 |
| 489 | Ga0495656_0002866 | 3300046615 | Bacteria | 5779 |
| 490 | Ga0495668_0001363 | 3300046616 | Bacteria | 23963 |
| 491 | Ga0495668_0001523 | 3300046616 | Bacteria | 22005 |
| 492 | Ga0495668_0004803 | 3300046616 | Bacteria | 9408 |
| 493 | Ga0495668_0004853 | 3300046616 | Bacteria | 9346 |
| 494 | Ga0495668_0170515 | 3300046616 | Bacteria | 1192 |
| 495 | Ga0495611_0012522 | 3300046648 | Bacteria | 3606 |
| 496 | Ga0495625_0001266 | 3300046660 | Bacteria | 31745 |
| 497 | Ga0495625_0002652 | 3300046660 | Bacteria | 19076 |
| 498 | Ga0495625_0002694 | 3300046660 | Bacteria | 18878 |
| 499 | Ga0495625_0004914 | 3300046660 | Bacteria | 12441 |
| 500 | Ga0495625_0023096 | 3300046660 | Bacteria | 4755 |
| 501 | Ga0495625_0042214 | 3300046660 | Bacteria | 3316 |
| 502 | Ga0495635_0046468 | 3300046663 | Bacteria | 2995 |
| 503 | Ga0495659_0000032 | 3300046664 | Bacteria | 65104 |
| 504 | Ga0495659_0000563 | 3300046664 | Bacteria | 13635 |
| 505 | Ga0495661_0031403 | 3300046665 | Bacteria | 3371 |
| 506 | Ga0495661_0050839 | 3300046665 | Bacteria | 2506 |
| 507 | Ga0495599_0005226 | 3300046678 | Bacteria | 7742 |
| 508 | Ga0495623_0012368 | 3300046679 | Bacteria | 5525 |
| 509 | Ga0495623_0019066 | 3300046679 | Bacteria | 4430 |
| 510 | Ga0495623_0021275 | 3300046679 | Bacteria | 4189 |
| 511 | Ga0495646_0012420 | 3300046680 | Bacteria | 5415 |
| 512 | Ga0495646_0016153 | 3300046680 | Bacteria | 4738 |
| 513 | Ga0495669_0065725 | 3300046684 | Bacteria | 1647 |
| 514 | Ga0495670_0001909 | 3300046691 | Bacteria | 10266 |
| 515 | Ga0495670_0003680 | 3300046691 | Bacteria | 7538 |
| 516 | Ga0495670_0026582 | 3300046691 | Bacteria | 2865 |
| 517 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 518 | Ga0495671_0001893 | 3300046692 | Bacteria | 13433 |
| 519 | Ga0495671_0093350 | 3300046692 | Bacteria | 1472 |
| 520 | Ga0495649_0004672 | 3300046694 | Bacteria | 8899 |
| 521 | Ga0495600_0004879 | 3300046809 | Bacteria | 8058 |
| 522 | Ga0495660_0001414 | 3300046810 | Bacteria | 16450 |
| 523 | Ga0495660_0003077 | 3300046810 | Bacteria | 10402 |
| 524 | Ga0495660_0006536 | 3300046810 | Bacteria | 6889 |
| 525 | Ga0495660_0011740 | 3300046810 | Bacteria | 5080 |
| 526 | Ga0495660_0014403 | 3300046810 | Bacteria | 4576 |
| 527 | Ga0495660_0026746 | 3300046810 | Bacteria | 3268 |
| 528 | Ga0495660_0070618 | 3300046810 | Bacteria | 1853 |
| 529 | Ga0495604_0004580 | 3300047317 | Bacteria | 10953 |
| 530 | Ga0495636_0017489 | 3300047318 | Bacteria | 2870 |
| 531 | Ga0495636_0021714 | 3300047318 | Bacteria | 2593 |
| 532 | Ga0495672_0000744 | 3300047320 | Bacteria | 35683 |
| 533 | Ga0495672_0000755 | 3300047320 | Bacteria | 35389 |
| 534 | Ga0495683_0001730 | 3300047323 | Bacteria | 13805 |
| 535 | Ga0495683_0017288 | 3300047323 | Bacteria | 3740 |
| 536 | Ga0495687_001135 | 3300047443 | Bacteria | 25805 |
| 537 | Ga0495687_001350 | 3300047443 | Bacteria | 22806 |
| 538 | Ga0495687_007877 | 3300047443 | Bacteria | 6195 |
| 539 | Ga0495677_0003783 | 3300047445 | Bacteria | 5851 |
| 540 | Ga0495677_0026631 | 3300047445 | Bacteria | 2097 |
| 541 | Ga0495679_022404 | 3300047446 | Bacteria | 2161 |
| 542 | Ga0495685_000023 | 3300047447 | Bacteria | 68601 |
| 543 | Ga0495685_062381 | 3300047447 | Bacteria | 1255 |
| 544 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 545 | Ga0495673_0000014 | 3300047469 | Bacteria | 599202 |
| 546 | Ga0495673_0000090 | 3300047469 | Bacteria | 188187 |
| 547 | Ga0495673_0015552 | 3300047469 | Bacteria | 3917 |
| 548 | Ga0495686_0015016 | 3300047472 | Bacteria | 5308 |
| 549 | Ga0495686_0018794 | 3300047472 | Bacteria | 4628 |
| 550 | Ga0495602_0024320 | 3300048088 | Bacteria | 5878 |
| 551 | Ga0495602_0033777 | 3300048088 | Bacteria | 4794 |
| 552 | Ga0495615_0002608 | 3300048090 | Bacteria | 2913 |
| 553 | Ga0496100_0012895 | 3300048903 | Bacteria | 4805 |
| 554 | Ga0496101_0001350 | 3300048904 | Bacteria | 14712 |
| 555 | Ga0496102_0025151 | 3300048905 | Bacteria | 5296 |
| 556 | Ga0496102_0103628 | 3300048905 | Bacteria | 2646 |
| 557 | Ga0496103_0077759 | 3300048906 | Bacteria | 2083 |
| 558 | Ga0496103_0171378 | 3300048906 | Bacteria | 1394 |
| 559 | Ga0496104_0021258 | 3300048907 | Bacteria | 5954 |
| 560 | Ga0496104_0373547 | 3300048907 | Bacteria | 1338 |
| 561 | Ga0496105_0003513 | 3300048908 | Bacteria | 11613 |
| 562 | Ga0496106_0121468 | 3300048909 | Bacteria | 2042 |
| 563 | Ga0496108_0105048 | 3300048911 | Bacteria | 2411 |
| 564 | Ga0496108_0172974 | 3300048911 | Bacteria | 1869 |
| 565 | Ga0496109_0035546 | 3300048912 | Bacteria | 4496 |
| 566 | Ga0496111_0018203 | 3300048914 | Bacteria | 4864 |
| 567 | Ga0496112_0225721 | 3300048915 | Bacteria | 1828 |
| 568 | Ga0496114_0086879 | 3300048917 | Bacteria | 2651 |
| 569 | Ga0496114_0181516 | 3300048917 | Bacteria | 1838 |
| 570 | Ga0496116_0003419 | 3300048919 | Bacteria | 15693 |
| 571 | Ga0496116_0024659 | 3300048919 | Bacteria | 4441 |
| 572 | Ga0496116_0031146 | 3300048919 | Bacteria | 3824 |
| 573 | Ga0496121_0008910 | 3300048924 | Bacteria | 11651 |
| 574 | Ga0496122_0000472 | 3300048925 | Bacteria | 83803 |
| 575 | Ga0496122_0030668 | 3300048925 | Bacteria | 4498 |
| 576 | Ga0496123_0000361 | 3300048926 | Bacteria | 85609 |
| 577 | Ga0496123_0004632 | 3300048926 | Bacteria | 14287 |
| 578 | Ga0496124_0065554 | 3300048927 | Bacteria | 3028 |
| 579 | Ga0496124_0121231 | 3300048927 | Bacteria | 2089 |
| 580 | Ga0496125_0000717 | 3300048928 | Bacteria | 54887 |
| 581 | Ga0496125_0006462 | 3300048928 | Bacteria | 12667 |
| 582 | Ga0496125_0028847 | 3300048928 | Bacteria | 5000 |
| 583 | Ga0496126_0074291 | 3300048929 | Bacteria | 3020 |
| 584 | Ga0495678_000016 | 3300049459 | Bacteria | 303426 |
| 585 | Ga0495678_000096 | 3300049459 | Bacteria | 109474 |
| 586 | Ga0495678_004440 | 3300049459 | Bacteria | 8106 |
| 587 | Ga0495682_0001281 | 3300049460 | Bacteria | 14052 |
| 588 | Ga0495682_0002033 | 3300049460 | Bacteria | 9935 |
| 589 | Ga0501034_0404693 | 3300049571 | Bacteria | 1287 |
| 590 | Ga0501040_0006336 | 3300049576 | Bacteria | 7684 |
| 591 | Ga0501042_0000875 | 3300049578 | Bacteria | 16835 |
| 592 | Ga0501043_0000097 | 3300049579 | Bacteria | 79736 |
| 593 | Ga0501046_0000047 | 3300049580 | Bacteria | 140344 |
| 594 | Ga0501046_0025002 | 3300049580 | Bacteria | 4892 |
| 595 | Ga0501047_0000058 | 3300049581 | Bacteria | 139202 |
| 596 | Ga0501048_0015359 | 3300049582 | Bacteria | 5654 |
| 597 | Ga0501080_0249830 | 3300049742 | Bacteria | 1617 |
| 598 | Ga0501044_0192356 | 3300049823 | Bacteria | 2002 |
| 599 | Ga0501044_0288112 | 3300049823 | Bacteria | 1574 |
| 600 | Ga0501045_0011193 | 3300049824 | Bacteria | 6291 |
| 601 | nmdc:mga03683_31632_c1 | 3300050489 | Bacteria | 2124 |
| 602 | nmdc:mga00v17_44089_c1 | 3300050491 | Bacteria | 2688 |
| 603 | nmdc:mga0yw44_59055_c1 | 3300050492 | Bacteria | 2345 |
| 604 | nmdc:mga0k408_114237_c1 | 3300050493 | Bacteria | 1597 |
| 605 | nmdc:mga0k408_160762_c1 | 3300050493 | Bacteria | 1338 |
| 606 | nmdc:mga0k408_380_c1 | 3300050493 | Bacteria | 3795 |
| 607 | nmdc:mga0k408_8396_c1 | 3300050493 | Bacteria | 5541 |
| 608 | nmdc:mga07m45_1006_c1 | 3300050496 | Bacteria | 12461 |
| 609 | nmdc:mga07m45_14148_c1 | 3300050496 | Bacteria | 4244 |
| 610 | nmdc:mga07m45_15030_c1 | 3300050496 | Bacteria | 4134 |
| 611 | nmdc:mga07m45_59968_c1 | 3300050496 | Bacteria | 2153 |
| 612 | nmdc:mga09592_19951_c1 | 3300050508 | Bacteria | 5506 |
| 613 | nmdc:mga0rr50_275708_c1 | 3300050513 | Bacteria | 1402 |
| 614 | Ga0495601_0025697 | 3300053077 | Bacteria | 3633 |
| 615 | Ga0495601_0041847 | 3300053077 | Bacteria | 2873 |
| 616 | Ga0500578_0001591 | 3300053086 | Bacteria | 22016 |
| 617 | Ga0500578_0070517 | 3300053086 | Bacteria | 2228 |
| 618 | Ga0500594_0003750 | 3300053118 | Bacteria | 3347 |
| 619 | Ga0500595_001402 | 3300053119 | Bacteria | 12939 |
| 620 | Ga0500618_000275 | 3300053125 | Bacteria | 39513 |
| 621 | Ga0500618_001021 | 3300053125 | Bacteria | 14018 |
| 622 | Ga0500618_010431 | 3300053125 | Bacteria | 2493 |
| 623 | Ga0500658_0002746 | 3300053134 | Bacteria | 6770 |
| 624 | Ga0500559_0001885 | 3300053136 | Bacteria | 11382 |
| 625 | Ga0500559_0007805 | 3300053136 | Bacteria | 4726 |
| 626 | Ga0500573_0131774 | 3300053140 | Bacteria | 1384 |
| 627 | Ga0500574_030194 | 3300053141 | Bacteria | 1451 |
| 628 | Ga0500586_000892 | 3300053145 | Bacteria | 6149 |
| 629 | Ga0500619_000212 | 3300053154 | Bacteria | 13317 |
| 630 | Ga0500622_0004245 | 3300053156 | Bacteria | 9115 |
| 631 | Ga0500622_0050455 | 3300053156 | Bacteria | 2144 |
| 632 | Ga0500645_000340 | 3300053730 | Bacteria | 33322 |
| 633 | Ga0500645_004312 | 3300053730 | Bacteria | 5480 |
| 634 | Ga0500587_001066 | 3300053739 | Bacteria | 3747 |
| 635 | Ga0590071_001461 | 3300059421 | Bacteria | 6237 |
| 636 | 2511245820 | 2511231002 | Bacteria | 5042903 |
| 637 | 2511249440 | 2511231003 | Bacteria | 5606035 |
| 638 | 2511387865 | 2511231026 | Bacteria | 5225445 |
| 639 | 2521557844 | 2521172590 | Bacteria | 5047645 |
| 640 | 2550695552 | 2548876994 | Bacteria | 4904866 |
| 641 | 2553002963 | 2551306416 | Bacteria | 6152985 |
| 642 | 2555230294 | 2554235227 | Bacteria | 3637389 |
| 643 | 2643933629 | 2643221585 | Bacteria | 5812563 |
| 644 | 2644030656 | 2643221603 | Bacteria | 6147767 |
| 645 | 2644222006 | 2643221639 | Bacteria | 6649903 |
| 646 | 2644244314 | 2643221644 | Bacteria | 6865017 |
| 647 | 2644253907 | 2643221645 | Bacteria | 7207331 |
| 648 | 2644304817 | 2643221654 | Bacteria | 5273570 |
| 649 | 2644315129 | 2643221656 | Bacteria | 5809961 |
| 650 | 2644356688 | 2643221664 | Bacteria | 7272945 |
| 651 | 2655031310 | 2654587600 | Bacteria | 3911798 |
| 652 | 2723876558 | 2721755763 | Bacteria | 4464185 |
| 653 | 2738742123 | 2738541280 | Bacteria | 6630198 |
| 654 | 2738825082 | 2738541297 | Bacteria | 6549566 |
| 655 | 2738844577 | 2738541300 | Bacteria | 6675882 |
| 656 | 2739055233 | 2738541337 | Bacteria | 6183410 |
| 657 | 2739148879 | 2738541357 | Bacteria | 6549408 |
| 658 | 2739190798 | 2738543003 | Bacteria | 6549560 |
| 659 | 2739276087 | 2738543018 | Bacteria | 6718814 |
| 660 | 2739317275 | 2738543026 | Bacteria | 6549408 |
| 661 | 2739335516 | 2738543029 | Bacteria | 6549249 |
| 662 | 2739345389 | 2738543030 | Bacteria | 6719714 |
| 663 | 2808984524 | 2808606386 | Bacteria | 4471946 |
| 664 | 2809128145 | 2808606415 | Bacteria | 4576710 |
| 665 | 2809151882 | 2808606419 | Bacteria | 4576925 |
| 666 | 2819542555 | 2818991436 | Bacteria | 5376622 |
| 667 | 2819593390 | 2818991445 | Bacteria | 4955017 |
| 668 | 2819615014 | 2818991449 | Bacteria | 5518009 |
| 669 | 2821133682 | 2821131069 | Bacteria | 6108407 |
| 670 | 2837187476 | 2837183177 | Bacteria | 4637169 |
| 671 | 2842717256 | 2842711865 | Bacteria | 7155354 |
| 672 | 2852619902 | 2852618963 | Bacteria | 4577824 |
| 673 | 2857553793 | 2857553236 | Bacteria | 6166726 |
| 674 | 2857560420 | 2857558681 | Bacteria | 6617694 |
| 675 | 2857565476 | 2857564685 | Bacteria | 6290584 |
| 676 | 2881101706 | 2881101125 | Bacteria | 4590519 |
| 677 | 2884814010 | 2884811622 | Bacteria | 5552861 |
| 678 | 2884839918 | 2884836552 | Bacteria | 5219991 |
| 679 | 2884857314 | 2884852848 | Bacteria | 5221161 |
| 680 | 2885192350 | 2885192300 | Bacteria | 5882526 |
| 681 | 2896157901 | 2896154374 | Bacteria | 5221518 |
| 682 | 2904430530 | 2904424332 | Bacteria | 7633521 |
| 683 | 2904441395 | 2904439833 | Bacteria | 5931679 |
| 684 | 2904531668 | 2904530477 | Bacteria | 5876334 |
| 685 | 2904586692 | 2904584206 | Bacteria | 6028872 |
| 686 | 2904593275 | 2904589729 | Bacteria | 6113573 |
| 687 | 2904602881 | 2904601388 | Bacteria | 5884906 |
| 688 | 2919046308 | 2919046199 | Bacteria | 5567169 |
| 689 | 2919079615 | 2919079590 | Bacteria | 5946433 |
| 690 | 2919480417 | 2919476304 | Bacteria | 5888696 |
| 691 | 2923511062 | 2923510766 | Bacteria | 5926163 |
| 692 | 2928131014 | 2928130867 | Bacteria | 5467269 |
| 693 | 2954768340 | 2954767861 | Bacteria | 5535784 |
| 694 | Ga0316576_10051463 | |||
| 695 | JGI25155J39150_1000049 | |||
| 696 | JGI25155J39150_1000174 | |||
| 697 | JGI25156J39149_1000023 | |||
| 698 | JGI25156J39149_1000168 | |||
| 699 | JGI25154J39366_1000036 | |||
| 700 | JGI25154J39366_1000185 | |||
| 701 | JGI25154J39366_1000239 | |||
| 702 | JGI25154J39366_1005780 | |||
| 703 | JGI25157J39369_1000023 | |||
| 704 | JGI25157J39369_1000429 | |||
| 705 | JGI25159J45721_1001259 | |||
| 706 | JGI25151J46595_10033349 | |||
| 707 | JGI25165J46597_1000022 | |||
| 708 | JGI25153J46596_10009345 | |||
| 709 | rootL2_10002393 | |||
| 710 | rootL2_10035151 | |||
| 711 | rootH1_10003102 | |||
| 712 | JGI25160J50197_1000260 | |||
| 713 | JGI25161J50226_1000015 | |||
| 714 | Ga0055538_1000002 | |||
| 715 | Ga0055538_1000011 | |||
| 716 | Ga0055539_1000002 | |||
| 717 | Ga0055539_1000016 | |||
| 718 | Ga0055533_1000004 | |||
| 719 | Ga0055533_1000019 | |||
| 720 | Ga0055532_1000050 | |||
| 721 | Ga0055525_1000002 | |||
| 722 | Ga0055525_1000042 | |||
| 723 | Ga0055529_1000154 | |||
| 724 | Ga0055526_1000166 | |||
| 725 | Ga0055526_1001297 | |||
| 726 | Ga0055526_1003006 | |||
| 727 | Ga0055526_1004954 | |||
| 728 | Ga0055537_1000135 | |||
| 729 | Ga0055524_1000016 | |||
| 730 | Ga0055524_1000094 | |||
| 731 | Ga0055534_1006054 | |||
| 732 | Ga0055528_1001624 | |||
| 733 | Ga0055528_1002120 | |||
| 734 | Ga0055530_10003682 | |||
| 735 | Ga0055540_1000004 | |||
| 736 | Ga0055531_10000011 | |||
| 737 | Ga0055531_10033161 | |||
| 738 | Ga0055541_1000002 | |||
| 739 | Ga0055541_1000017 | |||
| 740 | Ga0055541_1000043 | |||
| 741 | Ga0055543_1000634 | |||
| 742 | Ga0065707_10091325 | |||
| 743 | Ga0070676_10038754 | |||
| 744 | Ga0070683_100015504 | |||
| 745 | Ga0070683_100042472 | |||
| 746 | Ga0070683_100123716 | |||
| 747 | Ga0070690_100008898 | |||
| 748 | Ga0070677_10038511 | |||
| 749 | Ga0068869_100006980 | |||
| 750 | Ga0070666_10002851 | |||
| 751 | Ga0068868_100008007 | |||
| 752 | Ga0070660_100049748 | |||
| 753 | Ga0070660_100121905 | |||
| 754 | Ga0070661_100001791 | |||
| 755 | Ga0070661_100033553 | |||
| 756 | Ga0070669_100050989 | |||
| 757 | Ga0070669_100109499 | |||
| 758 | Ga0070675_100015977 | |||
| 759 | Ga0070671_100005541 | |||
| 760 | Ga0070673_100003452 | |||
| 761 | Ga0070673_100046418 | |||
| 762 | Ga0070659_100001056 | |||
| 763 | Ga0070659_100334610 | |||
| 764 | Ga0070667_100000729 | |||
| 765 | Ga0070667_100005018 | |||
| 766 | Ga0070663_100001214 | |||
| 767 | Ga0070662_100003372 | |||
| 768 | Ga0070681_10002456 | |||
| 769 | Ga0068867_100002085 | |||
| 770 | Ga0068867_100002621 | |||
| 771 | Ga0068867_100047485 | |||
| 772 | Ga0068867_100185450 | |||
| 773 | Ga0070706_100000212 | |||
| 774 | Ga0070699_100007930 | |||
| 775 | Ga0070679_100003476 | |||
| 776 | Ga0070684_100007991 | |||
| 777 | Ga0070684_100009951 | |||
| 778 | Ga0070672_100046830 | |||
| 779 | Ga0070672_100153205 | |||
| 780 | Ga0070672_100231428 | |||
| 781 | Ga0070696_100003597 | |||
| 782 | Ga0068855_100000065 | |||
| 783 | Ga0068855_100005948 | |||
| 784 | Ga0068855_100015197 | |||
| 785 | Ga0070664_100024067 | |||
| 786 | Ga0068854_100100315 | |||
| 787 | Ga0068854_100126436 | |||
| 788 | Ga0068856_100107829 | |||
| 789 | Ga0068852_100021759 | |||
| 790 | Ga0068852_100028333 | |||
| 791 | Ga0068859_100002750 | |||
| 792 | Ga0068859_100205172 | |||
| 793 | Ga0068864_100000758 | |||
| 794 | Ga0068864_100199308 | |||
| 795 | Ga0068861_100005840 | |||
| 796 | Ga0068863_100002927 | |||
| 797 | Ga0068863_100315211 | |||
| 798 | Ga0068858_100002564 | |||
| 799 | Ga0068860_100001303 | |||
| 800 | Ga0075365_10068318 | |||
| 801 | Ga0075364_10035858 | |||
| 802 | Ga0075366_10000553 | |||
| 803 | Ga0075366_10033366 | |||
| 804 | Ga0075366_10065133 | |||
| 805 | Ga0097621_100006649 | |||
| 806 | Ga0075370_10003313 | |||
| 807 | Ga0075370_10062443 | |||
| 808 | Ga0075370_10089373 | |||
| 809 | Ga0075429_100001804 | |||
| 810 | Ga0097620_100002750 | |||
| 811 | Ga0097620_100205185 | |||
| 812 | Ga0079104_1000252 | |||
| 813 | Ga0079104_1013466 | |||
| 814 | Ga0105244_10002725 | |||
| 815 | Ga0105244_10003271 | |||
| 816 | Ga0105244_10060741 | |||
| 817 | Ga0105240_10001127 | |||
| 818 | Ga0105240_10008631 | |||
| 819 | Ga0105240_10021557 | |||
| 820 | Ga0105240_10176843 | |||
| 821 | Ga0105243_10000970 | |||
| 822 | Ga0105241_10038237 | |||
| 823 | Ga0105242_10198623 | |||
| 824 | Ga0105248_10543857 | |||
| 825 | Ga0105237_10000045 | |||
| 826 | Ga0105237_10024607 | |||
| 827 | Ga0105238_10068539 | |||
| 828 | Ga0105238_10125895 | |||
| 829 | Ga0105249_10101094 | |||
| 830 | Ga0105239_10051413 | |||
| 831 | Ga0105239_10109837 | |||
| 832 | Ga0157370_10001801 | |||
| 833 | Ga0157369_10000499 | |||
| 834 | Ga0157369_10060326 | |||
| 835 | Ga0157374_10191144 | |||
| 836 | Ga0157378_10001723 | |||
| 837 | Ga0157378_10029766 | |||
| 838 | Ga0163162_10001695 | |||
| 839 | Ga0163162_10002613 | |||
| 840 | Ga0163162_10015896 | |||
| 841 | Ga0163162_10055825 | |||
| 842 | Ga0163162_10106129 | |||
| 843 | Ga0157372_10010791 | |||
| 844 | Ga0157375_10022368 | |||
| 845 | Ga0157375_10071046 | |||
| 846 | Ga0157375_10238854 | |||
| 847 | Ga0157375_10455459 | |||
| 848 | Ga0163163_10195298 | |||
| 849 | Ga0182008_10017982 | |||
| 850 | Ga0182008_10056288 | |||
| 851 | Ga0157377_10000206 | |||
| 852 | Ga0157377_10044082 | |||
| 853 | Ga0157379_10015979 | |||
| 854 | Ga0157379_10083827 | |||
| 855 | Ga0157379_10350928 | |||
| 856 | Ga0157376_10157266 | |||
| 857 | Ga0182006_1000619 | |||
| 858 | Ga0182006_1004496 | |||
| 859 | Ga0182007_10001487 | |||
| 860 | Ga0182007_10005597 | |||
| 861 | Ga0182007_10041142 | |||
| 862 | Ga0182005_1000020 | |||
| 863 | Ga0182005_1000307 | |||
| 864 | Ga0183362_10001 | |||
| 865 | Ga0163161_10028579 | |||
| 866 | Ga0163161_10061753 | |||
| 867 | Ga0163161_10109882 | |||
| 868 | Ga0213872_10000002 | |||
| 869 | Ga0213872_10000196 | |||
| 870 | Ga0213872_10000245 | |||
| 871 | Ga0213872_10001039 | |||
| 872 | Ga0213872_10002223 | |||
| 873 | Ga0213872_10002318 | |||
| 874 | Ga0213872_10052686 | |||
| 875 | Ga0209435_100001 | |||
| 876 | Ga0209435_100029 | |||
| 877 | Ga0209435_100100 | |||
| 878 | Ga0209760_102646 | |||
| 879 | Ga0209784_100002 | |||
| 880 | Ga0209784_100019 | |||
| 881 | Ga0209566_100003 | |||
| 882 | Ga0209566_100017 | |||
| 883 | Ga0209674_100004 | |||
| 884 | Ga0209674_100031 | |||
| 885 | Ga0209147_100004 | |||
| 886 | Ga0209563_100006 | |||
| 887 | Ga0209563_100035 | |||
| 888 | Ga0207427_100255 | |||
| 889 | Ga0209437_100038 | |||
| 890 | Ga0209258_100396 | |||
| 891 | Ga0207425_1006266 | |||
| 892 | Ga0207425_1007047 | |||
| 893 | Ga0209646_1000001 | |||
| 894 | Ga0209646_1000028 | |||
| 895 | Ga0209646_1000073 | |||
| 896 | Ga0209646_1000109 | |||
| 897 | Ga0209026_1000003 | |||
| 898 | Ga0209026_1000124 | |||
| 899 | Ga0209026_1004094 | |||
| 900 | Ga0209677_100003 | |||
| 901 | Ga0209677_100020 | |||
| 902 | Ga0209759_1000001 | |||
| 903 | Ga0209759_1000108 | |||
| 904 | Ga0209759_1000199 | |||
| 905 | Ga0209233_1000049 | |||
| 906 | Ga0209565_1000004 | |||
| 907 | Ga0209565_1000365 | |||
| 908 | Ga0209455_1000049 | |||
| 909 | Ga0209673_1000045 | |||
| 910 | Ga0209675_1006109 | |||
| 911 | Ga0209676_1009416 | |||
| 912 | Ga0209025_1003445 | |||
| 913 | Ga0209025_1015346 | |||
| 914 | Ga0209564_1000006 | |||
| 915 | Ga0209564_1000514 | |||
| 916 | Ga0209564_1000772 | |||
| 917 | Ga0209564_1001593 | |||
| 918 | Ga0209758_1000149 | |||
| 919 | Ga0209758_1000731 | |||
| 920 | Ga0209050_1000312 | |||
| 921 | Ga0209050_1001248 | |||
| 922 | Ga0209050_1007135 | |||
| 923 | Ga0209050_1016999 | |||
| 924 | Ga0209256_1000001 | |||
| 925 | Ga0209256_1000071 | |||
| 926 | Ga0209051_1000016 | |||
| 927 | Ga0209051_1023432 | |||
| 928 | Ga0209257_1000012 | |||
| 929 | Ga0209257_1000017 | |||
| 930 | Ga0209257_1000045 | |||
| 931 | Ga0209257_1000115 | |||
| 932 | Ga0207655_1005097 | |||
| 933 | Ga0207655_1005150 | |||
| 934 | Ga0207680_10002123 | |||
| 935 | Ga0207645_10004821 | |||
| 936 | Ga0207645_10011352 | |||
| 937 | Ga0207645_10029647 | |||
| 938 | Ga0207643_10096175 | |||
| 939 | Ga0207684_10003587 | |||
| 940 | Ga0207707_10003135 | |||
| 941 | Ga0207695_10000475 | |||
| 942 | Ga0207695_10009018 | |||
| 943 | Ga0207695_10125772 | |||
| 944 | Ga0207671_10047776 | |||
| 945 | Ga0207660_10004817 | |||
| 946 | Ga0207649_10153947 | |||
| 947 | Ga0207652_10069143 | |||
| 948 | Ga0207694_10041422 | |||
| 949 | Ga0207659_10010680 | |||
| 950 | Ga0207644_10005163 | |||
| 951 | Ga0207690_10001069 | |||
| 952 | Ga0207706_10001732 | |||
| 953 | Ga0207709_10000722 | |||
| 954 | Ga0207691_10071778 | |||
| 955 | Ga0207711_10019345 | |||
| 956 | Ga0207711_10044578 | |||
| 957 | Ga0207711_10397681 | |||
| 958 | Ga0207661_10004060 | |||
| 959 | Ga0207679_10136894 | |||
| 960 | Ga0207667_10000025 | |||
| 961 | Ga0207667_10031962 | |||
| 962 | Ga0207667_10040648 | |||
| 963 | Ga0207651_10000549 | |||
| 964 | Ga0207651_10023356 | |||
| 965 | Ga0207712_10100921 | |||
| 966 | Ga0207668_10035893 | |||
| 967 | Ga0207658_10000754 | |||
| 968 | Ga0207658_10002122 | |||
| 969 | Ga0207677_10002505 | |||
| 970 | Ga0207703_10013704 | |||
| 971 | Ga0207678_10032302 | |||
| 972 | Ga0207708_10049450 | |||
| 973 | Ga0207702_10122741 | |||
| 974 | Ga0207641_10011842 | |||
| 975 | Ga0207641_10038381 | |||
| 976 | Ga0207648_10000142 | |||
| 977 | Ga0207648_10002265 | |||
| 978 | Ga0207648_10008041 | |||
| 979 | Ga0207648_10079664 | |||
| 980 | Ga0207676_10001768 | |||
| 981 | Ga0207676_10167827 | |||
| 982 | Ga0207674_10070052 | |||
| 983 | Ga0207675_100000910 | |||
| 984 | Ga0207683_10023727 | |||
| 985 | Ga0207698_10046542 | |||
| 986 | Ga0209281_1000196 | |||
| 987 | Ga0209281_1006108 | |||
| 988 | Ga0209974_10010459 | |||
| 989 | Ga0268265_10187154 | |||
| 990 | Ga0268264_10002772 | |||
| 991 | Ga0307517_10003477 | |||
| 992 | Ga0307515_10000428 | |||
| 993 | Ga0307515_10105774 | |||
| 994 | Ga0307515_10108387 | |||
| 995 | Ga0307512_10078938 | |||
| 996 | Ga0316182_1425617 | |||
| 997 | Ga0265328_10007485 | |||
| 998 | Ga0265331_10022266 | |||
| 999 | Ga0265327_10000120 | |||
| 1000 | Ga0265327_10000689 | |||
| 1001 | Ga0265327_10025410 | |||
| 1002 | Ga0307513_10000010 | |||
| 1003 | Ga0307513_10000121 | |||
| 1004 | Ga0307513_10335186 | |||
| 1005 | Ga0307509_10000120 | |||
| 1006 | Ga0307509_10010566 | |||
| 1007 | Ga0307509_10013191 | |||
| 1008 | Ga0307509_10172684 | |||
| 1009 | Ga0307508_10000094 | |||
| 1010 | Ga0307514_10020110 | |||
| 1011 | Ga0307514_10089187 | |||
| 1012 | Ga0265314_10051576 | |||
| 1013 | Ga0316578_10002384 | |||
| 1014 | Ga0307516_10002590 | |||
| 1015 | Ga0307516_10020562 | |||
| 1016 | Ga0307516_10161410 | |||
| 1017 | Ga0307516_10208254 | |||
| 1018 | Ga0307416_100217368 | |||
| 1019 | Ga0307416_100335284 | |||
| 1020 | Ga0307416_100394523 | |||
| 1021 | Ga0307411_10039870 | |||
| 1022 | Ga0307411_10244191 | |||
| 1023 | Ga0307510_10018226 | |||
| 1024 | Ga0307510_10020396 | |||
| 1025 | Ga0307510_10062199 | |||
| 1026 | Ga0373950_0004559 | |||
| 1027 | Ga0373959_0010704 | |||
| 1028 | Ga0373960_0001500 | |||
| 1029 | Ga0373961_0032485 | |||
| 1030 | Ga0316574_0055178 | |||
| 1031 | Ga0373931_0000478 | |||
| 1032 | Ga0373937_0506550 | |||
| 1033 | Ga0316584_0065115 | |||
| 1034 | Ga0316584_0125588 | |||
| 1035 | Ga0373925_0027565 | |||
| 1036 | Ga0373925_0129907 | |||
| 1037 | Ga0395900_0006543 | |||
| 1038 | Ga0395900_0012541 | |||
| 1039 | Ga0395900_0017455 | |||
| 1040 | Ga0395900_0044155 | |||
| 1041 | Ga0395900_0044524 | |||
| 1042 | Ga0395898_0002485 | |||
| 1043 | Ga0395898_0021948 | |||
| 1044 | Ga0395898_0062080 | |||
| 1045 | Ga0395898_0165067 | |||
| 1046 | Ga0395898_0328594 | |||
| 1047 | Ga0395905_0001291 | |||
| 1048 | Ga0395905_0049775 | |||
| 1049 | Ga0395905_0075445 | |||
| 1050 | Ga0395905_0291146 | |||
| 1051 | Ga0395901_0003007 | |||
| 1052 | Ga0395901_0020218 | |||
| 1053 | Ga0395901_0088864 | |||
| 1054 | Ga0395901_0176114 | |||
| 1055 | Ga0400490_48285 | |||
| 1056 | Ga0436361_0324341 | |||
| 1057 | Ga0436361_0325909 | |||
| 1058 | Ga0436361_0391022 | |||
| 1059 | Ga0436361_0536051 | |||
| 1060 | Ga0436361_0626985 | |||
| 1061 | Ga0436361_0684212 | |||
| 1062 | Ga0436361_0925876 | |||
| 1063 | Ga0436363_0683349 | |||
| 1064 | Ga0439436_0000271 | |||
| 1065 | Ga0439447_014964 | |||
| 1066 | Ga0439461_0005003 | |||
| 1067 | Ga0439465_0000180 | |||
| 1068 | Ga0439431_0000113 | |||
| 1069 | Ga0439445_0000101 | |||
| 1070 | Ga0439432_009440 | |||
| 1071 | Ga0439449_0000486 | |||
| 1072 | Ga0439452_002555 | |||
| 1073 | Ga0439462_0009984 | |||
| 1074 | Ga0450919_000975 | |||
| 1075 | Ga0439434_0001146 | |||
| 1076 | Ga0439464_0008243 | |||
| 1077 | Ga0450918_000074 | |||
| 1078 | Ga0466969_0020269 | |||
| 1079 | Ga0466972_0000005 | |||
| 1080 | Ga0466972_0000323 | |||
| 1081 | Ga0466972_0005646 | |||
| 1082 | Ga0466977_0000251 | |||
| 1083 | Ga0466965_0011250 | |||
| 1084 | Ga0466966_0005559 | |||
| 1085 | Ga0466966_0006944 | |||
| 1086 | Ga0466964_0006578 | |||
| 1087 | Ga0466964_0007499 | |||
| 1088 | Ga0466968_0002113 | |||
| 1089 | Ga0466970_0009910 | |||
| 1090 | Ga0466959_0019390 | |||
| 1091 | Ga0466959_0038621 | |||
| 1092 | Ga0466967_0239055 | |||
| 1093 | Ga0495617_000006 | |||
| 1094 | Ga0495617_000852 | |||
| 1095 | Ga0495617_001340 | |||
| 1096 | Ga0495627_000005 | |||
| 1097 | Ga0495592_0010851 | |||
| 1098 | Ga0495592_0016149 | |||
| 1099 | Ga0495590_0000052 | |||
| 1100 | Ga0495638_0000066 | |||
| 1101 | Ga0495638_0024865 | |||
| 1102 | Ga0495641_0045268 | |||
| 1103 | Ga0495651_0013281 | |||
| 1104 | Ga0495651_0038851 | |||
| 1105 | Ga0495653_0000011 | |||
| 1106 | Ga0495653_0001619 | |||
| 1107 | Ga0495650_0000352 | |||
| 1108 | Ga0495650_0000773 | |||
| 1109 | Ga0495650_0001907 | |||
| 1110 | Ga0495650_0004408 | |||
| 1111 | Ga0495580_0014737 | |||
| 1112 | Ga0495605_0000003 | |||
| 1113 | Ga0495605_0021292 | |||
| 1114 | Ga0495639_0014582 | |||
| 1115 | Ga0495584_0003531 | |||
| 1116 | Ga0495585_0006322 | |||
| 1117 | Ga0495585_0043062 | |||
| 1118 | Ga0495607_0000177 | |||
| 1119 | Ga0495607_0003723 | |||
| 1120 | Ga0495607_0007312 | |||
| 1121 | Ga0495607_0017937 | |||
| 1122 | Ga0495607_0025953 | |||
| 1123 | Ga0495607_0107676 | |||
| 1124 | Ga0495583_0000056 | |||
| 1125 | Ga0495583_0000320 | |||
| 1126 | Ga0495606_0000024 | |||
| 1127 | Ga0495606_0001440 | |||
| 1128 | Ga0495606_0001995 | |||
| 1129 | Ga0495606_0002197 | |||
| 1130 | Ga0495606_0002956 | |||
| 1131 | Ga0495606_0004256 | |||
| 1132 | Ga0495606_0018994 | |||
| 1133 | Ga0495606_0027849 | |||
| 1134 | Ga0495608_0001471 | |||
| 1135 | Ga0495608_0034191 | |||
| 1136 | Ga0495608_0070057 | |||
| 1137 | Ga0495610_0002290 | |||
| 1138 | Ga0495610_0013441 | |||
| 1139 | Ga0495610_0044003 | |||
| 1140 | Ga0495618_0020035 | |||
| 1141 | Ga0495618_0124132 | |||
| 1142 | Ga0495628_0001674 | |||
| 1143 | Ga0495628_0003473 | |||
| 1144 | Ga0495628_0049345 | |||
| 1145 | Ga0495628_0133082 | |||
| 1146 | Ga0495632_0013311 | |||
| 1147 | Ga0495637_0000537 | |||
| 1148 | Ga0495637_0001788 | |||
| 1149 | Ga0495643_0001115 | |||
| 1150 | Ga0495643_0005028 | |||
| 1151 | Ga0495644_0002336 | |||
| 1152 | Ga0495644_0003135 | |||
| 1153 | Ga0495648_0003350 | |||
| 1154 | Ga0495648_0003511 | |||
| 1155 | Ga0495648_0006065 | |||
| 1156 | Ga0495648_0006696 | |||
| 1157 | Ga0495648_0026972 | |||
| 1158 | Ga0495642_0000708 | |||
| 1159 | Ga0495642_0011407 | |||
| 1160 | Ga0495652_0015550 | |||
| 1161 | Ga0495652_0020026 | |||
| 1162 | Ga0495652_0025365 | |||
| 1163 | Ga0495654_0000004 | |||
| 1164 | Ga0495654_0009485 | |||
| 1165 | Ga0495609_0001896 | |||
| 1166 | Ga0495609_0004176 | |||
| 1167 | Ga0495609_0028551 | |||
| 1168 | Ga0495597_0001233 | |||
| 1169 | Ga0495597_0023206 | |||
| 1170 | Ga0495597_0036890 | |||
| 1171 | Ga0495645_0027513 | |||
| 1172 | Ga0495622_0000658 | |||
| 1173 | Ga0495622_0002912 | |||
| 1174 | Ga0495633_0000230 | |||
| 1175 | Ga0495633_0001406 | |||
| 1176 | Ga0495633_0005224 | |||
| 1177 | Ga0495633_0010766 | |||
| 1178 | Ga0495633_0011084 | |||
| 1179 | Ga0495633_0042514 | |||
| 1180 | Ga0495656_0000075 | |||
| 1181 | Ga0495656_0002866 | |||
| 1182 | Ga0495668_0001363 | |||
| 1183 | Ga0495668_0001523 | |||
| 1184 | Ga0495668_0004803 | |||
| 1185 | Ga0495668_0004853 | |||
| 1186 | Ga0495668_0170515 | |||
| 1187 | Ga0495611_0012522 | |||
| 1188 | Ga0495625_0001266 | |||
| 1189 | Ga0495625_0002652 | |||
| 1190 | Ga0495625_0002694 | |||
| 1191 | Ga0495625_0004914 | |||
| 1192 | Ga0495625_0023096 | |||
| 1193 | Ga0495625_0042214 | |||
| 1194 | Ga0495635_0046468 | |||
| 1195 | Ga0495659_0000032 | |||
| 1196 | Ga0495659_0000563 | |||
| 1197 | Ga0495661_0031403 | |||
| 1198 | Ga0495661_0050839 | |||
| 1199 | Ga0495599_0005226 | |||
| 1200 | Ga0495623_0012368 | |||
| 1201 | Ga0495623_0019066 | |||
| 1202 | Ga0495623_0021275 | |||
| 1203 | Ga0495646_0012420 | |||
| 1204 | Ga0495646_0016153 | |||
| 1205 | Ga0495669_0065725 | |||
| 1206 | Ga0495670_0001909 | |||
| 1207 | Ga0495670_0003680 | |||
| 1208 | Ga0495670_0026582 | |||
| 1209 | Ga0495671_0000001 | |||
| 1210 | Ga0495671_0001893 | |||
| 1211 | Ga0495671_0093350 | |||
| 1212 | Ga0495649_0004672 | |||
| 1213 | Ga0495600_0004879 | |||
| 1214 | Ga0495660_0001414 | |||
| 1215 | Ga0495660_0003077 | |||
| 1216 | Ga0495660_0006536 | |||
| 1217 | Ga0495660_0011740 | |||
| 1218 | Ga0495660_0014403 | |||
| 1219 | Ga0495660_0026746 | |||
| 1220 | Ga0495660_0070618 | |||
| 1221 | Ga0495604_0004580 | |||
| 1222 | Ga0495636_0017489 | |||
| 1223 | Ga0495636_0021714 | |||
| 1224 | Ga0495672_0000744 | |||
| 1225 | Ga0495672_0000755 | |||
| 1226 | Ga0495683_0001730 | |||
| 1227 | Ga0495683_0017288 | |||
| 1228 | Ga0495687_001135 | |||
| 1229 | Ga0495687_001350 | |||
| 1230 | Ga0495687_007877 | |||
| 1231 | Ga0495677_0003783 | |||
| 1232 | Ga0495677_0026631 | |||
| 1233 | Ga0495679_022404 | |||
| 1234 | Ga0495685_000023 | |||
| 1235 | Ga0495685_062381 | |||
| 1236 | Ga0495673_0000006 | |||
| 1237 | Ga0495673_0000014 | |||
| 1238 | Ga0495673_0000090 | |||
| 1239 | Ga0495673_0015552 | |||
| 1240 | Ga0495686_0015016 | |||
| 1241 | Ga0495686_0018794 | |||
| 1242 | Ga0495602_0024320 | |||
| 1243 | Ga0495602_0033777 | |||
| 1244 | Ga0495615_0002608 | |||
| 1245 | Ga0496100_0012895 | |||
| 1246 | Ga0496101_0001350 | |||
| 1247 | Ga0496102_0025151 | |||
| 1248 | Ga0496102_0103628 | |||
| 1249 | Ga0496103_0077759 | |||
| 1250 | Ga0496103_0171378 | |||
| 1251 | Ga0496104_0021258 | |||
| 1252 | Ga0496104_0373547 | |||
| 1253 | Ga0496105_0003513 | |||
| 1254 | Ga0496106_0121468 | |||
| 1255 | Ga0496108_0105048 | |||
| 1256 | Ga0496108_0172974 | |||
| 1257 | Ga0496109_0035546 | |||
| 1258 | Ga0496111_0018203 | |||
| 1259 | Ga0496112_0225721 | |||
| 1260 | Ga0496114_0086879 | |||
| 1261 | Ga0496114_0181516 | |||
| 1262 | Ga0496116_0003419 | |||
| 1263 | Ga0496116_0024659 | |||
| 1264 | Ga0496116_0031146 | |||
| 1265 | Ga0496121_0008910 | |||
| 1266 | Ga0496122_0000472 | |||
| 1267 | Ga0496122_0030668 | |||
| 1268 | Ga0496123_0000361 | |||
| 1269 | Ga0496123_0004632 | |||
| 1270 | Ga0496124_0065554 | |||
| 1271 | Ga0496124_0121231 | |||
| 1272 | Ga0496125_0000717 | |||
| 1273 | Ga0496125_0006462 | |||
| 1274 | Ga0496125_0028847 | |||
| 1275 | Ga0496126_0074291 | |||
| 1276 | Ga0495678_000016 | |||
| 1277 | Ga0495678_000096 | |||
| 1278 | Ga0495678_004440 | |||
| 1279 | Ga0495682_0001281 | |||
| 1280 | Ga0495682_0002033 | |||
| 1281 | Ga0501034_0404693 | |||
| 1282 | Ga0501040_0006336 | |||
| 1283 | Ga0501042_0000875 | |||
| 1284 | Ga0501043_0000097 | |||
| 1285 | Ga0501046_0000047 | |||
| 1286 | Ga0501046_0025002 | |||
| 1287 | Ga0501047_0000058 | |||
| 1288 | Ga0501048_0015359 | |||
| 1289 | Ga0501080_0249830 | |||
| 1290 | Ga0501044_0192356 | |||
| 1291 | Ga0501044_0288112 | |||
| 1292 | Ga0501045_0011193 | |||
| 1293 | nmdc:mga03683_31632_c1 | |||
| 1294 | nmdc:mga00v17_44089_c1 | |||
| 1295 | nmdc:mga0yw44_59055_c1 | |||
| 1296 | nmdc:mga0k408_114237_c1 | |||
| 1297 | nmdc:mga0k408_160762_c1 | |||
| 1298 | nmdc:mga0k408_380_c1 | |||
| 1299 | nmdc:mga0k408_8396_c1 | |||
| 1300 | nmdc:mga07m45_1006_c1 | |||
| 1301 | nmdc:mga07m45_14148_c1 | |||
| 1302 | nmdc:mga07m45_15030_c1 | |||
| 1303 | nmdc:mga07m45_59968_c1 | |||
| 1304 | nmdc:mga09592_19951_c1 | |||
| 1305 | nmdc:mga0rr50_275708_c1 | |||
| 1306 | Ga0495601_0025697 | |||
| 1307 | Ga0495601_0041847 | |||
| 1308 | Ga0500578_0001591 | |||
| 1309 | Ga0500578_0070517 | |||
| 1310 | Ga0500594_0003750 | |||
| 1311 | Ga0500595_001402 | |||
| 1312 | Ga0500618_000275 | |||
| 1313 | Ga0500618_001021 | |||
| 1314 | Ga0500618_010431 | |||
| 1315 | Ga0500658_0002746 | |||
| 1316 | Ga0500559_0001885 | |||
| 1317 | Ga0500559_0007805 | |||
| 1318 | Ga0500573_0131774 | |||
| 1319 | Ga0500574_030194 | |||
| 1320 | Ga0500586_000892 | |||
| 1321 | Ga0500619_000212 | |||
| 1322 | Ga0500622_0004245 | |||
| 1323 | Ga0500622_0050455 | |||
| 1324 | Ga0500645_000340 | |||
| 1325 | Ga0500645_004312 | |||
| 1326 | Ga0500587_001066 | |||
| 1327 | Ga0590071_001461 | |||
| 1328 | 2511245820 | |||
| 1329 | 2511249440 | |||
| 1330 | 2511387865 | |||
| 1331 | 2521557844 | |||
| 1332 | 2550695552 | |||
| 1333 | 2553002963 | |||
| 1334 | 2555230294 | |||
| 1335 | 2643933629 | |||
| 1336 | 2644030656 | |||
| 1337 | 2644222006 | |||
| 1338 | 2644244314 | |||
| 1339 | 2644253907 | |||
| 1340 | 2644304817 | |||
| 1341 | 2644315129 | |||
| 1342 | 2644356688 | |||
| 1343 | 2655031310 | |||
| 1344 | 2723876558 | |||
| 1345 | 2738742123 | |||
| 1346 | 2738825082 | |||
| 1347 | 2738844577 | |||
| 1348 | 2739055233 | |||
| 1349 | 2739148879 | |||
| 1350 | 2739190798 | |||
| 1351 | 2739276087 | |||
| 1352 | 2739317275 | |||
| 1353 | 2739335516 | |||
| 1354 | 2739345389 | |||
| 1355 | 2808984524 | |||
| 1356 | 2809128145 | |||
| 1357 | 2809151882 | |||
| 1358 | 2819542555 | |||
| 1359 | 2819593390 | |||
| 1360 | 2819615014 | |||
| 1361 | 2821133682 | |||
| 1362 | 2837187476 | |||
| 1363 | 2842717256 | |||
| 1364 | 2852619902 | |||
| 1365 | 2857553793 | |||
| 1366 | 2857560420 | |||
| 1367 | 2857565476 | |||
| 1368 | 2881101706 | |||
| 1369 | 2884814010 | |||
| 1370 | 2884839918 | |||
| 1371 | 2884857314 | |||
| 1372 | 2885192350 | |||
| 1373 | 2896157901 | |||
| 1374 | 2904430530 | |||
| 1375 | 2904441395 | |||
| 1376 | 2904531668 | |||
| 1377 | 2904586692 | |||
| 1378 | 2904593275 | |||
| 1379 | 2904602881 | |||
| 1380 | 2919046308 | |||
| 1381 | 2919079615 | |||
| 1382 | 2919480417 | |||
| 1383 | 2923511062 | |||
| 1384 | 2928131014 | |||
| 1385 | 2954768340 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.9511 | 32 | 354 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.947 | 33 | 354 |
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.9257 | 32 | 354 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.9217 | 33 | 354 |
| 6b4c-assembly4.cif.gz_D | structure of viperin from trichoderma virens | 0.8164 | 38 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tv8A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9511 | 32 | 354 | 3.20.20.70 |
| af_P9WJS3_16_359_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9337 | 32 | 364 | 3.20.20.70 |
| 1tv8A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9257 | 32 | 354 | 3.20.20.70 |
| af_I1KTQ5_72_400_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9158 | 31 | 376 | 3.20.20.70 |
| af_I1KTQ5_72_400_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9078 | 31 | 376 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N0KGT5-F1-model_v4 | Cyclic pyranopterin phosphate synthase MoaA | 0.9803 | 60 | 333 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-A0A3B9VX85-F1-model_v4 | GTP 3',8-cyclase (EC 4.1.99.22) | 0.9781 | 30 | 353 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-X1CHU4-F1-model_v4 | Molybdenum cofactor biosynthesis protein A-like twitch domain-containing protein | 0.974 | 156 | 283 |
GO:0006777
GO:0051539 GO:0061798 GO:0061799 |
| AF-A0A7W1BPM9-F1-model_v4 | GTP 3',8-cyclase (EC 4.1.99.22) | 0.9736 | 32 | 321 |
GO:0005525
GO:0006777 GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-A0A382M3B8-F1-model_v4 | Radical SAM core domain-containing protein | 0.9715 | 32 | 281 |
GO:0006777
GO:0046872 GO:0051539 GO:0061798 GO:0061799 |