F475460

General Info

Members Datasets Scaffolds Average Seq Length
690 386 1380 153

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10030601|Ga0265313_100306012
Length 144
Sequence MPKIDVAAVPERKGTGYPPQFNAPCAERVRQRLGNAGGLTDFGVNLMRLPPGNWSSQRHWHSHEDEFVYVLEGELTLIEDGGDCAAFPKGTGNGHHMVNRSDAMAVYLEVGSRQPADLTTCSDIDMMSANADGRFVHKDGTPYP

Samples

Sample ID Description Type Environment
1 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
269 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
303 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
311 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
312 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
313 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
316 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
317 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
318 2512875024
319 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
320 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
321 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
322 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
323 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
324 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
325 2643221736 Bosea sp. Root483D1 Isolate Unclassified
326 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
327 2738541293 Rhizobium sp. GV031 Isolate Unclassified
328 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
329 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
330 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
331 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
332 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
333 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
334 2841760612 Bosea sp. Tri-49 Isolate Nodule
335 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
336 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
337 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
338 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
339 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
340 2844104063 Bosea sp. Tri-39 Isolate Nodule
341 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
342 2851246043 Bosea sp. Tri-54 Isolate Nodule
343 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
344 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
345 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
346 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
347 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
348 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
349 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
350 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
351 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
352 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
353 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
354 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
355 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
356 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
357 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
358 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
359 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
360 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
361 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
362 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
363 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
364 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
365 2909042592 Labrys sp. LIt4 Isolate Nodule
366 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
367 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
368 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
369 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
370 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
371 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
372 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
373 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
374 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
375 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
376 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
377 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
378 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
379 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
380 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
381 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
382 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
383 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
384 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
385 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
386 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 0
Isolates 10.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 7.25
Rhizoplane 4.06
Rhizosphere 76.52
Stem 0
Stem Tuber 0
Unclassified 0.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265313_10030601 3300031595 Bacteria 2769
2 MRS1b_contig_8759762 2162886011 Bacteria 1048
3 rootH1_10089477 3300003316 Bacteria 3853
4 rootH1_10187089 3300003323 Bacteria 1946
5 Ga0065712_10086956 3300005290 Bacteria 2607
6 Ga0065707_10014405 3300005295 Bacteria 1888
7 Ga0070658_10018443 3300005327 Bacteria 5586
8 Ga0070658_10053478 3300005327 Bacteria 3277
9 Ga0070658_10179056 3300005327 Bacteria 1784
10 Ga0070658_10607732 3300005327 Bacteria 948
11 Ga0070658_11095568 3300005327 Bacteria 693
12 Ga0070683_100975968 3300005329 Bacteria 813
13 Ga0070690_100001207 3300005330 Bacteria 13352
14 Ga0070690_101309311 3300005330 Bacteria 581
15 Ga0070670_100160687 3300005331 Bacteria 1947
16 Ga0070670_100182808 3300005331 Bacteria 1820
17 Ga0068869_100001173 3300005334 Bacteria 15377
18 Ga0068869_100041558 3300005334 Bacteria 3294
19 Ga0070666_10006559 3300005335 Bacteria 7150
20 Ga0070666_10107266 3300005335 Bacteria 1930
21 Ga0070666_10178562 3300005335 Bacteria 1488
22 Ga0070680_100000100 3300005336 Bacteria 49540
23 Ga0070680_100031230 3300005336 Bacteria 4282
24 Ga0068868_100030920 3300005338 Bacteria 4108
25 Ga0070660_100026765 3300005339 Bacteria 4297
26 Ga0070660_100060488 3300005339 Bacteria 2940
27 Ga0070660_100492611 3300005339 Bacteria 1019
28 Ga0070689_100004919 3300005340 Bacteria 9067
29 Ga0070687_100001063 3300005343 Bacteria 9398
30 Ga0070668_100595548 3300005347 Bacteria 966
31 Ga0070668_101198339 3300005347 Bacteria 688
32 Ga0070675_100004592 3300005354 Bacteria 10544
33 Ga0070671_100013931 3300005355 Bacteria 6489
34 Ga0070671_100025224 3300005355 Bacteria 4877
35 Ga0070671_100570320 3300005355 Bacteria 977
36 Ga0070674_100048580 3300005356 Bacteria 2913
37 Ga0070674_100078461 3300005356 Bacteria 2353
38 Ga0070673_100017107 3300005364 Bacteria 5146
39 Ga0070688_100011830 3300005365 Bacteria 4866
40 Ga0070688_101139585 3300005365 Bacteria 625
41 Ga0070659_100004294 3300005366 Bacteria 10174
42 Ga0070667_100071415 3300005367 Bacteria 2956
43 Ga0070667_100198212 3300005367 Bacteria 1781
44 Ga0070667_100316524 3300005367 Bacteria 1408
45 Ga0070667_100567637 3300005367 Bacteria 1044
46 Ga0070703_10330955 3300005406 Bacteria 644
47 Ga0070713_100106481 3300005436 Bacteria 2438
48 Ga0070701_10083096 3300005438 Bacteria 1738
49 Ga0070701_11244441 3300005438 Bacteria 530
50 Ga0070711_100110907 3300005439 Bacteria 2014
51 Ga0070700_100635299 3300005441 Bacteria 841
52 Ga0070694_100074610 3300005444 Bacteria 2345
53 Ga0070694_100245939 3300005444 Bacteria 1351
54 Ga0070663_100344216 3300005455 Bacteria 1205
55 Ga0070663_100521898 3300005455 Bacteria 989
56 Ga0070663_100946631 3300005455 Bacteria 746
57 Ga0070678_100359171 3300005456 Bacteria 1255
58 Ga0070678_100488187 3300005456 Bacteria 1085
59 Ga0070662_100002203 3300005457 Bacteria 11957
60 Ga0070662_100205085 3300005457 Bacteria 1566
61 Ga0070662_101321290 3300005457 Bacteria 621
62 Ga0070681_10000003 3300005458 Bacteria 252785
63 Ga0070681_10011899 3300005458 Bacteria 8627
64 Ga0070681_10012589 3300005458 Bacteria 8394
65 Ga0070681_10572466 3300005458 Bacteria 1043
66 Ga0068867_100009429 3300005459 Bacteria 6885
67 Ga0070685_10144993 3300005466 Bacteria 1499
68 Ga0070706_100256157 3300005467 Bacteria 1634
69 Ga0070706_101062470 3300005467 Bacteria 746
70 Ga0070707_100962154 3300005468 Bacteria 819
71 Ga0070679_100000617 3300005530 Bacteria 30256
72 Ga0070679_100002859 3300005530 Bacteria 15691
73 Ga0070679_100134472 3300005530 Bacteria 2454
74 Ga0070679_100306407 3300005530 Bacteria 1539
75 Ga0070684_100074972 3300005535 Bacteria 2983
76 Ga0068853_100004867 3300005539 Bacteria 10441
77 Ga0068853_100746552 3300005539 Bacteria 935
78 Ga0068853_101258851 3300005539 Bacteria 715
79 Ga0070672_100005409 3300005543 Bacteria 8460
80 Ga0070672_100315141 3300005543 Bacteria 1329
81 Ga0070686_100000293 3300005544 Bacteria 33629
82 Ga0070695_100028477 3300005545 Bacteria 3467
83 Ga0070693_100215841 3300005547 Bacteria 1254
84 Ga0070665_100012379 3300005548 Bacteria 8598
85 Ga0070665_100029685 3300005548 Bacteria 5502
86 Ga0070665_100043223 3300005548 Bacteria 4529
87 Ga0070665_100076443 3300005548 Bacteria 3355
88 Ga0070665_100111711 3300005548 Bacteria 2735
89 Ga0070665_100261818 3300005548 Bacteria 1731
90 Ga0070665_101361359 3300005548 Bacteria 719
91 Ga0070704_100541308 3300005549 Bacteria 1016
92 Ga0068855_100000010 3300005563 Bacteria 246022
93 Ga0068855_100008942 3300005563 Bacteria 12108
94 Ga0068855_101441640 3300005563 Bacteria 708
95 Ga0070664_100110535 3300005564 Bacteria 2398
96 Ga0070664_100496083 3300005564 Bacteria 1125
97 Ga0068857_100040969 3300005577 Bacteria 4106
98 Ga0068857_100059009 3300005577 Bacteria 3408
99 Ga0068857_100372171 3300005577 Bacteria 1325
100 Ga0068857_100556346 3300005577 Bacteria 1081
101 Ga0068856_100246583 3300005614 Bacteria 1801
102 Ga0070702_100000359 3300005615 Bacteria 15921
103 Ga0068852_100158317 3300005616 Bacteria 2112
104 Ga0068859_100001219 3300005617 Bacteria 26247
105 Ga0068859_100011800 3300005617 Bacteria 8780
106 Ga0068859_101729843 3300005617 Bacteria 691
107 Ga0068864_100008319 3300005618 Bacteria 8558
108 Ga0068864_100241518 3300005618 Bacteria 1674
109 Ga0068866_10236126 3300005718 Bacteria 1111
110 Ga0068861_100001118 3300005719 Bacteria 16634
111 Ga0068861_100091884 3300005719 Bacteria 2397
112 Ga0068861_100126498 3300005719 Bacteria 2068
113 Ga0068861_100348850 3300005719 Bacteria 1298
114 Ga0068870_10127249 3300005840 Bacteria 1475
115 Ga0068863_100013717 3300005841 Bacteria 7812
116 Ga0068863_100052578 3300005841 Bacteria 3860
117 Ga0068863_101424819 3300005841 Bacteria 701
118 Ga0068858_100003828 3300005842 Bacteria 14879
119 Ga0068858_100073512 3300005842 Bacteria 3173
120 Ga0068860_100000274 3300005843 Bacteria 75310
121 Ga0068860_100029840 3300005843 Bacteria 5246
122 Ga0068860_100418628 3300005843 Bacteria 1328
123 Ga0068862_100018205 3300005844 Bacteria 5848
124 Ga0068862_100020732 3300005844 Bacteria 5490
125 Ga0068862_100045872 3300005844 Bacteria 3730
126 Ga0068862_100439597 3300005844 Bacteria 1227
127 Ga0081455_10054938 3300005937 Bacteria 3390
128 Ga0081455_10258515 3300005937 Bacteria 1269
129 Ga0081540_1000213 3300005983 Bacteria 61164
130 Ga0081540_1163641 3300005983 Bacteria 859
131 Ga0070717_10076467 3300006028 Bacteria 2802
132 Ga0075363_100443865 3300006048 Bacteria 766
133 Ga0075364_10031574 3300006051 Bacteria 3403
134 Ga0070712_100715148 3300006175 Bacteria 855
135 Ga0075367_10036025 3300006178 Bacteria 2867
136 Ga0075367_10126195 3300006178 Bacteria 1579
137 Ga0075367_10626924 3300006178 Bacteria 683
138 Ga0097621_100000341 3300006237 Bacteria 31966
139 Ga0097621_100099829 3300006237 Bacteria 2441
140 Ga0097621_100252420 3300006237 Bacteria 1545
141 Ga0097621_100302987 3300006237 Bacteria 1412
142 Ga0068871_100000340 3300006358 Bacteria 32379
143 Ga0068871_100052366 3300006358 Bacteria 3306
144 Ga0075428_100041639 3300006844 Bacteria 5050
145 Ga0075428_100127042 3300006844 Bacteria 2774
146 Ga0075428_100279966 3300006844 Bacteria 1795
147 Ga0075430_100004465 3300006846 Bacteria 11801
148 Ga0075430_100024970 3300006846 Bacteria 5083
149 Ga0075430_100026810 3300006846 Bacteria 4901
150 Ga0075430_100274244 3300006846 Bacteria 1396
151 Ga0075431_100008217 3300006847 Bacteria 10430
152 Ga0075431_100270157 3300006847 Bacteria 1723
153 Ga0075431_100323820 3300006847 Bacteria 1554
154 Ga0075434_100316477 3300006871 Bacteria 1581
155 Ga0075429_100048877 3300006880 Bacteria 3678
156 Ga0075429_100854497 3300006880 Bacteria 797
157 Ga0068865_100039024 3300006881 Bacteria 3219
158 Ga0068865_100046840 3300006881 Bacteria 2968
159 Ga0068865_100287014 3300006881 Bacteria 1312
160 Ga0075436_101278117 3300006914 Bacteria 555
161 Ga0097620_100001219 3300006931 Bacteria 26247
162 Ga0097620_100011800 3300006931 Bacteria 8780
163 Ga0097620_101729808 3300006931 Bacteria 691
164 Ga0075435_100925174 3300007076 Bacteria 761
165 Ga0099795_10319566 3300007788 Bacteria 687
166 Ga0105240_10004725 3300009093 Bacteria 20555
167 Ga0105240_10209355 3300009093 Bacteria 2280
168 Ga0105240_10329580 3300009093 Bacteria 1738
169 Ga0111539_10119717 3300009094 Bacteria 3085
170 Ga0111539_10131475 3300009094 Bacteria 2931
171 Ga0111539_10184948 3300009094 Bacteria 2433
172 Ga0111539_10727918 3300009094 Bacteria 1155
173 Ga0105245_10648350 3300009098 Bacteria 1086
174 Ga0105245_11170708 3300009098 Bacteria 816
175 Ga0105247_10074249 3300009101 Bacteria 2132
176 Ga0105247_10141377 3300009101 Bacteria 1578
177 Ga0114129_10020069 3300009147 Bacteria 9512
178 Ga0114129_10651127 3300009147 Bacteria 1360
179 Ga0105241_10920612 3300009174 Bacteria 813
180 Ga0105242_10235070 3300009176 Bacteria 1644
181 Ga0105248_10002894 3300009177 Bacteria 19051
182 Ga0105248_10121436 3300009177 Bacteria 2947
183 Ga0105248_10304272 3300009177 Bacteria 1795
184 Ga0105248_10329928 3300009177 Bacteria 1718
185 Ga0105248_10421296 3300009177 Bacteria 1504
186 Ga0105248_11630474 3300009177 Bacteria 731
187 Ga0105238_10011351 3300009551 Bacteria 8964
188 Ga0105238_10126632 3300009551 Bacteria 2532
189 Ga0105238_10182225 3300009551 Bacteria 2077
190 Ga0105238_10211660 3300009551 Bacteria 1915
191 Ga0105238_10298174 3300009551 Bacteria 1595
192 Ga0105238_10599671 3300009551 Bacteria 1109
193 Ga0105238_10884063 3300009551 Bacteria 911
194 Ga0105249_10025505 3300009553 Bacteria 5322
195 Ga0105249_10290638 3300009553 Bacteria 1636
196 Ga0105249_10473084 3300009553 Bacteria 1295
197 Ga0105249_10874250 3300009553 Bacteria 965
198 Ga0105239_10012604 3300010375 Bacteria 9407
199 Ga0105239_10094436 3300010375 Bacteria 3304
200 Ga0105239_10328803 3300010375 Bacteria 1724
201 Ga0105239_10335653 3300010375 Bacteria 1705
202 Ga0105246_10610098 3300011119 Bacteria 944
203 Ga0157370_10193841 3300013104 Bacteria 1886
204 Ga0157370_10286872 3300013104 Bacteria 1521
205 Ga0157369_10084640 3300013105 Bacteria 3389
206 Ga0157374_10049581 3300013296 Bacteria 3900
207 Ga0157374_11173703 3300013296 Bacteria 789
208 Ga0157378_10076390 3300013297 Bacteria 3018
209 Ga0163162_10013049 3300013306 Bacteria 8110
210 Ga0163162_10062320 3300013306 Bacteria 3769
211 Ga0157372_10376723 3300013307 Bacteria 1654
212 Ga0157372_10813557 3300013307 Bacteria 1085
213 Ga0157375_10785046 3300013308 Bacteria 1102
214 Ga0157375_10921739 3300013308 Bacteria 1017
215 Ga0163163_10000548 3300014325 Bacteria 32947
216 Ga0163163_10181871 3300014325 Bacteria 2150
217 Ga0163163_10267305 3300014325 Bacteria 1761
218 Ga0163163_10274437 3300014325 Bacteria 1737
219 Ga0163163_11401241 3300014325 Bacteria 761
220 Ga0157380_10008474 3300014326 Bacteria 7343
221 Ga0157380_10015389 3300014326 Bacteria 5622
222 Ga0157380_10173711 3300014326 Bacteria 1886
223 Ga0157380_10654123 3300014326 Bacteria 1049
224 Ga0157377_10020163 3300014745 Bacteria 3490
225 Ga0157379_10002565 3300014968 Bacteria 15242
226 Ga0157379_10062422 3300014968 Bacteria 3332
227 Ga0157379_10104112 3300014968 Bacteria 2547
228 Ga0157379_11395960 3300014968 Bacteria 679
229 Ga0157376_10187475 3300014969 Bacteria 1895
230 Ga0157376_10829731 3300014969 Bacteria 939
231 Ga0183361_10019 3300016635 Bacteria 129849
232 Ga0163161_10024154 3300017792 Bacteria 4293
233 Ga0163161_10504879 3300017792 Bacteria 985
234 Ga0213876_10000199 3300021384 Bacteria 61562
235 Ga0207697_10181202 3300025315 Bacteria 923
236 Ga0207692_10595713 3300025898 Bacteria 710
237 Ga0207642_10244627 3300025899 Bacteria 1015
238 Ga0207642_10278944 3300025899 Bacteria 960
239 Ga0207710_10229939 3300025900 Bacteria 923
240 Ga0207680_10088475 3300025903 Bacteria 1964
241 Ga0207680_10235683 3300025903 Bacteria 1259
242 Ga0207680_10302089 3300025903 Bacteria 1116
243 Ga0207647_10160107 3300025904 Bacteria 1313
244 Ga0207699_10325280 3300025906 Bacteria 1080
245 Ga0207643_10222552 3300025908 Bacteria 1155
246 Ga0207705_10000629 3300025909 Bacteria 29508
247 Ga0207705_10058035 3300025909 Bacteria 2792
248 Ga0207705_10325429 3300025909 Bacteria 1182
249 Ga0207684_10203249 3300025910 Bacteria 1709
250 Ga0207654_10221975 3300025911 Bacteria 1254
251 Ga0207654_10911827 3300025911 Bacteria 637
252 Ga0207707_10000001 3300025912 Bacteria 1212482
253 Ga0207707_10002401 3300025912 Bacteria 16856
254 Ga0207707_10005879 3300025912 Bacteria 10725
255 Ga0207707_10466337 3300025912 Bacteria 1080
256 Ga0207707_10560057 3300025912 Bacteria 970
257 Ga0207695_10029064 3300025913 Bacteria 6117
258 Ga0207695_10167457 3300025913 Bacteria 2125
259 Ga0207695_10576283 3300025913 Bacteria 1007
260 Ga0207671_10164666 3300025914 Bacteria 1719
261 Ga0207671_10201689 3300025914 Bacteria 1554
262 Ga0207671_10367040 3300025914 Bacteria 1143
263 Ga0207660_10000896 3300025917 Bacteria 19600
264 Ga0207660_10006202 3300025917 Bacteria 7764
265 Ga0207662_10002950 3300025918 Bacteria 8646
266 Ga0207657_10000704 3300025919 Bacteria 35496
267 Ga0207657_10021074 3300025919 Bacteria 6143
268 Ga0207649_10043363 3300025920 Bacteria 2750
269 Ga0207649_10119173 3300025920 Bacteria 1777
270 Ga0207649_11373267 3300025920 Bacteria 559
271 Ga0207652_10000413 3300025921 Bacteria 44358
272 Ga0207652_10023321 3300025921 Bacteria 5125
273 Ga0207652_10028700 3300025921 Bacteria 4645
274 Ga0207652_10856262 3300025921 Bacteria 805
275 Ga0207681_10122713 3300025923 Bacteria 1908
276 Ga0207681_10624552 3300025923 Bacteria 892
277 Ga0207694_10000011 3300025924 Bacteria 417640
278 Ga0207694_10254856 3300025924 Bacteria 1436
279 Ga0207694_10367244 3300025924 Bacteria 1193
280 Ga0207650_10119176 3300025925 Bacteria 2052
281 Ga0207659_10066296 3300025926 Bacteria 2620
282 Ga0207659_10651928 3300025926 Bacteria 900
283 Ga0207687_10789665 3300025927 Bacteria 809
284 Ga0207700_10030609 3300025928 Bacteria 3813
285 Ga0207644_10051159 3300025931 Bacteria 2964
286 Ga0207690_10003837 3300025932 Bacteria 8896
287 Ga0207706_10003404 3300025933 Bacteria 15195
288 Ga0207706_10173125 3300025933 Bacteria 1897
289 Ga0207706_10860108 3300025933 Bacteria 768
290 Ga0207686_10035895 3300025934 Bacteria 2979
291 Ga0207686_10047226 3300025934 Bacteria 2661
292 Ga0207670_10004061 3300025936 Bacteria 7836
293 Ga0207669_10027195 3300025937 Bacteria 3127
294 Ga0207669_10058927 3300025937 Bacteria 2346
295 Ga0207669_10266878 3300025937 Bacteria 1283
296 Ga0207704_10022596 3300025938 Bacteria 3374
297 Ga0207704_10139647 3300025938 Bacteria 1693
298 Ga0207704_10254216 3300025938 Bacteria 1321
299 Ga0207665_10192047 3300025939 Bacteria 1484
300 Ga0207691_10035234 3300025940 Bacteria 4647
301 Ga0207711_10094029 3300025941 Bacteria 2641
302 Ga0207711_10164032 3300025941 Bacteria 2013
303 Ga0207711_10853675 3300025941 Bacteria 847
304 Ga0207689_10005748 3300025942 Bacteria 11016
305 Ga0207689_10567411 3300025942 Bacteria 954
306 Ga0207661_10432669 3300025944 Bacteria 1196
307 Ga0207679_10007930 3300025945 Bacteria 6750
308 Ga0207679_10289559 3300025945 Bacteria 1407
309 Ga0207679_10536715 3300025945 Bacteria 1048
310 Ga0207667_10000093 3300025949 Bacteria 145814
311 Ga0207667_10001457 3300025949 Bacteria 29683
312 Ga0207667_10512953 3300025949 Bacteria 1215
313 Ga0207667_11503743 3300025949 Bacteria 644
314 Ga0207651_10053897 3300025960 Bacteria 2752
315 Ga0207712_10137029 3300025961 Bacteria 1873
316 Ga0207712_10197782 3300025961 Bacteria 1591
317 Ga0207712_10318710 3300025961 Bacteria 1282
318 Ga0207712_10399597 3300025961 Bacteria 1155
319 Ga0207712_11268081 3300025961 Bacteria 658
320 Ga0207668_10332320 3300025972 Bacteria 1265
321 Ga0207668_11088671 3300025972 Bacteria 716
322 Ga0207640_10304524 3300025981 Bacteria 1262
323 Ga0207640_10505077 3300025981 Bacteria 1008
324 Ga0207658_10052026 3300025986 Bacteria 3021
325 Ga0207658_10480778 3300025986 Bacteria 1104
326 Ga0207677_10056319 3300026023 Bacteria 2693
327 Ga0207677_10070969 3300026023 Bacteria 2457
328 Ga0207703_10000667 3300026035 Bacteria 34257
329 Ga0207703_10054479 3300026035 Bacteria 3252
330 Ga0207703_10061260 3300026035 Bacteria 3080
331 Ga0207703_10545256 3300026035 Bacteria 1093
332 Ga0207639_10008663 3300026041 Bacteria 6981
333 Ga0207678_10017343 3300026067 Bacteria 6321
334 Ga0207678_10142098 3300026067 Bacteria 2049
335 Ga0207678_10143698 3300026067 Bacteria 2036
336 Ga0207678_11183120 3300026067 Bacteria 677
337 Ga0207708_10082817 3300026075 Bacteria 2467
338 Ga0207708_10740723 3300026075 Bacteria 843
339 Ga0207702_10229681 3300026078 Bacteria 1733
340 Ga0207641_10021368 3300026088 Bacteria 5319
341 Ga0207641_10047015 3300026088 Bacteria 3638
342 Ga0207641_10056202 3300026088 Bacteria 3344
343 Ga0207641_11284295 3300026088 Bacteria 732
344 Ga0207641_11582747 3300026088 Bacteria 657
345 Ga0207648_10004593 3300026089 Bacteria 14152
346 Ga0207676_10574828 3300026095 Bacteria 1079
347 Ga0207676_11076634 3300026095 Bacteria 794
348 Ga0207676_11344747 3300026095 Bacteria 710
349 Ga0207674_10052832 3300026116 Bacteria 4143
350 Ga0207674_10081965 3300026116 Bacteria 3228
351 Ga0207674_10094452 3300026116 Bacteria 2977
352 Ga0207674_10128744 3300026116 Bacteria 2496
353 Ga0207674_11885381 3300026116 Bacteria 564
354 Ga0207675_100001315 3300026118 Bacteria 24901
355 Ga0207675_100053500 3300026118 Bacteria 3766
356 Ga0207675_100162290 3300026118 Bacteria 2132
357 Ga0207675_100170388 3300026118 Bacteria 2081
358 Ga0207675_100667563 3300026118 Bacteria 1046
359 Ga0207683_10009296 3300026121 Bacteria 8374
360 Ga0207683_10024431 3300026121 Bacteria 5205
361 Ga0207683_10078454 3300026121 Bacteria 2926
362 Ga0207683_10095227 3300026121 Bacteria 2654
363 Ga0207698_10280834 3300026142 Bacteria 1540
364 Ga0209813_10054981 3300027866 Bacteria 1256
365 Ga0207428_10281415 3300027907 Bacteria 1234
366 Ga0268266_10000676 3300028379 Bacteria 46038
367 Ga0268266_10010435 3300028379 Bacteria 8116
368 Ga0268266_10014221 3300028379 Bacteria 6846
369 Ga0268266_10054459 3300028379 Bacteria 3437
370 Ga0268266_10136022 3300028379 Bacteria 2201
371 Ga0268266_10199282 3300028379 Bacteria 1831
372 Ga0268266_10215399 3300028379 Bacteria 1763
373 Ga0268265_10002175 3300028380 Bacteria 15165
374 Ga0268265_10024790 3300028380 Bacteria 4249
375 Ga0268265_10276364 3300028380 Bacteria 1501
376 Ga0268265_10462639 3300028380 Bacteria 1187
377 Ga0268264_10000058 3300028381 Bacteria 308956
378 Ga0268264_10000060 3300028381 Bacteria 305056
379 Ga0268264_10072503 3300028381 Bacteria 2920
380 Ga0268264_10365408 3300028381 Bacteria 1378
381 Ga0268264_10857576 3300028381 Bacteria 910
382 Ga0265334_10030844 3300028573 Bacteria 2144
383 Ga0307517_10243806 3300028786 Bacteria 1063
384 Ga0307517_10571011 3300028786 Bacteria 562
385 Ga0265338_10001143 3300028800 Bacteria 43898
386 Ga0265338_10166873 3300028800 Bacteria 1694
387 Ga0265330_10343531 3300031235 Bacteria 630
388 Ga0265325_10000003 3300031241 Bacteria 370490
389 Ga0265325_10093846 3300031241 Bacteria 1476
390 Ga0265329_10016878 3300031242 Bacteria 2524
391 Ga0265340_10018857 3300031247 Bacteria 3555
392 Ga0265340_10054101 3300031247 Bacteria 1937
393 Ga0265339_10008231 3300031249 Bacteria 6650
394 Ga0265331_10007890 3300031250 Bacteria 6103
395 Ga0265331_10018523 3300031250 Bacteria 3608
396 Ga0265331_10027595 3300031250 Bacteria 2845
397 Ga0265316_10042338 3300031344 Bacteria 3641
398 Ga0307513_10029913 3300031456 Bacteria 6194
399 Ga0307513_10034926 3300031456 Bacteria 5633
400 Ga0307513_10098957 3300031456 Bacteria 2946
401 Ga0307509_10015345 3300031507 Bacteria 8942
402 Ga0307408_100200972 3300031548 Bacteria 1613
403 Ga0265313_10002034 3300031595 Bacteria 18144
404 Ga0265313_10003018 3300031595 Bacteria 14000
405 Ga0265314_10097202 3300031711 Bacteria 1903
406 Ga0265314_10614199 3300031711 Bacteria 558
407 Ga0265342_10002356 3300031712 Bacteria 16385
408 Ga0265342_10012225 3300031712 Bacteria 5822
409 Ga0307516_10084087 3300031730 Bacteria 3022
410 Ga0307516_10094375 3300031730 Bacteria 2816
411 Ga0307405_10838922 3300031731 Bacteria 773
412 Ga0307412_10004387 3300031911 Bacteria 7866
413 Ga0307412_10143484 3300031911 Bacteria 1752
414 Ga0307409_101962692 3300031995 Bacteria 615
415 Ga0307510_10000006 3300033180 Bacteria 566474
416 Ga0307510_10045389 3300033180 Bacteria 4745
417 Ga0373940_0079961 3300035088 Bacteria 965
418 Ga0373936_0013587 3300035113 Bacteria 3107
419 Ga0373936_0263960 3300035113 Bacteria 771
420 Ga0373939_0108628 3300035114 Bacteria 963
421 Ga0373943_0564476 3300035170 Bacteria 669
422 Ga0373955_0242971 3300035172 Bacteria 1079
423 Ga0373924_0114098 3300035410 Bacteria 1170
424 Ga0373935_0705821 3300035692 Bacteria 742
425 Ga0373927_0583788 3300035695 Bacteria 739
426 Ga0395899_0000016 3300037312 Bacteria 468322
427 Ga0395899_0118364 3300037312 Bacteria 1899
428 Ga0395900_0009659 3300037418 Bacteria 9892
429 Ga0395900_0207890 3300037418 Bacteria 1977
430 Ga0395900_0472200 3300037418 Bacteria 1208
431 Ga0395898_0265652 3300037466 Bacteria 1636
432 Ga0395898_0303336 3300037466 Bacteria 1523
433 Ga0395905_0000069 3300037471 Bacteria 176869
434 Ga0395905_0090129 3300037471 Bacteria 2875
435 Ga0395905_0132645 3300037471 Bacteria 2343
436 Ga0395905_0337074 3300037471 Bacteria 1399
437 Ga0395905_0477196 3300037471 Bacteria 1146
438 Ga0395905_0511984 3300037471 Bacteria 1100
439 Ga0395901_0069562 3300038443 Bacteria 3666
440 Ga0395901_0209533 3300038443 Bacteria 2040
441 Ga0395901_0262273 3300038443 Bacteria 1798
442 Ga0436365_1372975 3300039437 Bacteria 5412
443 Ga0436365_1490174 3300039437 Bacteria 54443
444 Ga0436361_0664527 3300039447 Bacteria 1449
445 Ga0436363_1145957 3300039450 Bacteria 1982
446 Ga0439464_0150334 3300042439 Bacteria 728
447 Ga0451576_0054973 3300045051 Bacteria 4166
448 Ga0451576_1195248 3300045051 Bacteria 794
449 Ga0466958_0032020 3300045836 Bacteria 3126
450 Ga0495603_0102725 3300046455 Bacteria 1669
451 Ga0495638_0062154 3300046460 Bacteria 2306
452 Ga0495638_0071417 3300046460 Bacteria 2123
453 Ga0495641_0297233 3300046461 Bacteria 728
454 Ga0495650_0107466 3300046471 Bacteria 1040
455 Ga0495650_0269057 3300046471 Bacteria 576
456 Ga0495605_0010891 3300046474 Bacteria 5081
457 Ga0495584_0066387 3300046491 Bacteria 1814
458 Ga0495585_0011902 3300046492 Bacteria 5138
459 Ga0495596_0079222 3300046500 Bacteria 1275
460 Ga0495607_0089028 3300046501 Bacteria 1676
461 Ga0495583_0044568 3300046506 Bacteria 2056
462 Ga0495606_0001322 3300046507 Bacteria 33851
463 Ga0495606_0065099 3300046507 Bacteria 2317
464 Ga0495616_0104150 3300046513 Bacteria 1326
465 Ga0495631_0029015 3300046518 Bacteria 2520
466 Ga0495632_0008560 3300046519 Bacteria 6260
467 Ga0495632_0096025 3300046519 Bacteria 1400
468 Ga0495643_0039959 3300046522 Bacteria 2563
469 Ga0495644_0019674 3300046523 Bacteria 2578
470 Ga0495648_0060366 3300046524 Bacteria 2256
471 Ga0495642_0007283 3300046528 Bacteria 4247
472 Ga0495642_0023925 3300046528 Bacteria 2414
473 Ga0495642_0032391 3300046528 Bacteria 2097
474 Ga0495609_0072871 3300046538 Bacteria 1507
475 Ga0495597_0024058 3300046542 Bacteria 2813
476 Ga0495668_0022559 3300046616 Bacteria 3598
477 Ga0495668_0050954 3300046616 Bacteria 2293
478 Ga0495668_0183060 3300046616 Bacteria 1147
479 Ga0495668_0393483 3300046616 Bacteria 761
480 Ga0495611_0002895 3300046648 Bacteria 7656
481 Ga0495625_0113821 3300046660 Bacteria 1847
482 Ga0495625_0251596 3300046660 Bacteria 1147
483 Ga0495589_0016469 3300046794 Bacteria 3800
484 Ga0495660_0340446 3300046810 Bacteria 669
485 Ga0495636_0374405 3300047318 Bacteria 675
486 Ga0495674_0019683 3300047319 Bacteria 6261
487 Ga0495683_0006861 3300047323 Bacteria 6188
488 Ga0495677_0002863 3300047445 Bacteria 6723
489 Ga0495677_0174596 3300047445 Bacteria 832
490 Ga0495677_0255876 3300047445 Bacteria 685
491 Ga0495685_002965 3300047447 Bacteria 5373
492 Ga0495685_131461 3300047447 Bacteria 818
493 Ga0495681_0054613 3300047470 Bacteria 1866
494 Ga0495686_0005875 3300047472 Bacteria 9568
495 Ga0496100_0015643 3300048903 Bacteria 4433
496 Ga0496100_0045550 3300048903 Bacteria 2816
497 Ga0496100_0361909 3300048903 Bacteria 1098
498 Ga0496101_0056655 3300048904 Bacteria 2834
499 Ga0496101_0491896 3300048904 Bacteria 969
500 Ga0496102_0273956 3300048905 Bacteria 1591
501 Ga0496104_0001121 3300048907 Bacteria 22928
502 Ga0496105_0296556 3300048908 Bacteria 1300
503 Ga0496105_1079276 3300048908 Bacteria 597
504 Ga0496106_0506613 3300048909 Bacteria 969
505 Ga0496107_0577437 3300048910 Bacteria 832
506 Ga0496108_0049676 3300048911 Bacteria 3508
507 Ga0496108_0623182 3300048911 Bacteria 939
508 Ga0496109_0021712 3300048912 Bacteria 5681
509 Ga0496109_0109654 3300048912 Bacteria 2566
510 Ga0496110_0054366 3300048913 Bacteria 3522
511 Ga0496110_0391515 3300048913 Bacteria 1267
512 Ga0496111_0036443 3300048914 Bacteria 3517
513 Ga0496112_0069837 3300048915 Bacteria 3470
514 Ga0496112_0222889 3300048915 Bacteria 1841
515 Ga0496112_0861435 3300048915 Bacteria 829
516 Ga0496112_1221463 3300048915 Bacteria 668
517 Ga0496113_0088614 3300048916 Bacteria 2380
518 Ga0496114_0042505 3300048917 Bacteria 3768
519 Ga0496114_0059861 3300048917 Bacteria 3182
520 Ga0496114_0293527 3300048917 Unclassified 1435
521 Ga0496114_0559175 3300048917 Bacteria 1010
522 Ga0496114_0641134 3300048917 Bacteria 935
523 Ga0496116_0012102 3300048919 Bacteria 7068
524 Ga0496117_0004884 3300048920 Bacteria 14455
525 Ga0496117_0074458 3300048920 Bacteria 2260
526 Ga0496117_0187571 3300048920 Bacteria 1182
527 Ga0496118_0001630 3300048921 Bacteria 33114
528 Ga0496118_0016606 3300048921 Bacteria 6746
529 Ga0496119_0010064 3300048922 Bacteria 7996
530 Ga0496119_0054595 3300048922 Bacteria 2432
531 Ga0496119_0107977 3300048922 Bacteria 1550
532 Ga0496120_0000412 3300048923 Bacteria 68157
533 Ga0496120_0033194 3300048923 Bacteria 3103
534 Ga0496121_0007495 3300048924 Bacteria 13174
535 Ga0496121_0017037 3300048924 Bacteria 7454
536 Ga0496121_0024062 3300048924 Bacteria 5836
537 Ga0496121_0150403 3300048924 Bacteria 1714
538 Ga0496121_0245394 3300048924 Bacteria 1245
539 Ga0496122_0010791 3300048925 Bacteria 9361
540 Ga0496123_0014951 3300048926 Bacteria 6398
541 Ga0496124_0004910 3300048927 Bacteria 15361
542 Ga0496125_0001826 3300048928 Bacteria 29381
543 Ga0496126_0327021 3300048929 Bacteria 1259
544 Ga0496126_0747691 3300048929 Bacteria 755
545 Ga0496126_0839104 3300048929 Bacteria 702
546 Ga0495682_0005529 3300049460 Bacteria 5235
547 Ga0495682_0210090 3300049460 Bacteria 690
548 Ga0501032_0531808 3300049569 Bacteria 750
549 Ga0501036_0455004 3300049572 Bacteria 1066
550 Ga0501036_0498463 3300049572 Bacteria 1013
551 Ga0501037_0544197 3300049573 Bacteria 784
552 Ga0501038_0879840 3300049574 Bacteria 662
553 Ga0501039_0875531 3300049575 Bacteria 700
554 Ga0501039_1529254 3300049575 Unclassified 513
555 Ga0501041_0146184 3300049577 Bacteria 1475
556 Ga0501041_0474816 3300049577 Bacteria 795
557 Ga0501041_0769723 3300049577 Bacteria 617
558 Ga0501042_0129862 3300049578 Bacteria 1816
559 Ga0501042_0366626 3300049578 Bacteria 1042
560 Ga0501046_0462795 3300049580 Bacteria 911
561 Ga0501071_0040460 3300049587 Bacteria 3335
562 Ga0501071_0488857 3300049587 Bacteria 944
563 Ga0501072_0183838 3300049588 Bacteria 1668
564 Ga0501072_0725121 3300049588 Bacteria 781
565 Ga0501072_0790817 3300049588 Bacteria 743
566 Ga0501073_0352755 3300049589 Bacteria 1016
567 Ga0501073_0770026 3300049589 Bacteria 664
568 Ga0501075_1141726 3300049591 Bacteria 591
569 Ga0501076_0174180 3300049592 Bacteria 1754
570 Ga0501076_0293315 3300049592 Bacteria 1332
571 Ga0501076_1564974 3300049592 Bacteria 541
572 Ga0501077_0240515 3300049593 Bacteria 1151
573 Ga0501080_0624361 3300049742 Bacteria 955
574 Ga0501080_0971015 3300049742 Bacteria 738
575 Ga0501081_0430257 3300049743 Bacteria 979
576 Ga0501081_0729605 3300049743 Bacteria 744
577 Ga0501083_0317378 3300049744 Bacteria 1013
578 Ga0501035_0271002 3300049822 Unclassified 1437
579 Ga0501044_0008139 3300049823 Bacteria 11507
580 Ga0501045_0121553 3300049824 Bacteria 1939
581 Ga0501045_0987447 3300049824 Bacteria 617
582 nmdc:mga03683_20631_c1 3300050489 Bacteria 2531
583 nmdc:mga03n38_26439_c1 3300050490 Bacteria 2396
584 nmdc:mga0yw44_23265_c1 3300050492 Bacteria 3488
585 nmdc:mga06z11_164882_c1 3300050494 Bacteria 1269
586 nmdc:mga06z11_17996_c1 3300050494 Bacteria 3219
587 nmdc:mga04h51_47616_c1 3300050495 Bacteria 1425
588 nmdc:mga05p37_101701_c1 3300050507 Bacteria 3539
589 nmdc:mga05p37_270572_c1 3300050507 Bacteria 2030
590 nmdc:mga09592_796195_c1 3300050508 Bacteria 800
591 nmdc:mga0qj67_114907_c1 3300050509 Bacteria 2174
592 nmdc:mga0qj67_217374_c1 3300050509 Bacteria 1552
593 nmdc:mga0qj67_234921_c1 3300050509 Bacteria 1488
594 nmdc:mga0qj67_256711_c1 3300050509 Bacteria 1418
595 nmdc:mga06r32_41095_c1 3300050510 Archaea 4393
596 nmdc:mga06r32_42563_c1 3300050510 Bacteria 4319
597 nmdc:mga08y16_121478_c1 3300050511 Bacteria 2718
598 nmdc:mga08y16_556831_c1 3300050511 Bacteria 1160
599 nmdc:mga0n895_763360_c1 3300050512 Bacteria 959
600 nmdc:mga0n895_813131_c1 3300050512 Bacteria 924
601 nmdc:mga0a205_1169474_c1 3300050515 Bacteria 617
602 nmdc:mga0sz30_498_c1 3300050516 Bacteria 14575
603 Ga0500555_113367 3300053103 Bacteria 681
604 Ga0500591_021093 3300053115 Bacteria 3158
605 Ga0500595_096907 3300053119 Bacteria 849
606 Ga0500642_0085365 3300053130 Bacteria 1454
607 Ga0500652_144470 3300053131 Bacteria 989
608 Ga0500590_126666 3300053148 Bacteria 1188
609 Ga0500590_263529 3300053148 Bacteria 675
610 Ga0500616_0048408 3300053153 Bacteria 2254
611 Ga0500616_0098604 3300053153 Bacteria 1433
612 Ga0500627_0345838 3300053158 Bacteria 642
613 Ga0500630_079480 3300053159 Bacteria 1537
614 Ga0500639_082373 3300053163 Bacteria 1619
615 Ga0500601_000289 3300053737 Bacteria 9554
616 Ga0500661_020008 3300055283 Bacteria 1190
617 Ga0501082_0544786 3300060353 Bacteria 1015
618 Ga0501082_1306347 3300060353 Bacteria 634
619 Ga0530510_0332034 3300061734 Bacteria 1141
620 2503200437 2503198000 Bacteria 6884444
621 2512932195 2512875016 Bacteria 6529530
622 2512960199 2512875024 Bacteria 7195110
623 2513679132 2513237098 Bacteria 9902361
624 2528852430 2528768022 Bacteria 10457665
625 2563063639 2562617112 Bacteria 10918404
626 2585331131 2582581316 Bacteria 7774528
627 2643988020 2643221595 Bacteria 6565519
628 2644158187 2643221627 Bacteria 6761570
629 2644745370 2643221736 Bacteria 6608466
630 2713474519 2711768613 Bacteria 11048459
631 2738800831 2738541293 Bacteria 7065685
632 2756671897 2756170246 Bacteria 7451806
633 2792752089 2791355123 Bacteria 8049106
634 2824672428 2824671348 Bacteria 8369588
635 2824689017 2824687955 Bacteria 8360029
636 2824775438 2824773399 Bacteria 8360218
637 2838123532 2838122688 Bacteria 8803140
638 2841760880 2841760612 Bacteria 6454112
639 2841949632 2841949485 Bacteria 8680857
640 2841958867 2841957949 Bacteria 8652217
641 2841971860 2841966195 Bacteria 8673214
642 2841983644 2841983080 Bacteria 8395090
643 2844008162 2844002411 Bacteria 7168230
644 2844106537 2844104063 Bacteria 6440972
645 2847675301 2847670302 Bacteria 6165597
646 2851246893 2851246043 Bacteria 6439203
647 2856314893 2856314179 Bacteria 6477897
648 2871470247 2871466892 Bacteria 6923287
649 2871502614 2871495908 Bacteria 6935695
650 2876367776 2876363079 Bacteria 6544991
651 2876394040 2876392853 Bacteria 6660880
652 2878042136 2878035449 Bacteria 6555736
653 2878766506 2878760144 Bacteria 6823465
654 2878773702 2878767105 Bacteria 6898628
655 2881167156 2881161766 Bacteria 7127907
656 2881368644 2881364244 Bacteria 7710352
657 2882640636 2882632389 Bacteria 8154593
658 2885308662 2885305155 Bacteria 7348390
659 2885327597 2885326080 Bacteria 7134805
660 2885389287 2885383462 Bacteria 9473874
661 2903521707 2903521522 Bacteria 6525694
662 2903528084 2903528002 Bacteria 6586099
663 2903547655 2903540706 Bacteria 7062119
664 2903771057 2903768456 Bacteria 9749579
665 2904660371 2904659560 Bacteria 6685615
666 2906380421 2906378014 Bacteria 6911440
667 2906419537 2906414383 Bacteria 6580790
668 2906633970 2906626472 Bacteria 8826946
669 2909045762 2909042592 Bacteria 6499737
670 2921643623 2921643360 Bacteria 11448031
671 2929618282 2929615660 Bacteria 9193770
672 2929632470 2929624759 Bacteria 9339455
673 2933580210 2933577622 Bacteria 9116884
674 2938001530 2937994558 Bacteria 7036190
675 2958171684 2958165035 Bacteria 6906348
676 2961115696 2961114664 Bacteria 6680456
677 2961170125 2961163497 Bacteria 6901077
678 2963647012 2963644680 Bacteria 6530403
679 2965024876 2965018300 Bacteria 6883036
680 2968111429 2968110612 Bacteria 6814636
681 2968178517 2968171901 Bacteria 6894245
682 2970561362 2970554993 Bacteria 6814252
683 2977928201 2977922695 Bacteria 6956781
684 2987666366 2987659509 Bacteria 6966464
685 3000139969 3000135777 Bacteria 6891109
686 3004195372 3004188549 Bacteria 6952365
687 3004215407 3004211236 Bacteria 7417683
688 3004225750 3004218560 Bacteria 7421728
689 3004335310 3004334049 Bacteria 8449246
690 8055746129 8055742211 Bacteria 9226248
691 Ga0265313_10030601
692 MRS1b_contig_8759762
693 rootH1_10089477
694 rootH1_10187089
695 Ga0065712_10086956
696 Ga0065707_10014405
697 Ga0070658_10018443
698 Ga0070658_10053478
699 Ga0070658_10179056
700 Ga0070658_10607732
701 Ga0070658_11095568
702 Ga0070683_100975968
703 Ga0070690_100001207
704 Ga0070690_101309311
705 Ga0070670_100160687
706 Ga0070670_100182808
707 Ga0068869_100001173
708 Ga0068869_100041558
709 Ga0070666_10006559
710 Ga0070666_10107266
711 Ga0070666_10178562
712 Ga0070680_100000100
713 Ga0070680_100031230
714 Ga0068868_100030920
715 Ga0070660_100026765
716 Ga0070660_100060488
717 Ga0070660_100492611
718 Ga0070689_100004919
719 Ga0070687_100001063
720 Ga0070668_100595548
721 Ga0070668_101198339
722 Ga0070675_100004592
723 Ga0070671_100013931
724 Ga0070671_100025224
725 Ga0070671_100570320
726 Ga0070674_100048580
727 Ga0070674_100078461
728 Ga0070673_100017107
729 Ga0070688_100011830
730 Ga0070688_101139585
731 Ga0070659_100004294
732 Ga0070667_100071415
733 Ga0070667_100198212
734 Ga0070667_100316524
735 Ga0070667_100567637
736 Ga0070703_10330955
737 Ga0070713_100106481
738 Ga0070701_10083096
739 Ga0070701_11244441
740 Ga0070711_100110907
741 Ga0070700_100635299
742 Ga0070694_100074610
743 Ga0070694_100245939
744 Ga0070663_100344216
745 Ga0070663_100521898
746 Ga0070663_100946631
747 Ga0070678_100359171
748 Ga0070678_100488187
749 Ga0070662_100002203
750 Ga0070662_100205085
751 Ga0070662_101321290
752 Ga0070681_10000003
753 Ga0070681_10011899
754 Ga0070681_10012589
755 Ga0070681_10572466
756 Ga0068867_100009429
757 Ga0070685_10144993
758 Ga0070706_100256157
759 Ga0070706_101062470
760 Ga0070707_100962154
761 Ga0070679_100000617
762 Ga0070679_100002859
763 Ga0070679_100134472
764 Ga0070679_100306407
765 Ga0070684_100074972
766 Ga0068853_100004867
767 Ga0068853_100746552
768 Ga0068853_101258851
769 Ga0070672_100005409
770 Ga0070672_100315141
771 Ga0070686_100000293
772 Ga0070695_100028477
773 Ga0070693_100215841
774 Ga0070665_100012379
775 Ga0070665_100029685
776 Ga0070665_100043223
777 Ga0070665_100076443
778 Ga0070665_100111711
779 Ga0070665_100261818
780 Ga0070665_101361359
781 Ga0070704_100541308
782 Ga0068855_100000010
783 Ga0068855_100008942
784 Ga0068855_101441640
785 Ga0070664_100110535
786 Ga0070664_100496083
787 Ga0068857_100040969
788 Ga0068857_100059009
789 Ga0068857_100372171
790 Ga0068857_100556346
791 Ga0068856_100246583
792 Ga0070702_100000359
793 Ga0068852_100158317
794 Ga0068859_100001219
795 Ga0068859_100011800
796 Ga0068859_101729843
797 Ga0068864_100008319
798 Ga0068864_100241518
799 Ga0068866_10236126
800 Ga0068861_100001118
801 Ga0068861_100091884
802 Ga0068861_100126498
803 Ga0068861_100348850
804 Ga0068870_10127249
805 Ga0068863_100013717
806 Ga0068863_100052578
807 Ga0068863_101424819
808 Ga0068858_100003828
809 Ga0068858_100073512
810 Ga0068860_100000274
811 Ga0068860_100029840
812 Ga0068860_100418628
813 Ga0068862_100018205
814 Ga0068862_100020732
815 Ga0068862_100045872
816 Ga0068862_100439597
817 Ga0081455_10054938
818 Ga0081455_10258515
819 Ga0081540_1000213
820 Ga0081540_1163641
821 Ga0070717_10076467
822 Ga0075363_100443865
823 Ga0075364_10031574
824 Ga0070712_100715148
825 Ga0075367_10036025
826 Ga0075367_10126195
827 Ga0075367_10626924
828 Ga0097621_100000341
829 Ga0097621_100099829
830 Ga0097621_100252420
831 Ga0097621_100302987
832 Ga0068871_100000340
833 Ga0068871_100052366
834 Ga0075428_100041639
835 Ga0075428_100127042
836 Ga0075428_100279966
837 Ga0075430_100004465
838 Ga0075430_100024970
839 Ga0075430_100026810
840 Ga0075430_100274244
841 Ga0075431_100008217
842 Ga0075431_100270157
843 Ga0075431_100323820
844 Ga0075434_100316477
845 Ga0075429_100048877
846 Ga0075429_100854497
847 Ga0068865_100039024
848 Ga0068865_100046840
849 Ga0068865_100287014
850 Ga0075436_101278117
851 Ga0097620_100001219
852 Ga0097620_100011800
853 Ga0097620_101729808
854 Ga0075435_100925174
855 Ga0099795_10319566
856 Ga0105240_10004725
857 Ga0105240_10209355
858 Ga0105240_10329580
859 Ga0111539_10119717
860 Ga0111539_10131475
861 Ga0111539_10184948
862 Ga0111539_10727918
863 Ga0105245_10648350
864 Ga0105245_11170708
865 Ga0105247_10074249
866 Ga0105247_10141377
867 Ga0114129_10020069
868 Ga0114129_10651127
869 Ga0105241_10920612
870 Ga0105242_10235070
871 Ga0105248_10002894
872 Ga0105248_10121436
873 Ga0105248_10304272
874 Ga0105248_10329928
875 Ga0105248_10421296
876 Ga0105248_11630474
877 Ga0105238_10011351
878 Ga0105238_10126632
879 Ga0105238_10182225
880 Ga0105238_10211660
881 Ga0105238_10298174
882 Ga0105238_10599671
883 Ga0105238_10884063
884 Ga0105249_10025505
885 Ga0105249_10290638
886 Ga0105249_10473084
887 Ga0105249_10874250
888 Ga0105239_10012604
889 Ga0105239_10094436
890 Ga0105239_10328803
891 Ga0105239_10335653
892 Ga0105246_10610098
893 Ga0157370_10193841
894 Ga0157370_10286872
895 Ga0157369_10084640
896 Ga0157374_10049581
897 Ga0157374_11173703
898 Ga0157378_10076390
899 Ga0163162_10013049
900 Ga0163162_10062320
901 Ga0157372_10376723
902 Ga0157372_10813557
903 Ga0157375_10785046
904 Ga0157375_10921739
905 Ga0163163_10000548
906 Ga0163163_10181871
907 Ga0163163_10267305
908 Ga0163163_10274437
909 Ga0163163_11401241
910 Ga0157380_10008474
911 Ga0157380_10015389
912 Ga0157380_10173711
913 Ga0157380_10654123
914 Ga0157377_10020163
915 Ga0157379_10002565
916 Ga0157379_10062422
917 Ga0157379_10104112
918 Ga0157379_11395960
919 Ga0157376_10187475
920 Ga0157376_10829731
921 Ga0183361_10019
922 Ga0163161_10024154
923 Ga0163161_10504879
924 Ga0213876_10000199
925 Ga0207697_10181202
926 Ga0207692_10595713
927 Ga0207642_10244627
928 Ga0207642_10278944
929 Ga0207710_10229939
930 Ga0207680_10088475
931 Ga0207680_10235683
932 Ga0207680_10302089
933 Ga0207647_10160107
934 Ga0207699_10325280
935 Ga0207643_10222552
936 Ga0207705_10000629
937 Ga0207705_10058035
938 Ga0207705_10325429
939 Ga0207684_10203249
940 Ga0207654_10221975
941 Ga0207654_10911827
942 Ga0207707_10000001
943 Ga0207707_10002401
944 Ga0207707_10005879
945 Ga0207707_10466337
946 Ga0207707_10560057
947 Ga0207695_10029064
948 Ga0207695_10167457
949 Ga0207695_10576283
950 Ga0207671_10164666
951 Ga0207671_10201689
952 Ga0207671_10367040
953 Ga0207660_10000896
954 Ga0207660_10006202
955 Ga0207662_10002950
956 Ga0207657_10000704
957 Ga0207657_10021074
958 Ga0207649_10043363
959 Ga0207649_10119173
960 Ga0207649_11373267
961 Ga0207652_10000413
962 Ga0207652_10023321
963 Ga0207652_10028700
964 Ga0207652_10856262
965 Ga0207681_10122713
966 Ga0207681_10624552
967 Ga0207694_10000011
968 Ga0207694_10254856
969 Ga0207694_10367244
970 Ga0207650_10119176
971 Ga0207659_10066296
972 Ga0207659_10651928
973 Ga0207687_10789665
974 Ga0207700_10030609
975 Ga0207644_10051159
976 Ga0207690_10003837
977 Ga0207706_10003404
978 Ga0207706_10173125
979 Ga0207706_10860108
980 Ga0207686_10035895
981 Ga0207686_10047226
982 Ga0207670_10004061
983 Ga0207669_10027195
984 Ga0207669_10058927
985 Ga0207669_10266878
986 Ga0207704_10022596
987 Ga0207704_10139647
988 Ga0207704_10254216
989 Ga0207665_10192047
990 Ga0207691_10035234
991 Ga0207711_10094029
992 Ga0207711_10164032
993 Ga0207711_10853675
994 Ga0207689_10005748
995 Ga0207689_10567411
996 Ga0207661_10432669
997 Ga0207679_10007930
998 Ga0207679_10289559
999 Ga0207679_10536715
1000 Ga0207667_10000093
1001 Ga0207667_10001457
1002 Ga0207667_10512953
1003 Ga0207667_11503743
1004 Ga0207651_10053897
1005 Ga0207712_10137029
1006 Ga0207712_10197782
1007 Ga0207712_10318710
1008 Ga0207712_10399597
1009 Ga0207712_11268081
1010 Ga0207668_10332320
1011 Ga0207668_11088671
1012 Ga0207640_10304524
1013 Ga0207640_10505077
1014 Ga0207658_10052026
1015 Ga0207658_10480778
1016 Ga0207677_10056319
1017 Ga0207677_10070969
1018 Ga0207703_10000667
1019 Ga0207703_10054479
1020 Ga0207703_10061260
1021 Ga0207703_10545256
1022 Ga0207639_10008663
1023 Ga0207678_10017343
1024 Ga0207678_10142098
1025 Ga0207678_10143698
1026 Ga0207678_11183120
1027 Ga0207708_10082817
1028 Ga0207708_10740723
1029 Ga0207702_10229681
1030 Ga0207641_10021368
1031 Ga0207641_10047015
1032 Ga0207641_10056202
1033 Ga0207641_11284295
1034 Ga0207641_11582747
1035 Ga0207648_10004593
1036 Ga0207676_10574828
1037 Ga0207676_11076634
1038 Ga0207676_11344747
1039 Ga0207674_10052832
1040 Ga0207674_10081965
1041 Ga0207674_10094452
1042 Ga0207674_10128744
1043 Ga0207674_11885381
1044 Ga0207675_100001315
1045 Ga0207675_100053500
1046 Ga0207675_100162290
1047 Ga0207675_100170388
1048 Ga0207675_100667563
1049 Ga0207683_10009296
1050 Ga0207683_10024431
1051 Ga0207683_10078454
1052 Ga0207683_10095227
1053 Ga0207698_10280834
1054 Ga0209813_10054981
1055 Ga0207428_10281415
1056 Ga0268266_10000676
1057 Ga0268266_10010435
1058 Ga0268266_10014221
1059 Ga0268266_10054459
1060 Ga0268266_10136022
1061 Ga0268266_10199282
1062 Ga0268266_10215399
1063 Ga0268265_10002175
1064 Ga0268265_10024790
1065 Ga0268265_10276364
1066 Ga0268265_10462639
1067 Ga0268264_10000058
1068 Ga0268264_10000060
1069 Ga0268264_10072503
1070 Ga0268264_10365408
1071 Ga0268264_10857576
1072 Ga0265334_10030844
1073 Ga0307517_10243806
1074 Ga0307517_10571011
1075 Ga0265338_10001143
1076 Ga0265338_10166873
1077 Ga0265330_10343531
1078 Ga0265325_10000003
1079 Ga0265325_10093846
1080 Ga0265329_10016878
1081 Ga0265340_10018857
1082 Ga0265340_10054101
1083 Ga0265339_10008231
1084 Ga0265331_10007890
1085 Ga0265331_10018523
1086 Ga0265331_10027595
1087 Ga0265316_10042338
1088 Ga0307513_10029913
1089 Ga0307513_10034926
1090 Ga0307513_10098957
1091 Ga0307509_10015345
1092 Ga0307408_100200972
1093 Ga0265313_10002034
1094 Ga0265313_10003018
1095 Ga0265314_10097202
1096 Ga0265314_10614199
1097 Ga0265342_10002356
1098 Ga0265342_10012225
1099 Ga0307516_10084087
1100 Ga0307516_10094375
1101 Ga0307405_10838922
1102 Ga0307412_10004387
1103 Ga0307412_10143484
1104 Ga0307409_101962692
1105 Ga0307510_10000006
1106 Ga0307510_10045389
1107 Ga0373940_0079961
1108 Ga0373936_0013587
1109 Ga0373936_0263960
1110 Ga0373939_0108628
1111 Ga0373943_0564476
1112 Ga0373955_0242971
1113 Ga0373924_0114098
1114 Ga0373935_0705821
1115 Ga0373927_0583788
1116 Ga0395899_0000016
1117 Ga0395899_0118364
1118 Ga0395900_0009659
1119 Ga0395900_0207890
1120 Ga0395900_0472200
1121 Ga0395898_0265652
1122 Ga0395898_0303336
1123 Ga0395905_0000069
1124 Ga0395905_0090129
1125 Ga0395905_0132645
1126 Ga0395905_0337074
1127 Ga0395905_0477196
1128 Ga0395905_0511984
1129 Ga0395901_0069562
1130 Ga0395901_0209533
1131 Ga0395901_0262273
1132 Ga0436365_1372975
1133 Ga0436365_1490174
1134 Ga0436361_0664527
1135 Ga0436363_1145957
1136 Ga0439464_0150334
1137 Ga0451576_0054973
1138 Ga0451576_1195248
1139 Ga0466958_0032020
1140 Ga0495603_0102725
1141 Ga0495638_0062154
1142 Ga0495638_0071417
1143 Ga0495641_0297233
1144 Ga0495650_0107466
1145 Ga0495650_0269057
1146 Ga0495605_0010891
1147 Ga0495584_0066387
1148 Ga0495585_0011902
1149 Ga0495596_0079222
1150 Ga0495607_0089028
1151 Ga0495583_0044568
1152 Ga0495606_0001322
1153 Ga0495606_0065099
1154 Ga0495616_0104150
1155 Ga0495631_0029015
1156 Ga0495632_0008560
1157 Ga0495632_0096025
1158 Ga0495643_0039959
1159 Ga0495644_0019674
1160 Ga0495648_0060366
1161 Ga0495642_0007283
1162 Ga0495642_0023925
1163 Ga0495642_0032391
1164 Ga0495609_0072871
1165 Ga0495597_0024058
1166 Ga0495668_0022559
1167 Ga0495668_0050954
1168 Ga0495668_0183060
1169 Ga0495668_0393483
1170 Ga0495611_0002895
1171 Ga0495625_0113821
1172 Ga0495625_0251596
1173 Ga0495589_0016469
1174 Ga0495660_0340446
1175 Ga0495636_0374405
1176 Ga0495674_0019683
1177 Ga0495683_0006861
1178 Ga0495677_0002863
1179 Ga0495677_0174596
1180 Ga0495677_0255876
1181 Ga0495685_002965
1182 Ga0495685_131461
1183 Ga0495681_0054613
1184 Ga0495686_0005875
1185 Ga0496100_0015643
1186 Ga0496100_0045550
1187 Ga0496100_0361909
1188 Ga0496101_0056655
1189 Ga0496101_0491896
1190 Ga0496102_0273956
1191 Ga0496104_0001121
1192 Ga0496105_0296556
1193 Ga0496105_1079276
1194 Ga0496106_0506613
1195 Ga0496107_0577437
1196 Ga0496108_0049676
1197 Ga0496108_0623182
1198 Ga0496109_0021712
1199 Ga0496109_0109654
1200 Ga0496110_0054366
1201 Ga0496110_0391515
1202 Ga0496111_0036443
1203 Ga0496112_0069837
1204 Ga0496112_0222889
1205 Ga0496112_0861435
1206 Ga0496112_1221463
1207 Ga0496113_0088614
1208 Ga0496114_0042505
1209 Ga0496114_0059861
1210 Ga0496114_0293527
1211 Ga0496114_0559175
1212 Ga0496114_0641134
1213 Ga0496116_0012102
1214 Ga0496117_0004884
1215 Ga0496117_0074458
1216 Ga0496117_0187571
1217 Ga0496118_0001630
1218 Ga0496118_0016606
1219 Ga0496119_0010064
1220 Ga0496119_0054595
1221 Ga0496119_0107977
1222 Ga0496120_0000412
1223 Ga0496120_0033194
1224 Ga0496121_0007495
1225 Ga0496121_0017037
1226 Ga0496121_0024062
1227 Ga0496121_0150403
1228 Ga0496121_0245394
1229 Ga0496122_0010791
1230 Ga0496123_0014951
1231 Ga0496124_0004910
1232 Ga0496125_0001826
1233 Ga0496126_0327021
1234 Ga0496126_0747691
1235 Ga0496126_0839104
1236 Ga0495682_0005529
1237 Ga0495682_0210090
1238 Ga0501032_0531808
1239 Ga0501036_0455004
1240 Ga0501036_0498463
1241 Ga0501037_0544197
1242 Ga0501038_0879840
1243 Ga0501039_0875531
1244 Ga0501039_1529254
1245 Ga0501041_0146184
1246 Ga0501041_0474816
1247 Ga0501041_0769723
1248 Ga0501042_0129862
1249 Ga0501042_0366626
1250 Ga0501046_0462795
1251 Ga0501071_0040460
1252 Ga0501071_0488857
1253 Ga0501072_0183838
1254 Ga0501072_0725121
1255 Ga0501072_0790817
1256 Ga0501073_0352755
1257 Ga0501073_0770026
1258 Ga0501075_1141726
1259 Ga0501076_0174180
1260 Ga0501076_0293315
1261 Ga0501076_1564974
1262 Ga0501077_0240515
1263 Ga0501080_0624361
1264 Ga0501080_0971015
1265 Ga0501081_0430257
1266 Ga0501081_0729605
1267 Ga0501083_0317378
1268 Ga0501035_0271002
1269 Ga0501044_0008139
1270 Ga0501045_0121553
1271 Ga0501045_0987447
1272 nmdc:mga03683_20631_c1
1273 nmdc:mga03n38_26439_c1
1274 nmdc:mga0yw44_23265_c1
1275 nmdc:mga06z11_164882_c1
1276 nmdc:mga06z11_17996_c1
1277 nmdc:mga04h51_47616_c1
1278 nmdc:mga05p37_101701_c1
1279 nmdc:mga05p37_270572_c1
1280 nmdc:mga09592_796195_c1
1281 nmdc:mga0qj67_114907_c1
1282 nmdc:mga0qj67_217374_c1
1283 nmdc:mga0qj67_234921_c1
1284 nmdc:mga0qj67_256711_c1
1285 nmdc:mga06r32_41095_c1
1286 nmdc:mga06r32_42563_c1
1287 nmdc:mga08y16_121478_c1
1288 nmdc:mga08y16_556831_c1
1289 nmdc:mga0n895_763360_c1
1290 nmdc:mga0n895_813131_c1
1291 nmdc:mga0a205_1169474_c1
1292 nmdc:mga0sz30_498_c1
1293 Ga0500555_113367
1294 Ga0500591_021093
1295 Ga0500595_096907
1296 Ga0500642_0085365
1297 Ga0500652_144470
1298 Ga0500590_126666
1299 Ga0500590_263529
1300 Ga0500616_0048408
1301 Ga0500616_0098604
1302 Ga0500627_0345838
1303 Ga0500630_079480
1304 Ga0500639_082373
1305 Ga0500601_000289
1306 Ga0500661_020008
1307 Ga0501082_0544786
1308 Ga0501082_1306347
1309 Ga0530510_0332034
1310 2503200437
1311 2512932195
1312 2512960199
1313 2513679132
1314 2528852430
1315 2563063639
1316 2585331131
1317 2643988020
1318 2644158187
1319 2644745370
1320 2713474519
1321 2738800831
1322 2756671897
1323 2792752089
1324 2824672428
1325 2824689017
1326 2824775438
1327 2838123532
1328 2841760880
1329 2841949632
1330 2841958867
1331 2841971860
1332 2841983644
1333 2844008162
1334 2844106537
1335 2847675301
1336 2851246893
1337 2856314893
1338 2871470247
1339 2871502614
1340 2876367776
1341 2876394040
1342 2878042136
1343 2878766506
1344 2878773702
1345 2881167156
1346 2881368644
1347 2882640636
1348 2885308662
1349 2885327597
1350 2885389287
1351 2903521707
1352 2903528084
1353 2903547655
1354 2903771057
1355 2904660371
1356 2906380421
1357 2906419537
1358 2906633970
1359 2909045762
1360 2921643623
1361 2929618282
1362 2929632470
1363 2933580210
1364 2938001530
1365 2958171684
1366 2961115696
1367 2961170125
1368 2963647012
1369 2965024876
1370 2968111429
1371 2968178517
1372 2970561362
1373 2977928201
1374 2987666366
1375 3000139969
1376 3004195372
1377 3004215407
1378 3004225750
1379 3004335310
1380 8055746129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

45

111

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9328 2 152
3h8u-assembly1.cif.gz_B crystal structure of uncharacterized conserved protein with double-stranded beta-helix domain (yp_001338853.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.80 a resolution 0.9276 41 119
3i7d-assembly1.cif.gz_A crystal structure of sugar phosphate isomerase from a cupin superfamily spo2919 from silicibacter pomeroyi (yp_168127.1) from silicibacter pomeroyi dss-3 at 2.30 a resolution 0.9154 2 152
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8996 1 120
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8982 41 119
ID Description Score Start End Superfamily
3i7dB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9159 2 152 2.60.120.10
3h8uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9048 41 119 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9005 41 120 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8957 40 121 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8941 41 119 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0A0D1V7-F1-model_v4 Transcriptional regulator 0.9976 1 150 GO:0046872
AF-A0A1I1CL46-F1-model_v4 Uncharacterized conserved protein, cupin superfamily 0.9975 1 150 GO:0046872
AF-A0A3S3F3Z2-F1-model_v4 Cupin domain-containing protein 0.997 1 150 GO:0046872
AF-A0A434VWL6-F1-model_v4 Cupin domain-containing protein 0.9968 18 153 GO:0046872
AF-A0A1C3VQV0-F1-model_v4 Uncharacterized conserved protein, cupin superfamily 0.9967 1 150 GO:0046872

Map