F475441
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 424 | 623 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300006948|Ga0099826_10052996|Ga0099826_100529964 |
| Length | 304 |
| Sequence | MSNPFFMNEQSDAKVAMAANETDRAAQRGIQSIEVGGQLLRALVHHGRPMALKDLAREADMTAAKAHPYMVSFGRLGLIEQDRASGHYLLGPLALQLGLISLQQADPVHIATPLIAEVAQRLGHTVALAVWGARGATIVRTAESPSPVHVNMRHGTVFSLTNTASGRIFAAYIAADTVRQLLDAERQREEKQXXTGEQPPEAGMPPQPPLPSWREFERQLEEVRAHGISRSEGEVIEGVSAMAAPVFDHTGAIVLSVTAIGPAAIFDTAWDGEIARALKACAGTVSGRLGATPAGKSGSGKSGP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 12 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 13 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 14 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 15 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 16 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 17 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 18 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 19 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 20 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 21 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 22 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 23 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 24 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 25 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 26 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 27 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 28 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 29 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 30 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 31 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 32 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 33 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 34 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 35 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 36 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 37 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 38 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 39 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 40 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 41 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 42 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 43 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 44 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 45 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 46 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 47 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 48 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 49 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 50 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 51 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 52 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 53 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 54 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 55 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 56 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 57 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 58 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 59 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 60 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 61 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 62 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 63 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 64 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 65 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 66 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 67 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 68 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 69 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 70 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 71 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 72 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 73 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 74 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 75 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 76 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 77 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 78 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 79 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 80 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 81 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 83 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 84 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 88 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 91 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 93 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 94 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 101 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 102 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 104 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 114 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 115 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 118 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 119 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 120 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 121 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 122 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 123 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 124 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 125 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 126 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 127 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 128 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 129 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 130 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 131 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 132 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 133 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 134 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 135 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 136 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 137 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 138 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 140 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 167 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 169 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 181 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 241 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 242 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 243 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 244 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 245 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 246 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 247 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 248 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 251 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 252 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 253 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 254 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 257 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 262 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 263 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 266 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 271 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 272 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 273 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 274 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 275 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 276 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 277 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 278 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 279 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 280 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 281 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 282 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 283 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 284 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 285 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 286 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 287 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 288 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 289 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 290 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 291 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 292 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 293 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 294 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 295 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 296 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 297 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 298 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 299 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 300 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 365 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 366 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 369 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 370 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 372 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 376 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 380 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 384 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 385 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 387 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 388 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 389 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 390 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 392 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 396 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 397 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 398 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 399 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 400 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 402 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 403 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 404 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 405 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 407 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 413 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 415 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 416 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 419 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 420 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 421 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 422 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 423 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 424 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.71 |
| Metatranscriptomes | 0.58 |
| Isolates | 9.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 28.55 |
| Nodule | 2.75 |
| Rhizoplane | 2.46 |
| Rhizosphere | 54.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_7730667 | 2162886012 | Bacteria | 922 |
| 2 | JGI24740J21852_10050475 | 3300001979 | Bacteria | 1196 |
| 3 | JGI24739J22299_10027556 | 3300001989 | Bacteria | 1985 |
| 4 | JGI25156J39149_1000064 | 3300002705 | Bacteria | 83982 |
| 5 | JGI25154J39366_1002258 | 3300002738 | Bacteria | 5266 |
| 6 | JGI25157J39369_1000083 | 3300002741 | Bacteria | 84002 |
| 7 | JGI25152J39213_1018250 | 3300002773 | Bacteria | 1301 |
| 8 | JGI25150J39212_1002739 | 3300002774 | Bacteria | 4286 |
| 9 | JGI25151J46595_10001531 | 3300003187 | Bacteria | 15448 |
| 10 | JGI25151J46595_10011727 | 3300003187 | Bacteria | 4016 |
| 11 | JGI25165J46597_1004578 | 3300003214 | Bacteria | 2917 |
| 12 | JGI25153J46596_10000500 | 3300003215 | Bacteria | 24942 |
| 13 | JGI25153J46596_10000936 | 3300003215 | Bacteria | 17752 |
| 14 | JGI25153J46596_10003835 | 3300003215 | Bacteria | 8281 |
| 15 | rootH1_10019095 | 3300003316 | Bacteria | 7009 |
| 16 | rootL2_10053149 | 3300003322 | Bacteria | 9797 |
| 17 | rootH1_10024011 | 3300003323 | Bacteria | 4099 |
| 18 | JGI25161J50226_1003212 | 3300003374 | Bacteria | 3838 |
| 19 | Ga0006562J51391_1026631 | 3300003578 | Bacteria | 2770 |
| 20 | Ga0006562J51391_1026633 | 3300003578 | Bacteria | 1760 |
| 21 | Ga0006562J51391_1038713 | 3300003578 | Bacteria | 4420 |
| 22 | Ga0006562J51391_1038717 | 3300003578 | Bacteria | 2880 |
| 23 | Ga0055539_1000154 | 3300003752 | Bacteria | 66426 |
| 24 | Ga0055539_1000635 | 3300003752 | Bacteria | 9391 |
| 25 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 26 | Ga0055535_1000158 | 3300003761 | Bacteria | 72697 |
| 27 | Ga0055542_1000013 | 3300003762 | Bacteria | 387560 |
| 28 | Ga0055526_1001517 | 3300003771 | Bacteria | 16449 |
| 29 | Ga0055537_1000487 | 3300003773 | Bacteria | 24424 |
| 30 | Ga0055536_1021556 | 3300003781 | Bacteria | 1950 |
| 31 | Ga0055534_1000037 | 3300003784 | Bacteria | 107072 |
| 32 | Ga0055534_1002881 | 3300003784 | Bacteria | 5715 |
| 33 | Ga0055530_10003251 | 3300003791 | Bacteria | 9469 |
| 34 | Ga0055540_1002170 | 3300003792 | Bacteria | 10687 |
| 35 | Ga0055540_1005927 | 3300003792 | Bacteria | 4980 |
| 36 | Ga0055540_1010550 | 3300003792 | Bacteria | 3064 |
| 37 | Ga0055531_10009461 | 3300003794 | Bacteria | 4976 |
| 38 | Ga0055531_10016471 | 3300003794 | Bacteria | 3186 |
| 39 | Ga0055543_1003737 | 3300004625 | Bacteria | 4353 |
| 40 | Ga0065165_1000376 | 3300005262 | Bacteria | 72908 |
| 41 | Ga0065165_1000923 | 3300005262 | Bacteria | 37706 |
| 42 | Ga0065165_1001023 | 3300005262 | Bacteria | 33959 |
| 43 | Ga0065714_10079881 | 3300005288 | Bacteria | 2481 |
| 44 | Ga0065715_10370311 | 3300005293 | Bacteria | 922 |
| 45 | Ga0070658_10146278 | 3300005327 | Bacteria | 1976 |
| 46 | Ga0070676_10207342 | 3300005328 | Bacteria | 1288 |
| 47 | Ga0070670_100109513 | 3300005331 | Bacteria | 2380 |
| 48 | Ga0070677_10153572 | 3300005333 | Bacteria | 1074 |
| 49 | Ga0068869_100002518 | 3300005334 | Bacteria | 11059 |
| 50 | Ga0068869_100105892 | 3300005334 | Bacteria | 2134 |
| 51 | Ga0068868_100092650 | 3300005338 | Bacteria | 2435 |
| 52 | Ga0068868_100388576 | 3300005338 | Bacteria | 1202 |
| 53 | Ga0070660_100349103 | 3300005339 | Bacteria | 1218 |
| 54 | Ga0070689_100138203 | 3300005340 | Bacteria | 1958 |
| 55 | Ga0070668_100034898 | 3300005347 | Bacteria | 3833 |
| 56 | Ga0070669_100004753 | 3300005353 | Bacteria | 9794 |
| 57 | Ga0070675_100172353 | 3300005354 | Bacteria | 1867 |
| 58 | Ga0070674_100253115 | 3300005356 | Bacteria | 1384 |
| 59 | Ga0070673_100051895 | 3300005364 | Bacteria | 3215 |
| 60 | Ga0070659_100027906 | 3300005366 | Bacteria | 4354 |
| 61 | Ga0070667_100014913 | 3300005367 | Bacteria | 6419 |
| 62 | Ga0070667_100184786 | 3300005367 | Bacteria | 1845 |
| 63 | Ga0070663_100004721 | 3300005455 | Bacteria | 8038 |
| 64 | Ga0070678_100335929 | 3300005456 | Bacteria | 1294 |
| 65 | Ga0068867_100000020 | 3300005459 | Bacteria | 93210 |
| 66 | Ga0068867_100005069 | 3300005459 | Bacteria | 9302 |
| 67 | Ga0068853_100045517 | 3300005539 | Bacteria | 3758 |
| 68 | Ga0068853_100220761 | 3300005539 | Bacteria | 1731 |
| 69 | Ga0068853_100232238 | 3300005539 | Bacteria | 1688 |
| 70 | Ga0068853_100375795 | 3300005539 | Bacteria | 1326 |
| 71 | Ga0070672_100125337 | 3300005543 | Bacteria | 2106 |
| 72 | Ga0070672_100235466 | 3300005543 | Bacteria | 1539 |
| 73 | Ga0070672_100606073 | 3300005543 | Bacteria | 954 |
| 74 | Ga0070665_100022220 | 3300005548 | Bacteria | 6381 |
| 75 | Ga0070665_100083845 | 3300005548 | Bacteria | 3192 |
| 76 | Ga0070665_100171139 | 3300005548 | Bacteria | 2173 |
| 77 | Ga0070665_100318618 | 3300005548 | Bacteria | 1559 |
| 78 | Ga0070665_100550844 | 3300005548 | Bacteria | 1165 |
| 79 | Ga0070665_100614319 | 3300005548 | Bacteria | 1100 |
| 80 | Ga0068855_100002972 | 3300005563 | Bacteria | 20715 |
| 81 | Ga0068857_100008364 | 3300005577 | Bacteria | 8940 |
| 82 | Ga0068857_100072045 | 3300005577 | Bacteria | 3079 |
| 83 | Ga0068857_100219430 | 3300005577 | Bacteria | 1736 |
| 84 | Ga0068857_100308444 | 3300005577 | Bacteria | 1460 |
| 85 | Ga0068854_100004287 | 3300005578 | Bacteria | 8988 |
| 86 | Ga0068856_100000510 | 3300005614 | Bacteria | 42987 |
| 87 | Ga0068856_100414701 | 3300005614 | Bacteria | 1367 |
| 88 | Ga0068852_100033828 | 3300005616 | Bacteria | 4249 |
| 89 | Ga0068852_100274442 | 3300005616 | Bacteria | 1623 |
| 90 | Ga0068852_100285818 | 3300005616 | Bacteria | 1591 |
| 91 | Ga0068852_100693292 | 3300005616 | Bacteria | 1028 |
| 92 | Ga0068859_100188107 | 3300005617 | Bacteria | 2149 |
| 93 | Ga0068859_100544146 | 3300005617 | Bacteria | 1256 |
| 94 | Ga0068864_100010178 | 3300005618 | Bacteria | 7764 |
| 95 | Ga0068864_100164672 | 3300005618 | Bacteria | 2018 |
| 96 | Ga0068864_100256742 | 3300005618 | Bacteria | 1624 |
| 97 | Ga0068861_100228621 | 3300005719 | Bacteria | 1576 |
| 98 | Ga0068851_10013320 | 3300005834 | Bacteria | 3892 |
| 99 | Ga0068863_100003703 | 3300005841 | Bacteria | 15115 |
| 100 | Ga0068863_100227911 | 3300005841 | Bacteria | 1797 |
| 101 | Ga0068863_100442277 | 3300005841 | Bacteria | 1275 |
| 102 | Ga0068860_100080022 | 3300005843 | Bacteria | 3107 |
| 103 | Ga0068860_100154249 | 3300005843 | Bacteria | 2213 |
| 104 | Ga0068862_100009153 | 3300005844 | Bacteria | 8200 |
| 105 | Ga0075365_10117596 | 3300006038 | Bacteria | 1831 |
| 106 | Ga0075368_10036523 | 3300006042 | Bacteria | 1919 |
| 107 | Ga0075363_100034839 | 3300006048 | Bacteria | 2630 |
| 108 | Ga0075362_10007616 | 3300006177 | Bacteria | 4113 |
| 109 | Ga0075362_10015283 | 3300006177 | Bacteria | 3119 |
| 110 | Ga0075362_10054771 | 3300006177 | Bacteria | 1793 |
| 111 | Ga0075367_10002856 | 3300006178 | Bacteria | 8032 |
| 112 | Ga0075369_10008092 | 3300006186 | Bacteria | 4032 |
| 113 | Ga0075369_10043244 | 3300006186 | Bacteria | 1932 |
| 114 | Ga0075369_10074029 | 3300006186 | Bacteria | 1502 |
| 115 | Ga0075366_10001796 | 3300006195 | Bacteria | 10840 |
| 116 | Ga0075366_10018013 | 3300006195 | Bacteria | 4075 |
| 117 | Ga0075366_10033093 | 3300006195 | Bacteria | 3044 |
| 118 | Ga0075366_10041899 | 3300006195 | Bacteria | 2711 |
| 119 | Ga0075366_10100364 | 3300006195 | Bacteria | 1737 |
| 120 | Ga0075366_10321027 | 3300006195 | Bacteria | 949 |
| 121 | Ga0075370_10000553 | 3300006353 | Bacteria | 14337 |
| 122 | Ga0075370_10004155 | 3300006353 | Bacteria | 6981 |
| 123 | Ga0075370_10007614 | 3300006353 | Bacteria | 5523 |
| 124 | Ga0075370_10008343 | 3300006353 | Bacteria | 5327 |
| 125 | Ga0075370_10009968 | 3300006353 | Bacteria | 4952 |
| 126 | Ga0075370_10029365 | 3300006353 | Bacteria | 3063 |
| 127 | Ga0075370_10035722 | 3300006353 | Bacteria | 2790 |
| 128 | Ga0075370_10106828 | 3300006353 | Bacteria | 1623 |
| 129 | Ga0075370_10162383 | 3300006353 | Bacteria | 1311 |
| 130 | Ga0068871_100129082 | 3300006358 | Bacteria | 2142 |
| 131 | Ga0097620_100188112 | 3300006931 | Bacteria | 2149 |
| 132 | Ga0097620_100544137 | 3300006931 | Bacteria | 1256 |
| 133 | Ga0099826_10007091 | 3300006948 | Bacteria | 8230 |
| 134 | Ga0099826_10052996 | 3300006948 | Bacteria | 2704 |
| 135 | Ga0105244_10018749 | 3300009036 | Bacteria | 3875 |
| 136 | Ga0105240_10001378 | 3300009093 | Bacteria | 41800 |
| 137 | Ga0105240_10083345 | 3300009093 | Bacteria | 3924 |
| 138 | Ga0105240_10139454 | 3300009093 | Bacteria | 2900 |
| 139 | Ga0105240_10236235 | 3300009093 | Bacteria | 2121 |
| 140 | Ga0105245_10149508 | 3300009098 | Bacteria | 2207 |
| 141 | Ga0105245_10254587 | 3300009098 | Bacteria | 1707 |
| 142 | Ga0105245_10724920 | 3300009098 | Bacteria | 1029 |
| 143 | Ga0105243_10001054 | 3300009148 | Bacteria | 25232 |
| 144 | Ga0105243_10001608 | 3300009148 | Bacteria | 19691 |
| 145 | Ga0105243_10004197 | 3300009148 | Bacteria | 11426 |
| 146 | Ga0105243_10464133 | 3300009148 | Bacteria | 1191 |
| 147 | Ga0105241_10098024 | 3300009174 | Bacteria | 2325 |
| 148 | Ga0105241_10237780 | 3300009174 | Bacteria | 1538 |
| 149 | Ga0105242_10108770 | 3300009176 | Bacteria | 2360 |
| 150 | Ga0105242_10273390 | 3300009176 | Bacteria | 1531 |
| 151 | Ga0105248_10094819 | 3300009177 | Bacteria | 3360 |
| 152 | Ga0105237_10001985 | 3300009545 | Bacteria | 26026 |
| 153 | Ga0105237_10021968 | 3300009545 | Bacteria | 6551 |
| 154 | Ga0105237_10203965 | 3300009545 | Bacteria | 1978 |
| 155 | Ga0105238_10083230 | 3300009551 | Bacteria | 3189 |
| 156 | Ga0105239_10001251 | 3300010375 | Bacteria | 34516 |
| 157 | Ga0105239_10029361 | 3300010375 | Bacteria | 6045 |
| 158 | Ga0105239_10086515 | 3300010375 | Bacteria | 3455 |
| 159 | Ga0105239_10121128 | 3300010375 | Bacteria | 2905 |
| 160 | Ga0105246_10105651 | 3300011119 | Bacteria | 2058 |
| 161 | Ga0157347_1001046 | 3300012502 | Bacteria | 2057 |
| 162 | Ga0157373_10015591 | 3300013100 | Bacteria | 5553 |
| 163 | Ga0157371_10025385 | 3300013102 | Bacteria | 4318 |
| 164 | Ga0157370_10030892 | 3300013104 | Bacteria | 5246 |
| 165 | Ga0157370_10046236 | 3300013104 | Bacteria | 4173 |
| 166 | Ga0157370_10492323 | 3300013104 | Bacteria | 1126 |
| 167 | Ga0157369_10029847 | 3300013105 | Bacteria | 6022 |
| 168 | Ga0157378_10063147 | 3300013297 | Bacteria | 3309 |
| 169 | Ga0157372_10066292 | 3300013307 | Bacteria | 4056 |
| 170 | Ga0157375_10188757 | 3300013308 | Bacteria | 2215 |
| 171 | Ga0157375_11010774 | 3300013308 | Bacteria | 971 |
| 172 | Ga0163163_10005824 | 3300014325 | Bacteria | 10713 |
| 173 | Ga0182008_10000255 | 3300014497 | Bacteria | 41477 |
| 174 | Ga0182008_10001524 | 3300014497 | Bacteria | 15422 |
| 175 | Ga0182008_10161193 | 3300014497 | Bacteria | 1129 |
| 176 | Ga0157377_10000032 | 3300014745 | Bacteria | 121003 |
| 177 | Ga0157379_10000772 | 3300014968 | Bacteria | 26002 |
| 178 | Ga0157379_10054798 | 3300014968 | Bacteria | 3563 |
| 179 | Ga0157376_10354300 | 3300014969 | Bacteria | 1406 |
| 180 | Ga0157376_10881770 | 3300014969 | Bacteria | 912 |
| 181 | Ga0182006_1003278 | 3300015261 | Bacteria | 8367 |
| 182 | Ga0182006_1065298 | 3300015261 | Bacteria | 1363 |
| 183 | Ga0182007_10000837 | 3300015262 | Bacteria | 17113 |
| 184 | Ga0182007_10003776 | 3300015262 | Bacteria | 7055 |
| 185 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 186 | Ga0163161_10000304 | 3300017792 | Bacteria | 42860 |
| 187 | Ga0163161_10003838 | 3300017792 | Bacteria | 10536 |
| 188 | Ga0163161_10033820 | 3300017792 | Bacteria | 3653 |
| 189 | Ga0163161_10046519 | 3300017792 | Bacteria | 3131 |
| 190 | Ga0163161_10203266 | 3300017792 | Bacteria | 1527 |
| 191 | Ga0213872_10000077 | 3300021361 | Bacteria | 90250 |
| 192 | Ga0213872_10001319 | 3300021361 | Bacteria | 16438 |
| 193 | Ga0213872_10092643 | 3300021361 | Bacteria | 1351 |
| 194 | Ga0209436_111904 | 3300025208 | Bacteria | 1503 |
| 195 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 196 | Ga0209672_101526 | 3300025228 | Bacteria | 8049 |
| 197 | Ga0209147_100596 | 3300025229 | Bacteria | 19916 |
| 198 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 199 | Ga0209258_100020 | 3300025242 | Bacteria | 565241 |
| 200 | Ga0209258_100424 | 3300025242 | Bacteria | 49640 |
| 201 | Ga0207425_1000652 | 3300025245 | Bacteria | 19165 |
| 202 | Ga0209646_1000129 | 3300025246 | Bacteria | 129401 |
| 203 | Ga0209026_1000059 | 3300025250 | Bacteria | 226652 |
| 204 | Ga0209677_100044 | 3300025253 | Bacteria | 215799 |
| 205 | Ga0209677_100126 | 3300025253 | Bacteria | 78655 |
| 206 | Ga0209148_1000031 | 3300025254 | Bacteria | 564601 |
| 207 | Ga0209148_1000569 | 3300025254 | Bacteria | 34445 |
| 208 | Ga0209759_1000081 | 3300025256 | Bacteria | 169943 |
| 209 | Ga0209759_1004174 | 3300025256 | Bacteria | 5493 |
| 210 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 211 | Ga0209129_1000055 | 3300025258 | Bacteria | 261708 |
| 212 | Ga0209129_1003344 | 3300025258 | Bacteria | 7062 |
| 213 | Ga0209129_1008112 | 3300025258 | Bacteria | 2980 |
| 214 | Ga0209129_1016676 | 3300025258 | Bacteria | 1465 |
| 215 | Ga0209565_1000131 | 3300025263 | Bacteria | 107341 |
| 216 | Ga0209565_1000310 | 3300025263 | Bacteria | 45322 |
| 217 | Ga0209455_1003164 | 3300025272 | Bacteria | 5980 |
| 218 | Ga0209673_1000170 | 3300025273 | Bacteria | 133933 |
| 219 | Ga0209673_1000502 | 3300025273 | Bacteria | 64647 |
| 220 | Ga0209673_1000812 | 3300025273 | Bacteria | 41302 |
| 221 | Ga0209673_1006993 | 3300025273 | Bacteria | 5313 |
| 222 | Ga0209673_1019729 | 3300025273 | Bacteria | 2412 |
| 223 | Ga0209130_1000457 | 3300025284 | Bacteria | 42999 |
| 224 | Ga0209130_1001874 | 3300025284 | Bacteria | 11991 |
| 225 | Ga0209675_1000055 | 3300025291 | Bacteria | 193129 |
| 226 | Ga0209675_1001688 | 3300025291 | Bacteria | 12249 |
| 227 | Ga0209675_1004043 | 3300025291 | Bacteria | 6682 |
| 228 | Ga0209675_1006235 | 3300025291 | Bacteria | 4824 |
| 229 | Ga0209676_1000040 | 3300025292 | Bacteria | 438184 |
| 230 | Ga0209676_1002233 | 3300025292 | Bacteria | 14333 |
| 231 | Ga0209676_1018248 | 3300025292 | Bacteria | 2452 |
| 232 | Ga0209676_1018608 | 3300025292 | Bacteria | 2419 |
| 233 | Ga0209025_1000065 | 3300025294 | Bacteria | 300915 |
| 234 | Ga0209025_1000360 | 3300025294 | Bacteria | 97454 |
| 235 | Ga0209025_1054000 | 3300025294 | Bacteria | 1569 |
| 236 | Ga0209025_1058057 | 3300025294 | Bacteria | 1473 |
| 237 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 238 | Ga0209564_1000803 | 3300025295 | Bacteria | 42999 |
| 239 | Ga0209564_1000832 | 3300025295 | Bacteria | 41822 |
| 240 | Ga0209758_1000042 | 3300025297 | Bacteria | 407145 |
| 241 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 242 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 243 | Ga0209758_1011064 | 3300025297 | Bacteria | 5283 |
| 244 | Ga0209758_1054986 | 3300025297 | Bacteria | 1356 |
| 245 | Ga0209050_1000021 | 3300025298 | Bacteria | 574406 |
| 246 | Ga0209050_1000198 | 3300025298 | Bacteria | 134820 |
| 247 | Ga0209050_1005317 | 3300025298 | Bacteria | 8165 |
| 248 | Ga0209256_1000056 | 3300025299 | Bacteria | 283044 |
| 249 | Ga0209256_1000124 | 3300025299 | Bacteria | 165390 |
| 250 | Ga0207426_1000055 | 3300025302 | Bacteria | 374450 |
| 251 | Ga0207426_1000079 | 3300025302 | Bacteria | 314709 |
| 252 | Ga0207426_1000733 | 3300025302 | Bacteria | 37559 |
| 253 | Ga0209051_1000028 | 3300025303 | Bacteria | 404269 |
| 254 | Ga0209051_1000126 | 3300025303 | Bacteria | 142582 |
| 255 | Ga0209051_1000284 | 3300025303 | Bacteria | 82589 |
| 256 | Ga0209051_1000446 | 3300025303 | Bacteria | 55218 |
| 257 | Ga0209051_1000468 | 3300025303 | Bacteria | 52954 |
| 258 | Ga0209051_1013731 | 3300025303 | Bacteria | 3831 |
| 259 | Ga0209051_1017573 | 3300025303 | Bacteria | 3192 |
| 260 | Ga0209257_1000043 | 3300025304 | Bacteria | 512127 |
| 261 | Ga0209257_1005730 | 3300025304 | Bacteria | 8510 |
| 262 | Ga0209257_1006666 | 3300025304 | Bacteria | 7321 |
| 263 | Ga0207697_10023522 | 3300025315 | Bacteria | 2522 |
| 264 | Ga0207655_1001192 | 3300025728 | Bacteria | 25155 |
| 265 | Ga0207688_10295659 | 3300025901 | Bacteria | 989 |
| 266 | Ga0207680_10371595 | 3300025903 | Bacteria | 1007 |
| 267 | Ga0207645_10054381 | 3300025907 | Bacteria | 2557 |
| 268 | Ga0207645_10116329 | 3300025907 | Bacteria | 1734 |
| 269 | Ga0207705_10312215 | 3300025909 | Bacteria | 1207 |
| 270 | Ga0207654_10070195 | 3300025911 | Bacteria | 2079 |
| 271 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 272 | Ga0207695_10005596 | 3300025913 | Bacteria | 16596 |
| 273 | Ga0207695_10068902 | 3300025913 | Bacteria | 3623 |
| 274 | Ga0207671_10005488 | 3300025914 | Bacteria | 11665 |
| 275 | Ga0207671_10018810 | 3300025914 | Bacteria | 5293 |
| 276 | Ga0207646_10625590 | 3300025922 | Bacteria | 965 |
| 277 | Ga0207681_10011830 | 3300025923 | Bacteria | 5370 |
| 278 | Ga0207694_10011386 | 3300025924 | Bacteria | 6714 |
| 279 | Ga0207659_10179453 | 3300025926 | Bacteria | 1676 |
| 280 | Ga0207659_10273176 | 3300025926 | Bacteria | 1379 |
| 281 | Ga0207687_10102983 | 3300025927 | Bacteria | 2104 |
| 282 | Ga0207644_10100904 | 3300025931 | Bacteria | 2168 |
| 283 | Ga0207690_10070570 | 3300025932 | Bacteria | 2407 |
| 284 | Ga0207706_10008446 | 3300025933 | Bacteria | 9501 |
| 285 | Ga0207709_10000405 | 3300025935 | Bacteria | 42204 |
| 286 | Ga0207709_10000540 | 3300025935 | Bacteria | 32468 |
| 287 | Ga0207709_10000641 | 3300025935 | Bacteria | 28524 |
| 288 | Ga0207669_10231741 | 3300025937 | Bacteria | 1363 |
| 289 | Ga0207691_10051486 | 3300025940 | Bacteria | 3764 |
| 290 | Ga0207691_10202465 | 3300025940 | Bacteria | 1727 |
| 291 | Ga0207691_10541561 | 3300025940 | Bacteria | 987 |
| 292 | Ga0207711_10066136 | 3300025941 | Bacteria | 3126 |
| 293 | Ga0207689_10001840 | 3300025942 | Bacteria | 20078 |
| 294 | Ga0207689_10087242 | 3300025942 | Bacteria | 2564 |
| 295 | Ga0207679_10102797 | 3300025945 | Bacteria | 2238 |
| 296 | Ga0207667_10006390 | 3300025949 | Bacteria | 14286 |
| 297 | Ga0207640_10087059 | 3300025981 | Bacteria | 2152 |
| 298 | Ga0207658_10225921 | 3300025986 | Bacteria | 1577 |
| 299 | Ga0207658_10267498 | 3300025986 | Bacteria | 1459 |
| 300 | Ga0207677_10498021 | 3300026023 | Bacteria | 1053 |
| 301 | Ga0207703_10005673 | 3300026035 | Bacteria | 10020 |
| 302 | Ga0207639_10327512 | 3300026041 | Bacteria | 1362 |
| 303 | Ga0207639_10514563 | 3300026041 | Bacteria | 1095 |
| 304 | Ga0207678_10010915 | 3300026067 | Bacteria | 7981 |
| 305 | Ga0207678_10085010 | 3300026067 | Bacteria | 2705 |
| 306 | Ga0207702_10001084 | 3300026078 | Bacteria | 27885 |
| 307 | Ga0207641_10001425 | 3300026088 | Bacteria | 23532 |
| 308 | Ga0207641_10039299 | 3300026088 | Bacteria | 3957 |
| 309 | Ga0207648_10000172 | 3300026089 | Bacteria | 66986 |
| 310 | Ga0207648_10205389 | 3300026089 | Bacteria | 1748 |
| 311 | Ga0207648_10331307 | 3300026089 | Bacteria | 1369 |
| 312 | Ga0207676_10127809 | 3300026095 | Bacteria | 2155 |
| 313 | Ga0207674_10004452 | 3300026116 | Bacteria | 16839 |
| 314 | Ga0207674_10054335 | 3300026116 | Bacteria | 4078 |
| 315 | Ga0207674_10148313 | 3300026116 | Bacteria | 2303 |
| 316 | Ga0207675_100008948 | 3300026118 | Bacteria | 9394 |
| 317 | Ga0207675_100024421 | 3300026118 | Bacteria | 5620 |
| 318 | Ga0207675_100461354 | 3300026118 | Bacteria | 1260 |
| 319 | Ga0207683_10085054 | 3300026121 | Bacteria | 2812 |
| 320 | Ga0207683_10180203 | 3300026121 | Bacteria | 1915 |
| 321 | Ga0207698_10148354 | 3300026142 | Bacteria | 2032 |
| 322 | Ga0207698_10149030 | 3300026142 | Bacteria | 2028 |
| 323 | Ga0207698_10430343 | 3300026142 | Bacteria | 1269 |
| 324 | Ga0209389_1000057 | 3300027296 | Bacteria | 107632 |
| 325 | Ga0209489_100226 | 3300027361 | Bacteria | 94384 |
| 326 | Ga0209282_1015251 | 3300027666 | Bacteria | 4891 |
| 327 | Ga0268266_10048942 | 3300028379 | Bacteria | 3623 |
| 328 | Ga0268266_10062828 | 3300028379 | Bacteria | 3205 |
| 329 | Ga0268266_10344931 | 3300028379 | Unclassified | 1398 |
| 330 | Ga0268265_10263580 | 3300028380 | Bacteria | 1533 |
| 331 | Ga0268264_10000840 | 3300028381 | Bacteria | 32863 |
| 332 | Ga0268264_10125629 | 3300028381 | Bacteria | 2266 |
| 333 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 334 | Ga0307515_10000292 | 3300028794 | Bacteria | 123160 |
| 335 | Ga0307515_10012210 | 3300028794 | Bacteria | 16189 |
| 336 | Ga0307515_10028818 | 3300028794 | Bacteria | 9418 |
| 337 | Ga0307515_10175176 | 3300028794 | Bacteria | 2119 |
| 338 | Ga0307512_10084254 | 3300030522 | Bacteria | 2261 |
| 339 | Ga0316177_1054210 | 3300030731 | Bacteria | 2421 |
| 340 | Ga0316176_1042109 | 3300030732 | Bacteria | 2727 |
| 341 | Ga0314311_1148034 | 3300030733 | Bacteria | 2577 |
| 342 | Ga0316179_1063319 | 3300030734 | Bacteria | 2728 |
| 343 | Ga0316178_1061531 | 3300030735 | Bacteria | 3914 |
| 344 | Ga0316180_1072720 | 3300030736 | Bacteria | 2657 |
| 345 | Ga0316181_1195265 | 3300030744 | Bacteria | 1199 |
| 346 | Ga0265327_10006724 | 3300031251 | Bacteria | 9099 |
| 347 | Ga0265327_10064913 | 3300031251 | Bacteria | 1848 |
| 348 | Ga0307513_10082898 | 3300031456 | Bacteria | 3299 |
| 349 | Ga0307513_10157352 | 3300031456 | Bacteria | 2170 |
| 350 | Ga0307513_10285062 | 3300031456 | Bacteria | 1427 |
| 351 | Ga0307509_10002541 | 3300031507 | Bacteria | 29347 |
| 352 | Ga0307509_10003190 | 3300031507 | Bacteria | 25358 |
| 353 | Ga0307509_10008176 | 3300031507 | Bacteria | 13398 |
| 354 | Ga0307408_100298433 | 3300031548 | Bacteria | 1348 |
| 355 | Ga0307508_10002422 | 3300031616 | Bacteria | 19675 |
| 356 | Ga0307508_10041228 | 3300031616 | Bacteria | 4144 |
| 357 | Ga0307514_10010952 | 3300031649 | Bacteria | 7569 |
| 358 | Ga0307514_10030903 | 3300031649 | Bacteria | 4296 |
| 359 | Ga0307514_10059933 | 3300031649 | Bacteria | 2906 |
| 360 | Ga0307405_10006552 | 3300031731 | Bacteria | 5736 |
| 361 | Ga0307405_10085115 | 3300031731 | Bacteria | 2077 |
| 362 | Ga0307405_10151302 | 3300031731 | Unclassified | 1632 |
| 363 | Ga0307405_10155211 | 3300031731 | Bacteria | 1614 |
| 364 | Ga0307405_10232283 | 3300031731 | Bacteria | 1360 |
| 365 | Ga0307406_10001733 | 3300031901 | Bacteria | 11962 |
| 366 | Ga0307412_10002474 | 3300031911 | Bacteria | 10281 |
| 367 | Ga0307412_10061291 | 3300031911 | Bacteria | 2528 |
| 368 | Ga0307416_100252834 | 3300032002 | Bacteria | 1716 |
| 369 | Ga0307416_100488055 | 3300032002 | Bacteria | 1293 |
| 370 | Ga0307414_10061159 | 3300032004 | Bacteria | 2666 |
| 371 | Ga0307414_10182326 | 3300032004 | Bacteria | 1690 |
| 372 | Ga0307411_10028523 | 3300032005 | Bacteria | 3395 |
| 373 | Ga0307411_10088536 | 3300032005 | Bacteria | 2153 |
| 374 | Ga0307411_10230712 | 3300032005 | Bacteria | 1442 |
| 375 | Ga0307510_10028597 | 3300033180 | Bacteria | 6365 |
| 376 | Ga0307510_10034134 | 3300033180 | Bacteria | 5701 |
| 377 | Ga0373959_0004443 | 3300034820 | Bacteria | 2262 |
| 378 | Ga0373938_0061488 | 3300034957 | Bacteria | 879 |
| 379 | Ga0373931_0016995 | 3300035691 | Bacteria | 3589 |
| 380 | Ga0373927_0178663 | 3300035695 | Bacteria | 1392 |
| 381 | Ga0373925_0004630 | 3300037068 | Bacteria | 10383 |
| 382 | Ga0373925_0037946 | 3300037068 | Bacteria | 3559 |
| 383 | Ga0395905_0025079 | 3300037471 | Bacteria | 5623 |
| 384 | Ga0395905_0048128 | 3300037471 | Bacteria | 3996 |
| 385 | Ga0395901_0103704 | 3300038443 | Bacteria | 2984 |
| 386 | Ga0436361_0549249 | 3300039447 | Bacteria | 2067 |
| 387 | Ga0436361_0656823 | 3300039447 | Bacteria | 15445 |
| 388 | Ga0436361_1007413 | 3300039447 | Bacteria | 98457 |
| 389 | Ga0439436_0007708 | 3300041404 | Bacteria | 3312 |
| 390 | Ga0439436_0065386 | 3300041404 | Bacteria | 1015 |
| 391 | Ga0439438_045905 | 3300041405 | Bacteria | 1123 |
| 392 | Ga0439439_0012756 | 3300041406 | Bacteria | 2033 |
| 393 | Ga0439439_0022472 | 3300041406 | Bacteria | 1576 |
| 394 | Ga0439461_0023719 | 3300041410 | Bacteria | 1236 |
| 395 | Ga0439466_0013614 | 3300041411 | Bacteria | 2975 |
| 396 | Ga0439466_0042287 | 3300041411 | Bacteria | 1517 |
| 397 | Ga0439465_0027847 | 3300041413 | Bacteria | 1791 |
| 398 | Ga0439465_0030235 | 3300041413 | Bacteria | 1722 |
| 399 | Ga0439431_0005421 | 3300041997 | Bacteria | 2818 |
| 400 | Ga0439433_0004518 | 3300041999 | Bacteria | 2997 |
| 401 | Ga0439433_0019359 | 3300041999 | Bacteria | 1516 |
| 402 | Ga0439442_005912 | 3300042002 | Bacteria | 2452 |
| 403 | Ga0439442_030391 | 3300042002 | Bacteria | 1128 |
| 404 | Ga0439445_0003668 | 3300042004 | Bacteria | 3446 |
| 405 | Ga0439445_0020963 | 3300042004 | Bacteria | 1639 |
| 406 | Ga0439432_017634 | 3300042006 | Bacteria | 2394 |
| 407 | Ga0439432_038634 | 3300042006 | Bacteria | 1519 |
| 408 | Ga0439449_0000129 | 3300042007 | Bacteria | 25430 |
| 409 | Ga0439449_0002894 | 3300042007 | Bacteria | 6676 |
| 410 | Ga0439449_0029030 | 3300042007 | Bacteria | 2061 |
| 411 | Ga0439449_0030220 | 3300042007 | Bacteria | 2018 |
| 412 | Ga0439452_004744 | 3300042010 | Bacteria | 4497 |
| 413 | Ga0439452_008152 | 3300042010 | Bacteria | 3169 |
| 414 | Ga0439455_0012429 | 3300042012 | Bacteria | 1912 |
| 415 | Ga0439457_048077 | 3300042014 | Bacteria | 955 |
| 416 | Ga0439462_0005459 | 3300042015 | Bacteria | 3135 |
| 417 | Ga0439462_0007022 | 3300042015 | Bacteria | 2814 |
| 418 | Ga0450920_009213 | 3300042122 | Bacteria | 1815 |
| 419 | Ga0450894_016750 | 3300042131 | Bacteria | 973 |
| 420 | Ga0450896_018109 | 3300042133 | Bacteria | 1020 |
| 421 | Ga0450898_006695 | 3300042134 | Bacteria | 1776 |
| 422 | Ga0450906_010898 | 3300042145 | Bacteria | 1709 |
| 423 | Ga0450910_004800 | 3300042147 | Bacteria | 1835 |
| 424 | Ga0450910_011193 | 3300042147 | Bacteria | 1285 |
| 425 | Ga0439446_0023379 | 3300042156 | Bacteria | 1758 |
| 426 | Ga0439446_0030573 | 3300042156 | Bacteria | 1556 |
| 427 | Ga0439458_0029867 | 3300042157 | Bacteria | 1295 |
| 428 | Ga0450908_003837 | 3300042184 | Bacteria | 2911 |
| 429 | Ga0450908_011394 | 3300042184 | Bacteria | 1628 |
| 430 | Ga0439434_0007326 | 3300042435 | Bacteria | 3233 |
| 431 | Ga0439464_0005585 | 3300042439 | Bacteria | 3257 |
| 432 | Ga0450918_000547 | 3300042531 | Bacteria | 8038 |
| 433 | Ga0451577_0018260 | 3300042876 | Bacteria | 6463 |
| 434 | Ga0451577_0025149 | 3300042876 | Bacteria | 5405 |
| 435 | Ga0466965_0053922 | 3300044683 | Bacteria | 1999 |
| 436 | Ga0453684_0029308 | 3300044712 | Bacteria | 7822 |
| 437 | Ga0466960_0112699 | 3300044901 | Bacteria | 1415 |
| 438 | Ga0451576_0119829 | 3300045051 | Bacteria | 2740 |
| 439 | Ga0451576_0849025 | 3300045051 | Bacteria | 958 |
| 440 | Ga0466958_0175453 | 3300045836 | Bacteria | 1358 |
| 441 | Ga0466967_0410558 | 3300045976 | Bacteria | 1318 |
| 442 | Ga0495627_009665 | 3300046453 | Bacteria | 3540 |
| 443 | Ga0495592_0341345 | 3300046454 | Bacteria | 963 |
| 444 | Ga0495629_0076852 | 3300046459 | Bacteria | 2331 |
| 445 | Ga0495629_0251351 | 3300046459 | Bacteria | 1216 |
| 446 | Ga0495638_0006701 | 3300046460 | Bacteria | 8346 |
| 447 | Ga0495638_0014632 | 3300046460 | Bacteria | 5294 |
| 448 | Ga0495638_0136434 | 3300046460 | Bacteria | 1436 |
| 449 | Ga0495583_0000149 | 3300046506 | Bacteria | 117980 |
| 450 | Ga0495606_0007595 | 3300046507 | Bacteria | 9648 |
| 451 | Ga0495610_0022677 | 3300046512 | Bacteria | 3429 |
| 452 | Ga0495610_0071874 | 3300046512 | Bacteria | 1612 |
| 453 | Ga0495616_0005630 | 3300046513 | Bacteria | 7667 |
| 454 | Ga0495620_0015656 | 3300046515 | Bacteria | 3822 |
| 455 | Ga0495620_0133003 | 3300046515 | Bacteria | 975 |
| 456 | Ga0495630_0091176 | 3300046517 | Bacteria | 2303 |
| 457 | Ga0495631_0000101 | 3300046518 | Bacteria | 57202 |
| 458 | Ga0495632_0018486 | 3300046519 | Bacteria | 3825 |
| 459 | Ga0495637_0011270 | 3300046520 | Bacteria | 4299 |
| 460 | Ga0495643_0097787 | 3300046522 | Bacteria | 1508 |
| 461 | Ga0495652_0147373 | 3300046529 | Bacteria | 1843 |
| 462 | Ga0495652_0195995 | 3300046529 | Bacteria | 1537 |
| 463 | Ga0495654_0008326 | 3300046530 | Bacteria | 5735 |
| 464 | Ga0495654_0132767 | 3300046530 | Bacteria | 1116 |
| 465 | Ga0495640_0252825 | 3300046533 | Bacteria | 1103 |
| 466 | Ga0495586_0016921 | 3300046535 | Bacteria | 3879 |
| 467 | Ga0495586_0118713 | 3300046535 | Bacteria | 1476 |
| 468 | Ga0495587_0323552 | 3300046536 | Bacteria | 861 |
| 469 | Ga0495621_0013894 | 3300046539 | Bacteria | 2539 |
| 470 | Ga0495621_0039969 | 3300046539 | Bacteria | 1642 |
| 471 | Ga0495622_0118914 | 3300046557 | Bacteria | 1207 |
| 472 | Ga0495633_0092218 | 3300046558 | Bacteria | 1408 |
| 473 | Ga0495656_0002204 | 3300046615 | Bacteria | 6437 |
| 474 | Ga0495668_0047961 | 3300046616 | Bacteria | 2371 |
| 475 | Ga0495668_0058049 | 3300046616 | Bacteria | 2136 |
| 476 | Ga0495668_0135105 | 3300046616 | Bacteria | 1350 |
| 477 | Ga0495625_0000136 | 3300046660 | Bacteria | 114576 |
| 478 | Ga0495625_0008517 | 3300046660 | Bacteria | 8740 |
| 479 | Ga0495635_0002221 | 3300046663 | Bacteria | 13191 |
| 480 | Ga0495635_0166675 | 3300046663 | Bacteria | 1499 |
| 481 | Ga0495657_0009715 | 3300046675 | Bacteria | 7274 |
| 482 | Ga0495599_0440838 | 3300046678 | Bacteria | 772 |
| 483 | Ga0495646_0244703 | 3300046680 | Bacteria | 963 |
| 484 | Ga0495658_0055161 | 3300046683 | Bacteria | 2263 |
| 485 | Ga0495658_0094286 | 3300046683 | Bacteria | 1778 |
| 486 | Ga0495658_0110643 | 3300046683 | Bacteria | 1651 |
| 487 | Ga0495613_0040359 | 3300046689 | Bacteria | 3459 |
| 488 | Ga0495624_0018282 | 3300046690 | Bacteria | 4689 |
| 489 | Ga0495624_0189034 | 3300046690 | Bacteria | 1253 |
| 490 | Ga0495670_0176558 | 3300046691 | Bacteria | 1126 |
| 491 | Ga0495671_0005355 | 3300046692 | Bacteria | 7529 |
| 492 | Ga0495649_0000946 | 3300046694 | Bacteria | 22945 |
| 493 | Ga0495600_0289098 | 3300046809 | Bacteria | 1036 |
| 494 | Ga0495581_0035271 | 3300047315 | Bacteria | 2895 |
| 495 | Ga0495604_0007504 | 3300047317 | Bacteria | 8630 |
| 496 | Ga0495604_0121307 | 3300047317 | Bacteria | 1892 |
| 497 | Ga0495676_0011797 | 3300047321 | Bacteria | 7882 |
| 498 | Ga0495676_0208650 | 3300047321 | Bacteria | 1353 |
| 499 | Ga0495676_0362449 | 3300047321 | Bacteria | 967 |
| 500 | Ga0495681_0091307 | 3300047470 | Bacteria | 1344 |
| 501 | Ga0495686_0001817 | 3300047472 | Bacteria | 21551 |
| 502 | Ga0495686_0014244 | 3300047472 | Bacteria | 5480 |
| 503 | Ga0495686_0015159 | 3300047472 | Bacteria | 5278 |
| 504 | Ga0495686_0056755 | 3300047472 | Bacteria | 2446 |
| 505 | Ga0495593_0014959 | 3300047673 | Bacteria | 4405 |
| 506 | Ga0495593_0016235 | 3300047673 | Bacteria | 4203 |
| 507 | Ga0495602_0106162 | 3300048088 | Bacteria | 2293 |
| 508 | Ga0495614_0078965 | 3300048089 | Bacteria | 1424 |
| 509 | Ga0495615_0002659 | 3300048090 | Bacteria | 2895 |
| 510 | Ga0496100_0026056 | 3300048903 | Bacteria | 3581 |
| 511 | Ga0496101_0013253 | 3300048904 | Bacteria | 5521 |
| 512 | Ga0496101_0084090 | 3300048904 | Bacteria | 2356 |
| 513 | Ga0496102_0008824 | 3300048905 | Bacteria | 8648 |
| 514 | Ga0496102_0011577 | 3300048905 | Bacteria | 7610 |
| 515 | Ga0496104_0049293 | 3300048907 | Bacteria | 3971 |
| 516 | Ga0496104_0071387 | 3300048907 | Bacteria | 3301 |
| 517 | Ga0496105_0035902 | 3300048908 | Bacteria | 4082 |
| 518 | Ga0496105_0338849 | 3300048908 | Bacteria | 1203 |
| 519 | Ga0496106_0008083 | 3300048909 | Bacteria | 7771 |
| 520 | Ga0496106_0336671 | 3300048909 | Bacteria | 1212 |
| 521 | Ga0496108_0701730 | 3300048911 | Bacteria | 877 |
| 522 | Ga0496111_0092473 | 3300048914 | Bacteria | 2217 |
| 523 | Ga0496114_0438276 | 3300048917 | Bacteria | 1157 |
| 524 | Ga0496116_0016291 | 3300048919 | Bacteria | 5822 |
| 525 | Ga0496117_0110094 | 3300048920 | Bacteria | 1718 |
| 526 | Ga0496118_0010997 | 3300048921 | Bacteria | 8891 |
| 527 | Ga0496118_0170571 | 3300048921 | Bacteria | 1330 |
| 528 | Ga0496119_0057076 | 3300048922 | Bacteria | 2362 |
| 529 | Ga0496119_0220665 | 3300048922 | Bacteria | 970 |
| 530 | Ga0496121_0006346 | 3300048924 | Bacteria | 14735 |
| 531 | Ga0496121_0087512 | 3300048924 | Bacteria | 2445 |
| 532 | Ga0496121_0154007 | 3300048924 | Bacteria | 1688 |
| 533 | Ga0496122_0000080 | 3300048925 | Bacteria | 212397 |
| 534 | Ga0496123_0000072 | 3300048926 | Bacteria | 198524 |
| 535 | Ga0496123_0053232 | 3300048926 | Bacteria | 2677 |
| 536 | Ga0496124_0049023 | 3300048927 | Bacteria | 3604 |
| 537 | Ga0496124_0051736 | 3300048927 | Bacteria | 3493 |
| 538 | Ga0496124_0233944 | 3300048927 | Bacteria | 1371 |
| 539 | Ga0496125_0043450 | 3300048928 | Bacteria | 3814 |
| 540 | Ga0496125_0188792 | 3300048928 | Bacteria | 1363 |
| 541 | Ga0496126_0078656 | 3300048929 | Bacteria | 2921 |
| 542 | Ga0501249_008246 | 3300049679 | Bacteria | 2161 |
| 543 | Ga0501225_0011240 | 3300049705 | Bacteria | 2521 |
| 544 | Ga0501262_000864 | 3300049759 | Bacteria | 3470 |
| 545 | nmdc:mga03683_4303_c1 | 3300050489 | Bacteria | 4705 |
| 546 | nmdc:mga03683_5158_c1 | 3300050489 | Bacteria | 4391 |
| 547 | nmdc:mga03683_5908_c1 | 3300050489 | Bacteria | 4165 |
| 548 | nmdc:mga03n38_64383_c1 | 3300050490 | Bacteria | 1678 |
| 549 | nmdc:mga00v17_138873_c1 | 3300050491 | Bacteria | 1557 |
| 550 | nmdc:mga0k408_2101_c1 | 3300050493 | Bacteria | 10666 |
| 551 | nmdc:mga0k408_2135_c1 | 3300050493 | Bacteria | 10597 |
| 552 | nmdc:mga0k408_224794_c1 | 3300050493 | Bacteria | 1121 |
| 553 | nmdc:mga0k408_32892_c1 | 3300050493 | Bacteria | 2963 |
| 554 | nmdc:mga0k408_50214_c1 | 3300050493 | Bacteria | 2415 |
| 555 | nmdc:mga0k408_54674_c1 | 3300050493 | Bacteria | 2314 |
| 556 | nmdc:mga0k408_601_c1 | 3300050493 | Bacteria | 19883 |
| 557 | nmdc:mga06z11_11256_c1 | 3300050494 | Bacteria | 3851 |
| 558 | nmdc:mga06z11_129189_c1 | 3300050494 | Bacteria | 1417 |
| 559 | nmdc:mga04h51_35013_c1 | 3300050495 | Bacteria | 1607 |
| 560 | nmdc:mga07m45_11444_c1 | 3300050496 | Bacteria | 4661 |
| 561 | nmdc:mga07m45_142984_c1 | 3300050496 | Bacteria | 1386 |
| 562 | nmdc:mga07m45_149859_c1 | 3300050496 | Bacteria | 1353 |
| 563 | nmdc:mga07m45_168746_c1 | 3300050496 | Bacteria | 1271 |
| 564 | nmdc:mga07m45_247_c1 | 3300050496 | Bacteria | 21997 |
| 565 | nmdc:mga07m45_270453_c1 | 3300050496 | Bacteria | 989 |
| 566 | nmdc:mga0sz30_16457_c1 | 3300050516 | Bacteria | 2937 |
| 567 | Ga0500610_0005742 | 3300053079 | Bacteria | 5125 |
| 568 | Ga0500610_0018232 | 3300053079 | Bacteria | 3388 |
| 569 | Ga0500635_0000029 | 3300053080 | Bacteria | 100914 |
| 570 | Ga0495619_0194486 | 3300053085 | Bacteria | 1404 |
| 571 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 572 | Ga0500578_0023086 | 3300053086 | Bacteria | 3996 |
| 573 | Ga0500643_064095 | 3300053087 | Bacteria | 1028 |
| 574 | Ga0500644_0011292 | 3300053088 | Bacteria | 2438 |
| 575 | Ga0500646_0011480 | 3300053090 | Bacteria | 2280 |
| 576 | Ga0500651_0000136 | 3300053093 | Bacteria | 45911 |
| 577 | Ga0500651_0072746 | 3300053093 | Bacteria | 2137 |
| 578 | Ga0500566_0000041 | 3300053094 | Bacteria | 65580 |
| 579 | Ga0500650_0139917 | 3300053098 | Bacteria | 1122 |
| 580 | Ga0500556_0113468 | 3300053104 | Bacteria | 1052 |
| 581 | Ga0500562_056666 | 3300053108 | Bacteria | 1051 |
| 582 | Ga0500571_000102 | 3300053110 | Bacteria | 28122 |
| 583 | Ga0500592_015663 | 3300053116 | Bacteria | 1217 |
| 584 | Ga0500593_003920 | 3300053117 | Bacteria | 5704 |
| 585 | Ga0500594_0000520 | 3300053118 | Bacteria | 8360 |
| 586 | Ga0500595_008714 | 3300053119 | Bacteria | 4129 |
| 587 | Ga0500607_009966 | 3300053121 | Bacteria | 5692 |
| 588 | Ga0500607_060158 | 3300053121 | Bacteria | 1994 |
| 589 | Ga0500607_080500 | 3300053121 | Bacteria | 1662 |
| 590 | Ga0500608_034025 | 3300053122 | Bacteria | 2427 |
| 591 | Ga0500608_081518 | 3300053122 | Bacteria | 1526 |
| 592 | Ga0500608_097298 | 3300053122 | Bacteria | 1368 |
| 593 | Ga0500614_017028 | 3300053123 | Bacteria | 1638 |
| 594 | Ga0500618_013199 | 3300053125 | Bacteria | 2144 |
| 595 | Ga0500618_014869 | 3300053125 | Bacteria | 1978 |
| 596 | Ga0500626_066395 | 3300053128 | Bacteria | 1609 |
| 597 | Ga0500642_0001752 | 3300053130 | Bacteria | 6256 |
| 598 | Ga0500652_001055 | 3300053131 | Bacteria | 8942 |
| 599 | Ga0500655_004881 | 3300053133 | Bacteria | 2409 |
| 600 | Ga0500658_0000168 | 3300053134 | Bacteria | 31129 |
| 601 | Ga0500658_0000433 | 3300053134 | Bacteria | 17977 |
| 602 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 603 | Ga0500559_0002006 | 3300053136 | Bacteria | 10945 |
| 604 | Ga0500564_046051 | 3300053138 | Bacteria | 2001 |
| 605 | Ga0500568_0000984 | 3300053139 | Bacteria | 19583 |
| 606 | Ga0500568_0026915 | 3300053139 | Bacteria | 2409 |
| 607 | Ga0500604_0003867 | 3300053151 | Bacteria | 4002 |
| 608 | Ga0500616_0005475 | 3300053153 | Bacteria | 8618 |
| 609 | Ga0500616_0022635 | 3300053153 | Bacteria | 3506 |
| 610 | Ga0500619_048723 | 3300053154 | Bacteria | 1365 |
| 611 | Ga0500622_0000311 | 3300053156 | Bacteria | 49557 |
| 612 | Ga0500622_0012392 | 3300053156 | Bacteria | 4616 |
| 613 | Ga0500622_0015369 | 3300053156 | Bacteria | 4099 |
| 614 | Ga0500627_0036114 | 3300053158 | Bacteria | 2102 |
| 615 | Ga0500634_0002047 | 3300053161 | Bacteria | 8295 |
| 616 | Ga0500634_0074003 | 3300053161 | Bacteria | 1775 |
| 617 | Ga0500638_029155 | 3300053162 | Bacteria | 2654 |
| 618 | Ga0500636_0054854 | 3300053177 | Bacteria | 2336 |
| 619 | Ga0500645_006788 | 3300053730 | Bacteria | 4049 |
| 620 | Ga0500596_010828 | 3300053735 | Bacteria | 1403 |
| 621 | Ga0500601_000067 | 3300053737 | Bacteria | 21859 |
| 622 | Ga0500661_016978 | 3300055283 | Bacteria | 1300 |
| 623 | Ga0466962_0147180 | 3300061719 | Bacteria | 1142 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053087 | Ga0500643_064095 | Ga0500643_064095_13_750 | 200 |
| 2 | 3300046536 | Ga0495587_0323552 | Ga0495587_0323552_33_806 | 211 |
| 3 | 3300053177 | Ga0500636_0054854 | Ga0500636_0054854_1531_2301 | 211 |
| 4 | 3300006195 | Ga0075366_10321027 | Ga0075366_103210271 | 224 |
| 5 | 3300041410 | Ga0439461_0023719 | Ga0439461_0023719_44_775 | 224 |
| 6 | 3300053122 | Ga0500608_081518 | Ga0500608_081518_552_1412 | 226 |
| 7 | 3300014969 | Ga0157376_10881770 | Ga0157376_108817702 | 227 |
| 8 | 3300046678 | Ga0495599_0440838 | Ga0495599_0440838_20_733 | 227 |
| 9 | 3300046680 | Ga0495646_0244703 | Ga0495646_0244703_49_762 | 227 |
| 10 | 3300046809 | Ga0495600_0289098 | Ga0495600_0289098_297_1010 | 227 |
| 11 | 3300053104 | Ga0500556_0113468 | Ga0500556_0113468_293_1006 | 227 |
| 12 | 3300025291 | Ga0209675_1006235 | Ga0209675_10062356 | 229 |
| 13 | 3300048919 | Ga0496116_0016291 | Ga0496116_0016291_3609_4478 | 229 |
| 14 | 3300028794 | Ga0307515_10012210 | Ga0307515_100122109 | 230 |
| 15 | 3300048904 | Ga0496101_0084090 | Ga0496101_0084090_1090_1974 | 231 |
| 16 | 3300053125 | Ga0500618_014869 | Ga0500618_014869_1176_1955 | 231 |
| 17 | 3300042876 | Ga0451577_0018260 | Ga0451577_0018260_1043_1795 | 232 |
| 18 | 3300053121 | Ga0500607_080500 | Ga0500607_080500_418_1281 | 233 |
| 19 | 3300053735 | Ga0500596_010828 | Ga0500596_010828_143_1006 | 234 |
| 20 | 3300046460 | Ga0495638_0014632 | Ga0495638_0014632_2097_2960 | 236 |
| 21 | 3300046513 | Ga0495616_0005630 | Ga0495616_0005630_395_1258 | 236 |
| 22 | 3300046518 | Ga0495631_0000101 | Ga0495631_0000101_39010_39873 | 236 |
| 23 | 3300048909 | Ga0496106_0336671 | Ga0496106_0336671_217_1080 | 236 |
| 24 | 3300048924 | Ga0496121_0087512 | Ga0496121_0087512_1172_2035 | 236 |
| 25 | 3300048926 | Ga0496123_0053232 | Ga0496123_0053232_953_1816 | 236 |
| 26 | 3300053116 | Ga0500592_015663 | Ga0500592_015663_257_1120 | 236 |
| 27 | 3300053156 | Ga0500622_0012392 | Ga0500622_0012392_3167_3961 | 236 |
| 28 | 3300053737 | Ga0500601_000067 | Ga0500601_000067_5089_5883 | 237 |
| 29 | 3300045836 | Ga0466958_0175453 | Ga0466958_0175453_39_770 | 238 |
| 30 | 3300046454 | Ga0495592_0341345 | Ga0495592_0341345_14_760 | 238 |
| 31 | 3300001979 | JGI24740J21852_10050475 | JGI24740J21852_100504752 | 240 |
| 32 | 3300005539 | Ga0068853_100045517 | Ga0068853_1000455175 | 240 |
| 33 | 3300046520 | Ga0495637_0011270 | Ga0495637_0011270_434_1294 | 240 |
| 34 | 3300046530 | Ga0495654_0008326 | Ga0495654_0008326_4314_5174 | 240 |
| 35 | 3300046539 | Ga0495621_0013894 | Ga0495621_0013894_1150_2010 | 240 |
| 36 | 3300046557 | Ga0495622_0118914 | Ga0495622_0118914_61_921 | 240 |
| 37 | 3300046616 | Ga0495668_0047961 | Ga0495668_0047961_1409_2269 | 240 |
| 38 | 3300046663 | Ga0495635_0166675 | Ga0495635_0166675_360_1226 | 240 |
| 39 | 3300046683 | Ga0495658_0110643 | Ga0495658_0110643_678_1544 | 240 |
| 40 | 3300046690 | Ga0495624_0189034 | Ga0495624_0189034_136_1002 | 240 |
| 41 | 3300047321 | Ga0495676_0011797 | Ga0495676_0011797_6098_6964 | 240 |
| 42 | 3300047673 | Ga0495593_0016235 | Ga0495593_0016235_850_1716 | 240 |
| 43 | 3300048089 | Ga0495614_0078965 | Ga0495614_0078965_441_1307 | 240 |
| 44 | 3300048927 | Ga0496124_0049023 | Ga0496124_0049023_2513_3364 | 240 |
| 45 | 3300048928 | Ga0496125_0188792 | Ga0496125_0188792_168_1028 | 240 |
| 46 | 3300053093 | Ga0500651_0000136 | Ga0500651_0000136_2266_3132 | 240 |
| 47 | 3300053110 | Ga0500571_000102 | Ga0500571_000102_20903_21769 | 240 |
| 48 | 3300053123 | Ga0500614_017028 | Ga0500614_017028_342_1202 | 240 |
| 49 | 3300053128 | Ga0500626_066395 | Ga0500626_066395_329_1195 | 240 |
| 50 | 3300053133 | Ga0500655_004881 | Ga0500655_004881_450_1316 | 240 |
| 51 | 3300053134 | Ga0500658_0000433 | Ga0500658_0000433_7281_8147 | 240 |
| 52 | 3300053139 | Ga0500568_0000984 | Ga0500568_0000984_538_1398 | 240 |
| 53 | 3300053153 | Ga0500616_0022635 | Ga0500616_0022635_1307_2167 | 240 |
| 54 | 3300053162 | Ga0500638_029155 | Ga0500638_029155_666_1532 | 240 |
| 55 | 3300005548 | Ga0070665_100171139 | Ga0070665_1001711391 | 241 |
| 56 | 3300042876 | Ga0451577_0025149 | Ga0451577_0025149_1605_2405 | 241 |
| 57 | 3300045051 | Ga0451576_0849025 | Ga0451576_0849025_66_866 | 241 |
| 58 | 3300046512 | Ga0495610_0022677 | Ga0495610_0022677_1504_2367 | 241 |
| 59 | 3300048922 | Ga0496119_0057076 | Ga0496119_0057076_525_1388 | 241 |
| 60 | 3300053134 | Ga0500658_0000168 | Ga0500658_0000168_12484_13347 | 241 |
| 61 | 3300006042 | Ga0075368_10036523 | Ga0075368_100365232 | 242 |
| 62 | 3300006048 | Ga0075363_100034839 | Ga0075363_1000348393 | 242 |
| 63 | 3300006177 | Ga0075362_10054771 | Ga0075362_100547712 | 242 |
| 64 | 3300006178 | Ga0075367_10002856 | Ga0075367_100028563 | 242 |
| 65 | 3300006186 | Ga0075369_10008092 | Ga0075369_100080924 | 242 |
| 66 | 3300006353 | Ga0075370_10004155 | Ga0075370_100041552 | 242 |
| 67 | 3300012502 | Ga0157347_1001046 | Ga0157347_10010462 | 242 |
| 68 | 3300028794 | Ga0307515_10000292 | Ga0307515_1000029246 | 242 |
| 69 | 3300041404 | Ga0439436_0065386 | Ga0439436_0065386_162_986 | 242 |
| 70 | 3300041406 | Ga0439439_0022472 | Ga0439439_0022472_143_967 | 242 |
| 71 | 3300041411 | Ga0439466_0042287 | Ga0439466_0042287_36_860 | 242 |
| 72 | 3300041413 | Ga0439465_0027847 | Ga0439465_0027847_677_1501 | 242 |
| 73 | 3300041997 | Ga0439431_0005421 | Ga0439431_0005421_610_1434 | 242 |
| 74 | 3300041999 | Ga0439433_0004518 | Ga0439433_0004518_531_1355 | 242 |
| 75 | 3300042002 | Ga0439442_030391 | Ga0439442_030391_240_1070 | 242 |
| 76 | 3300042004 | Ga0439445_0003668 | Ga0439445_0003668_2426_3250 | 242 |
| 77 | 3300042006 | Ga0439432_017634 | Ga0439432_017634_1457_2281 | 242 |
| 78 | 3300042007 | Ga0439449_0002894 | Ga0439449_0002894_3548_4372 | 242 |
| 79 | 3300042007 | Ga0439449_0029030 | Ga0439449_0029030_883_1707 | 242 |
| 80 | 3300042010 | Ga0439452_008152 | Ga0439452_008152_432_1256 | 242 |
| 81 | 3300042015 | Ga0439462_0007022 | Ga0439462_0007022_1178_2002 | 242 |
| 82 | 3300042156 | Ga0439446_0030573 | Ga0439446_0030573_513_1337 | 242 |
| 83 | 3300042435 | Ga0439434_0007326 | Ga0439434_0007326_269_1093 | 242 |
| 84 | 3300005548 | Ga0070665_100318618 | Ga0070665_1003186181 | 243 |
| 85 | 3300014497 | Ga0182008_10000255 | Ga0182008_1000025522 | 243 |
| 86 | 3300028379 | Ga0268266_10344931 | Ga0268266_103449312 | 243 |
| 87 | 3300028794 | Ga0307515_10175176 | Ga0307515_101751762 | 243 |
| 88 | 3300031456 | Ga0307513_10082898 | Ga0307513_100828981 | 243 |
| 89 | 3300005543 | Ga0070672_100235466 | Ga0070672_1002354662 | 244 |
| 90 | 3300005719 | Ga0068861_100228621 | Ga0068861_1002286212 | 244 |
| 91 | 3300025901 | Ga0207688_10295659 | Ga0207688_102956592 | 244 |
| 92 | 3300025926 | Ga0207659_10273176 | Ga0207659_102731762 | 244 |
| 93 | 3300026089 | Ga0207648_10331307 | Ga0207648_103313072 | 244 |
| 94 | 3300026118 | Ga0207675_100461354 | Ga0207675_1004613542 | 244 |
| 95 | 3300028794 | Ga0307515_10000034 | Ga0307515_10000034318 | 244 |
| 96 | 3300035695 | Ga0373927_0178663 | Ga0373927_0178663_470_1330 | 244 |
| 97 | 3300037068 | Ga0373925_0037946 | Ga0373925_0037946_1915_2775 | 244 |
| 98 | iso_pu_bacteria | 2643221592 | 2643968072 | 244 |
| 99 | iso_pu_bacteria | 2643221625 | 2644142572 | 244 |
| 100 | iso_pu_bacteria | 2643221648 | 2644276929 | 244 |
| 101 | 3300005328 | Ga0070676_10207342 | Ga0070676_102073422 | 246 |
| 102 | 3300021361 | Ga0213872_10000077 | Ga0213872_1000007763 | 246 |
| 103 | 3300025303 | Ga0209051_1017573 | Ga0209051_10175733 | 246 |
| 104 | 3300025907 | Ga0207645_10116329 | Ga0207645_101163292 | 246 |
| 105 | 3300039447 | Ga0436361_1007413 | Ga0436361_1007413_77090_77863 | 246 |
| 106 | 3300003215 | JGI25153J46596_10000500 | JGI25153J46596_100005006 | 247 |
| 107 | 3300003771 | Ga0055526_1001517 | Ga0055526_10015172 | 247 |
| 108 | 3300006195 | Ga0075366_10100364 | Ga0075366_101003642 | 247 |
| 109 | 3300025245 | Ga0207425_1000652 | Ga0207425_100065219 | 247 |
| 110 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027261 | 247 |
| 111 | 3300025273 | Ga0209673_1006993 | Ga0209673_10069934 | 247 |
| 112 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014521 | 247 |
| 113 | 3300025297 | Ga0209758_1000208 | Ga0209758_100020876 | 247 |
| 114 | 3300026041 | Ga0207639_10514563 | Ga0207639_105145632 | 247 |
| 115 | iso_pu_bacteria | 2585428057 | 2587725048 | 247 |
| 116 | iso_pu_bacteria | 2585428058 | 2587731591 | 247 |
| 117 | iso_pu_bacteria | 2588253510 | 2588292553 | 247 |
| 118 | 3300005456 | Ga0070678_100335929 | Ga0070678_1003359291 | 248 |
| 119 | 3300005548 | Ga0070665_100022220 | Ga0070665_1000222202 | 248 |
| 120 | 3300005548 | Ga0070665_100550844 | Ga0070665_1005508442 | 248 |
| 121 | 3300021361 | Ga0213872_10092643 | Ga0213872_100926432 | 248 |
| 122 | 3300025986 | Ga0207658_10225921 | Ga0207658_102259212 | 248 |
| 123 | 3300026121 | Ga0207683_10085054 | Ga0207683_100850542 | 248 |
| 124 | 3300028379 | Ga0268266_10062828 | Ga0268266_100628283 | 248 |
| 125 | 3300039447 | Ga0436361_0549249 | Ga0436361_0549249_978_1808 | 248 |
| 126 | 3300046522 | Ga0495643_0097787 | Ga0495643_0097787_177_956 | 248 |
| 127 | 3300050489 | nmdc:mga03683_5908_c1 | nmdc:mga03683_5908_c1_413_1279 | 248 |
| 128 | 3300050490 | nmdc:mga03n38_64383_c1 | nmdc:mga03n38_64383_c1_88_954 | 248 |
| 129 | 3300050491 | nmdc:mga00v17_138873_c1 | nmdc:mga00v17_138873_c1_478_1344 | 248 |
| 130 | 3300050493 | nmdc:mga0k408_601_c1 | nmdc:mga0k408_601_c1_9353_10219 | 248 |
| 131 | 3300050494 | nmdc:mga06z11_11256_c1 | nmdc:mga06z11_11256_c1_1609_2475 | 248 |
| 132 | 3300050495 | nmdc:mga04h51_35013_c1 | nmdc:mga04h51_35013_c1_233_1099 | 248 |
| 133 | 3300050496 | nmdc:mga07m45_149859_c1 | nmdc:mga07m45_149859_c1_530_1297 | 248 |
| 134 | 3300050496 | nmdc:mga07m45_247_c1 | nmdc:mga07m45_247_c1_1806_2672 | 248 |
| 135 | 3300003215 | JGI25153J46596_10003835 | JGI25153J46596_100038353 | 249 |
| 136 | 3300005459 | Ga0068867_100000020 | Ga0068867_10000002047 | 249 |
| 137 | 3300005616 | Ga0068852_100033828 | Ga0068852_1000338283 | 249 |
| 138 | 3300009148 | Ga0105243_10001054 | Ga0105243_1000105411 | 249 |
| 139 | 3300014745 | Ga0157377_10000032 | Ga0157377_1000003228 | 249 |
| 140 | 3300021361 | Ga0213872_10001319 | Ga0213872_100013198 | 249 |
| 141 | 3300025258 | Ga0209129_1016676 | Ga0209129_10166762 | 249 |
| 142 | 3300025297 | Ga0209758_1000193 | Ga0209758_100019342 | 249 |
| 143 | 3300025935 | Ga0207709_10000641 | Ga0207709_1000064111 | 249 |
| 144 | 3300026089 | Ga0207648_10000172 | Ga0207648_1000017242 | 249 |
| 145 | 3300026142 | Ga0207698_10149030 | Ga0207698_101490302 | 249 |
| 146 | 3300031456 | Ga0307513_10285062 | Ga0307513_102850622 | 249 |
| 147 | 3300039447 | Ga0436361_0656823 | Ga0436361_0656823_9336_10163 | 249 |
| 148 | 3300002773 | JGI25152J39213_1018250 | JGI25152J39213_10182501 | 250 |
| 149 | 3300003187 | JGI25151J46595_10011727 | JGI25151J46595_100117273 | 250 |
| 150 | 3300003316 | rootH1_10019095 | rootH1_100190954 | 250 |
| 151 | 3300003374 | JGI25161J50226_1003212 | JGI25161J50226_10032122 | 250 |
| 152 | 3300003578 | Ga0006562J51391_1026631 | Ga0006562J51391_10266314 | 250 |
| 153 | 3300003578 | Ga0006562J51391_1026633 | Ga0006562J51391_10266332 | 250 |
| 154 | 3300003784 | Ga0055534_1002881 | Ga0055534_10028817 | 250 |
| 155 | 3300003791 | Ga0055530_10003251 | Ga0055530_100032516 | 250 |
| 156 | 3300003794 | Ga0055531_10016471 | Ga0055531_100164713 | 250 |
| 157 | 3300005455 | Ga0070663_100004721 | Ga0070663_1000047214 | 250 |
| 158 | 3300006195 | Ga0075366_10033093 | Ga0075366_100330932 | 250 |
| 159 | 3300006353 | Ga0075370_10000553 | Ga0075370_1000055316 | 250 |
| 160 | 3300006353 | Ga0075370_10009968 | Ga0075370_100099682 | 250 |
| 161 | 3300006353 | Ga0075370_10106828 | Ga0075370_101068281 | 250 |
| 162 | 3300025208 | Ga0209436_111904 | Ga0209436_1119042 | 250 |
| 163 | 3300025258 | Ga0209129_1008112 | Ga0209129_10081123 | 250 |
| 164 | 3300025263 | Ga0209565_1000310 | Ga0209565_10003109 | 250 |
| 165 | 3300025273 | Ga0209673_1000502 | Ga0209673_100050236 | 250 |
| 166 | 3300025273 | Ga0209673_1000812 | Ga0209673_100081217 | 250 |
| 167 | 3300025284 | Ga0209130_1001874 | Ga0209130_100187412 | 250 |
| 168 | 3300025291 | Ga0209675_1004043 | Ga0209675_10040437 | 250 |
| 169 | 3300025292 | Ga0209676_1000040 | Ga0209676_1000040214 | 250 |
| 170 | 3300025294 | Ga0209025_1000360 | Ga0209025_100036065 | 250 |
| 171 | 3300025294 | Ga0209025_1058057 | Ga0209025_10580572 | 250 |
| 172 | 3300025295 | Ga0209564_1000832 | Ga0209564_100083211 | 250 |
| 173 | 3300025298 | Ga0209050_1000021 | Ga0209050_1000021179 | 250 |
| 174 | 3300025299 | Ga0209256_1000056 | Ga0209256_100005694 | 250 |
| 175 | 3300025302 | Ga0207426_1000079 | Ga0207426_1000079177 | 250 |
| 176 | 3300025303 | Ga0209051_1000028 | Ga0209051_1000028333 | 250 |
| 177 | 3300025303 | Ga0209051_1000468 | Ga0209051_100046842 | 250 |
| 178 | 3300025304 | Ga0209257_1000043 | Ga0209257_1000043174 | 250 |
| 179 | 3300026067 | Ga0207678_10010915 | Ga0207678_100109154 | 250 |
| 180 | 3300030731 | Ga0316177_1054210 | Ga0316177_10542102 | 250 |
| 181 | 3300030733 | Ga0314311_1148034 | Ga0314311_11480344 | 250 |
| 182 | 3300031456 | Ga0307513_10157352 | Ga0307513_101573522 | 250 |
| 183 | 3300034957 | Ga0373938_0061488 | Ga0373938_0061488_77_865 | 250 |
| 184 | 3300037471 | Ga0395905_0048128 | Ga0395905_0048128_1956_2726 | 250 |
| 185 | 3300038443 | Ga0395901_0103704 | Ga0395901_0103704_66_860 | 250 |
| 186 | 3300046519 | Ga0495632_0018486 | Ga0495632_0018486_537_1316 | 250 |
| 187 | 3300050493 | nmdc:mga0k408_50214_c1 | nmdc:mga0k408_50214_c1_914_1693 | 250 |
| 188 | 3300050496 | nmdc:mga07m45_11444_c1 | nmdc:mga07m45_11444_c1_3022_3801 | 250 |
| 189 | 3300053090 | Ga0500646_0011480 | Ga0500646_0011480_784_1563 | 250 |
| 190 | 3300053098 | Ga0500650_0139917 | Ga0500650_0139917_38_817 | 250 |
| 191 | 3300053130 | Ga0500642_0001752 | Ga0500642_0001752_1599_2378 | 250 |
| 192 | 3300053131 | Ga0500652_001055 | Ga0500652_001055_4340_5119 | 250 |
| 193 | 3300053139 | Ga0500568_0026915 | Ga0500568_0026915_1160_1939 | 250 |
| 194 | 3300053151 | Ga0500604_0003867 | Ga0500604_0003867_2282_3055 | 250 |
| 195 | 3300053156 | Ga0500622_0000311 | Ga0500622_0000311_16194_16973 | 250 |
| 196 | iso_pu_bacteria | 2513237094 | 2513640842 | 250 |
| 197 | iso_pu_bacteria | 2844315083 | 2844316707 | 250 |
| 198 | iso_pu_bacteria | 2874628541 | 2874631456 | 250 |
| 199 | iso_pu_bacteria | 2885409591 | 2885410579 | 250 |
| 200 | iso_pu_bacteria | 2888378607 | 2888381310 | 250 |
| 201 | iso_pu_bacteria | 2888388044 | 2888389355 | 250 |
| 202 | iso_pu_bacteria | 2903727486 | 2903733762 | 250 |
| 203 | iso_pu_bacteria | 2906602504 | 2906608054 | 250 |
| 204 | iso_pu_bacteria | 2929615660 | 2929619346 | 250 |
| 205 | iso_pu_bacteria | 2929624759 | 2929628184 | 250 |
| 206 | iso_pu_bacteria | 2932794094 | 2932796944 | 250 |
| 207 | iso_pu_bacteria | 2932801729 | 2932807242 | 250 |
| 208 | iso_pu_bacteria | 2933577622 | 2933581267 | 250 |
| 209 | iso_pu_bacteria | 2935883170 | 2935884634 | 250 |
| 210 | iso_pu_bacteria | 2941531003 | 2941533494 | 250 |
| 211 | iso_pu_bacteria | 3005594810 | 3005596317 | 250 |
| 212 | iso_pu_bacteria | 3005718088 | 3005719450 | 250 |
| 213 | iso_pu_bacteria | 8019648815 | 8019650254 | 250 |
| 214 | iso_pu_bacteria | 8055742211 | 8055749396 | 250 |
| 215 | iso_pu_bacteria | 8056967851 | 8056973647 | 250 |
| 216 | 3300003187 | JGI25151J46595_10001531 | JGI25151J46595_100015312 | 251 |
| 217 | 3300005843 | Ga0068860_100154249 | Ga0068860_1001542493 | 251 |
| 218 | 3300006177 | Ga0075362_10015283 | Ga0075362_100152832 | 251 |
| 219 | 3300006195 | Ga0075366_10041899 | Ga0075366_100418991 | 251 |
| 220 | 3300006353 | Ga0075370_10029365 | Ga0075370_100293651 | 251 |
| 221 | 3300025258 | Ga0209129_1003344 | Ga0209129_10033444 | 251 |
| 222 | 3300025294 | Ga0209025_1000065 | Ga0209025_10000657 | 251 |
| 223 | 3300025914 | Ga0207671_10005488 | Ga0207671_100054886 | 251 |
| 224 | 3300028381 | Ga0268264_10125629 | Ga0268264_101256292 | 251 |
| 225 | 3300031251 | Ga0265327_10006724 | Ga0265327_100067243 | 251 |
| 226 | 3300031731 | Ga0307405_10151302 | Ga0307405_101513021 | 251 |
| 227 | 3300041411 | Ga0439466_0013614 | Ga0439466_0013614_1841_2752 | 251 |
| 228 | 3300042002 | Ga0439442_005912 | Ga0439442_005912_923_1834 | 251 |
| 229 | 3300048924 | Ga0496121_0006346 | Ga0496121_0006346_701_1513 | 251 |
| 230 | 3300050489 | nmdc:mga03683_5158_c1 | nmdc:mga03683_5158_c1_1570_2403 | 251 |
| 231 | 3300050493 | nmdc:mga0k408_32892_c1 | nmdc:mga0k408_32892_c1_1236_2117 | 251 |
| 232 | 3300005262 | Ga0065165_1000923 | Ga0065165_100092334 | 252 |
| 233 | 3300006353 | Ga0075370_10007614 | Ga0075370_100076142 | 252 |
| 234 | 3300025273 | Ga0209673_1019729 | Ga0209673_10197291 | 252 |
| 235 | 3300025298 | Ga0209050_1000198 | Ga0209050_100019864 | 252 |
| 236 | 3300025909 | Ga0207705_10312215 | Ga0207705_103122152 | 252 |
| 237 | 3300031548 | Ga0307408_100298433 | Ga0307408_1002984332 | 252 |
| 238 | 3300031731 | Ga0307405_10085115 | Ga0307405_100851152 | 252 |
| 239 | 3300031911 | Ga0307412_10061291 | Ga0307412_100612912 | 252 |
| 240 | 3300032002 | Ga0307416_100252834 | Ga0307416_1002528342 | 252 |
| 241 | 3300041404 | Ga0439436_0007708 | Ga0439436_0007708_1750_2583 | 252 |
| 242 | 3300041405 | Ga0439438_045905 | Ga0439438_045905_174_1007 | 252 |
| 243 | 3300041406 | Ga0439439_0012756 | Ga0439439_0012756_1027_1860 | 252 |
| 244 | 3300041999 | Ga0439433_0019359 | Ga0439433_0019359_253_1086 | 252 |
| 245 | 3300042004 | Ga0439445_0020963 | Ga0439445_0020963_572_1405 | 252 |
| 246 | 3300042006 | Ga0439432_038634 | Ga0439432_038634_26_853 | 252 |
| 247 | 3300042007 | Ga0439449_0030220 | Ga0439449_0030220_937_1770 | 252 |
| 248 | 3300042010 | Ga0439452_004744 | Ga0439452_004744_1015_1848 | 252 |
| 249 | 3300042012 | Ga0439455_0012429 | Ga0439455_0012429_1049_1858 | 252 |
| 250 | 3300042014 | Ga0439457_048077 | Ga0439457_048077_24_857 | 252 |
| 251 | 3300042015 | Ga0439462_0005459 | Ga0439462_0005459_1426_2259 | 252 |
| 252 | 3300042133 | Ga0450896_018109 | Ga0450896_018109_31_837 | 252 |
| 253 | 3300042134 | Ga0450898_006695 | Ga0450898_006695_499_1305 | 252 |
| 254 | 3300042147 | Ga0450910_011193 | Ga0450910_011193_334_1167 | 252 |
| 255 | 3300042157 | Ga0439458_0029867 | Ga0439458_0029867_429_1238 | 252 |
| 256 | 3300042184 | Ga0450908_011394 | Ga0450908_011394_287_1120 | 252 |
| 257 | 3300042439 | Ga0439464_0005585 | Ga0439464_0005585_1929_2735 | 252 |
| 258 | 3300046515 | Ga0495620_0015656 | Ga0495620_0015656_753_1631 | 252 |
| 259 | 3300046530 | Ga0495654_0132767 | Ga0495654_0132767_172_1050 | 252 |
| 260 | 3300046616 | Ga0495668_0058049 | Ga0495668_0058049_866_1744 | 252 |
| 261 | 3300050493 | nmdc:mga0k408_224794_c1 | nmdc:mga0k408_224794_c1_246_1079 | 252 |
| 262 | 3300050496 | nmdc:mga07m45_270453_c1 | nmdc:mga07m45_270453_c1_116_949 | 252 |
| 263 | 3300053079 | Ga0500610_0005742 | Ga0500610_0005742_3219_4097 | 252 |
| 264 | 3300053079 | Ga0500610_0018232 | Ga0500610_0018232_1473_2351 | 252 |
| 265 | 3300053086 | Ga0500578_0000006 | Ga0500578_0000006_188318_189103 | 252 |
| 266 | 3300053117 | Ga0500593_003920 | Ga0500593_003920_401_1279 | 252 |
| 267 | 3300053121 | Ga0500607_009966 | Ga0500607_009966_683_1543 | 252 |
| 268 | 3300053158 | Ga0500627_0036114 | Ga0500627_0036114_604_1482 | 252 |
| 269 | 3300053161 | Ga0500634_0002047 | Ga0500634_0002047_661_1539 | 252 |
| 270 | 3300003323 | rootH1_10024011 | rootH1_100240115 | 253 |
| 271 | 3300005577 | Ga0068857_100219430 | Ga0068857_1002194302 | 253 |
| 272 | 3300005616 | Ga0068852_100285818 | Ga0068852_1002858182 | 253 |
| 273 | 3300009093 | Ga0105240_10139454 | Ga0105240_101394541 | 253 |
| 274 | 3300013104 | Ga0157370_10030892 | Ga0157370_100308922 | 253 |
| 275 | 3300013105 | Ga0157369_10029847 | Ga0157369_100298476 | 253 |
| 276 | 3300025913 | Ga0207695_10068902 | Ga0207695_100689022 | 253 |
| 277 | 3300026116 | Ga0207674_10148313 | Ga0207674_101483133 | 253 |
| 278 | 3300026142 | Ga0207698_10430343 | Ga0207698_104303432 | 253 |
| 279 | 3300041413 | Ga0439465_0030235 | Ga0439465_0030235_542_1453 | 253 |
| 280 | 3300042122 | Ga0450920_009213 | Ga0450920_009213_153_1064 | 253 |
| 281 | 3300042145 | Ga0450906_010898 | Ga0450906_010898_190_1101 | 253 |
| 282 | 3300042147 | Ga0450910_004800 | Ga0450910_004800_388_1299 | 253 |
| 283 | 3300042156 | Ga0439446_0023379 | Ga0439446_0023379_625_1536 | 253 |
| 284 | 3300042184 | Ga0450908_003837 | Ga0450908_003837_1892_2803 | 253 |
| 285 | 3300042531 | Ga0450918_000547 | Ga0450918_000547_4594_5505 | 253 |
| 286 | 3300046453 | Ga0495627_009665 | Ga0495627_009665_1303_2181 | 253 |
| 287 | 3300046692 | Ga0495671_0005355 | Ga0495671_0005355_3995_4873 | 253 |
| 288 | 3300047470 | Ga0495681_0091307 | Ga0495681_0091307_431_1309 | 253 |
| 289 | 3300047472 | Ga0495686_0014244 | Ga0495686_0014244_1033_1872 | 253 |
| 290 | 3300048927 | Ga0496124_0233944 | Ga0496124_0233944_377_1237 | 253 |
| 291 | 3300003214 | JGI25165J46597_1004578 | JGI25165J46597_10045782 | 254 |
| 292 | 3300003215 | JGI25153J46596_10000936 | JGI25153J46596_1000093610 | 254 |
| 293 | 3300003322 | rootL2_10053149 | rootL2_100531492 | 254 |
| 294 | 3300003761 | Ga0055535_1000158 | Ga0055535_100015838 | 254 |
| 295 | 3300003762 | Ga0055542_1000013 | Ga0055542_1000013158 | 254 |
| 296 | 3300005262 | Ga0065165_1000376 | Ga0065165_100037651 | 254 |
| 297 | 3300005616 | Ga0068852_100274442 | Ga0068852_1002744423 | 254 |
| 298 | 3300005834 | Ga0068851_10013320 | Ga0068851_100133202 | 254 |
| 299 | 3300009093 | Ga0105240_10236235 | Ga0105240_102362351 | 254 |
| 300 | 3300009098 | Ga0105245_10254587 | Ga0105245_102545871 | 254 |
| 301 | 3300009545 | Ga0105237_10021968 | Ga0105237_100219687 | 254 |
| 302 | 3300010375 | Ga0105239_10029361 | Ga0105239_100293617 | 254 |
| 303 | 3300013102 | Ga0157371_10025385 | Ga0157371_100253854 | 254 |
| 304 | 3300013307 | Ga0157372_10066292 | Ga0157372_100662925 | 254 |
| 305 | 3300025228 | Ga0209672_101526 | Ga0209672_1015263 | 254 |
| 306 | 3300025229 | Ga0209147_100596 | Ga0209147_10059615 | 254 |
| 307 | 3300025242 | Ga0209258_100020 | Ga0209258_100020314 | 254 |
| 308 | 3300025254 | Ga0209148_1000031 | Ga0209148_1000031314 | 254 |
| 309 | 3300025254 | Ga0209148_1000569 | Ga0209148_100056918 | 254 |
| 310 | 3300025272 | Ga0209455_1003164 | Ga0209455_10031642 | 254 |
| 311 | 3300025297 | Ga0209758_1011064 | Ga0209758_10110642 | 254 |
| 312 | 3300025297 | Ga0209758_1054986 | Ga0209758_10549862 | 254 |
| 313 | 3300025302 | Ga0207426_1000733 | Ga0207426_100073320 | 254 |
| 314 | 3300025315 | Ga0207697_10023522 | Ga0207697_100235222 | 254 |
| 315 | 3300025913 | Ga0207695_10000006 | Ga0207695_10000006999 | 254 |
| 316 | 3300025914 | Ga0207671_10018810 | Ga0207671_100188106 | 254 |
| 317 | 3300025932 | Ga0207690_10070570 | Ga0207690_100705702 | 254 |
| 318 | 3300027296 | Ga0209389_1000057 | Ga0209389_100005790 | 254 |
| 319 | 3300027361 | Ga0209489_100226 | Ga0209489_10022679 | 254 |
| 320 | 3300033180 | Ga0307510_10028597 | Ga0307510_100285973 | 254 |
| 321 | 3300042131 | Ga0450894_016750 | Ga0450894_016750_11_877 | 254 |
| 322 | 3300045976 | Ga0466967_0410558 | Ga0466967_0410558_13_807 | 254 |
| 323 | 3300046459 | Ga0495629_0251351 | Ga0495629_0251351_177_971 | 254 |
| 324 | 3300046460 | Ga0495638_0006701 | Ga0495638_0006701_3796_4590 | 254 |
| 325 | 3300046529 | Ga0495652_0147373 | Ga0495652_0147373_963_1757 | 254 |
| 326 | 3300046529 | Ga0495652_0195995 | Ga0495652_0195995_489_1283 | 254 |
| 327 | 3300046533 | Ga0495640_0252825 | Ga0495640_0252825_160_954 | 254 |
| 328 | 3300046663 | Ga0495635_0002221 | Ga0495635_0002221_8663_9457 | 254 |
| 329 | 3300046675 | Ga0495657_0009715 | Ga0495657_0009715_2988_3782 | 254 |
| 330 | 3300046689 | Ga0495613_0040359 | Ga0495613_0040359_2590_3384 | 254 |
| 331 | 3300046690 | Ga0495624_0018282 | Ga0495624_0018282_681_1475 | 254 |
| 332 | 3300047315 | Ga0495581_0035271 | Ga0495581_0035271_95_889 | 254 |
| 333 | 3300047317 | Ga0495604_0007504 | Ga0495604_0007504_170_964 | 254 |
| 334 | 3300047317 | Ga0495604_0121307 | Ga0495604_0121307_736_1530 | 254 |
| 335 | 3300047321 | Ga0495676_0362449 | Ga0495676_0362449_100_894 | 254 |
| 336 | 3300047472 | Ga0495686_0015159 | Ga0495686_0015159_2834_3628 | 254 |
| 337 | 3300047472 | Ga0495686_0056755 | Ga0495686_0056755_1001_1795 | 254 |
| 338 | 3300047673 | Ga0495593_0014959 | Ga0495593_0014959_3597_4391 | 254 |
| 339 | 3300048088 | Ga0495602_0106162 | Ga0495602_0106162_1385_2179 | 254 |
| 340 | 3300048907 | Ga0496104_0071387 | Ga0496104_0071387_1302_2096 | 254 |
| 341 | 3300048920 | Ga0496117_0110094 | Ga0496117_0110094_411_1205 | 254 |
| 342 | 3300048922 | Ga0496119_0220665 | Ga0496119_0220665_86_880 | 254 |
| 343 | 3300048929 | Ga0496126_0078656 | Ga0496126_0078656_1115_1909 | 254 |
| 344 | 3300053085 | Ga0495619_0194486 | Ga0495619_0194486_516_1310 | 254 |
| 345 | 3300053094 | Ga0500566_0000041 | Ga0500566_0000041_48250_49044 | 254 |
| 346 | 3300053108 | Ga0500562_056666 | Ga0500562_056666_50_844 | 254 |
| 347 | 3300053119 | Ga0500595_008714 | Ga0500595_008714_1384_2178 | 254 |
| 348 | 3300053122 | Ga0500608_097298 | Ga0500608_097298_171_965 | 254 |
| 349 | 3300053153 | Ga0500616_0005475 | Ga0500616_0005475_180_974 | 254 |
| 350 | 3300061719 | Ga0466962_0147180 | Ga0466962_0147180_325_1119 | 254 |
| 351 | iso_pu_bacteria | 2831265667 | 2831270892 | 254 |
| 352 | iso_pu_bacteria | 2838054893 | 2838058939 | 254 |
| 353 | 3300005614 | Ga0068856_100414701 | Ga0068856_1004147011 | 255 |
| 354 | 3300006195 | Ga0075366_10001796 | Ga0075366_100017969 | 255 |
| 355 | 3300026142 | Ga0207698_10148354 | Ga0207698_101483541 | 255 |
| 356 | 3300044683 | Ga0466965_0053922 | Ga0466965_0053922_653_1480 | 255 |
| 357 | 3300045051 | Ga0451576_0119829 | Ga0451576_0119829_1325_2191 | 255 |
| 358 | 3300050493 | nmdc:mga0k408_2135_c1 | nmdc:mga0k408_2135_c1_987_1826 | 255 |
| 359 | iso_pu_bacteria | 2928084124 | 2928086551 | 255 |
| 360 | 3300031649 | Ga0307514_10010952 | Ga0307514_100109527 | 256 |
| 361 | 3300031911 | Ga0307412_10002474 | Ga0307412_1000247411 | 256 |
| 362 | 3300044712 | Ga0453684_0029308 | Ga0453684_0029308_455_1249 | 256 |
| 363 | 3300044901 | Ga0466960_0112699 | Ga0466960_0112699_418_1245 | 256 |
| 364 | 3300050493 | nmdc:mga0k408_2101_c1 | nmdc:mga0k408_2101_c1_2130_2984 | 256 |
| 365 | iso_pu_bacteria | 2513020051 | 2513229249 | 256 |
| 366 | iso_pu_bacteria | 2643221658 | 2644326536 | 256 |
| 367 | iso_pu_bacteria | 2643221672 | 2644396879 | 256 |
| 368 | iso_pu_bacteria | 2738541277 | 2738719348 | 256 |
| 369 | iso_pu_bacteria | 2738541307 | 2738883307 | 256 |
| 370 | iso_pu_bacteria | 2738543019 | 2739282921 | 256 |
| 371 | iso_pu_bacteria | 2885198086 | 2885202286 | 256 |
| 372 | iso_pu_bacteria | 2885211737 | 2885215939 | 256 |
| 373 | iso_pu_bacteria | 2904449895 | 2904451646 | 256 |
| 374 | iso_pu_bacteria | 2904456579 | 2904461865 | 256 |
| 375 | iso_pu_bacteria | 2929520902 | 2929526564 | 256 |
| 376 | iso_pu_bacteria | 2945945610 | 2945950436 | 256 |
| 377 | iso_pu_bacteria | 2945972063 | 2945974922 | 256 |
| 378 | 3300005548 | Ga0070665_100614319 | Ga0070665_1006143192 | 257 |
| 379 | 3300006353 | Ga0075370_10008343 | Ga0075370_100083432 | 257 |
| 380 | 3300026023 | Ga0207677_10498021 | Ga0207677_104980212 | 257 |
| 381 | 3300026067 | Ga0207678_10085010 | Ga0207678_100850102 | 257 |
| 382 | iso_pu_bacteria | 2842733646 | 2842738539 | 257 |
| 383 | iso_pu_bacteria | 2885192300 | 2885194326 | 257 |
| 384 | iso_pu_bacteria | 2904541872 | 2904546629 | 257 |
| 385 | iso_pu_bacteria | 2929160207 | 2929166083 | 257 |
| 386 | iso_pu_bacteria | 2954767861 | 2954770117 | 257 |
| 387 | 3300002774 | JGI25150J39212_1002739 | JGI25150J39212_10027392 | 258 |
| 388 | 3300003781 | Ga0055536_1021556 | Ga0055536_10215561 | 258 |
| 389 | 3300003792 | Ga0055540_1010550 | Ga0055540_10105501 | 258 |
| 390 | 3300004625 | Ga0055543_1003737 | Ga0055543_10037372 | 258 |
| 391 | 3300005262 | Ga0065165_1001023 | Ga0065165_100102320 | 258 |
| 392 | 3300005334 | Ga0068869_100002518 | Ga0068869_1000025188 | 258 |
| 393 | 3300005338 | Ga0068868_100092650 | Ga0068868_1000926502 | 258 |
| 394 | 3300005338 | Ga0068868_100388576 | Ga0068868_1003885761 | 258 |
| 395 | 3300005340 | Ga0070689_100138203 | Ga0070689_1001382032 | 258 |
| 396 | 3300005353 | Ga0070669_100004753 | Ga0070669_1000047534 | 258 |
| 397 | 3300005364 | Ga0070673_100051895 | Ga0070673_1000518952 | 258 |
| 398 | 3300005367 | Ga0070667_100014913 | Ga0070667_1000149131 | 258 |
| 399 | 3300005459 | Ga0068867_100005069 | Ga0068867_1000050698 | 258 |
| 400 | 3300005539 | Ga0068853_100232238 | Ga0068853_1002322382 | 258 |
| 401 | 3300005539 | Ga0068853_100375795 | Ga0068853_1003757952 | 258 |
| 402 | 3300005543 | Ga0070672_100606073 | Ga0070672_1006060731 | 258 |
| 403 | 3300005548 | Ga0070665_100083845 | Ga0070665_1000838453 | 258 |
| 404 | 3300005577 | Ga0068857_100072045 | Ga0068857_1000720452 | 258 |
| 405 | 3300005617 | Ga0068859_100188107 | Ga0068859_1001881072 | 258 |
| 406 | 3300005617 | Ga0068859_100544146 | Ga0068859_1005441461 | 258 |
| 407 | 3300005618 | Ga0068864_100010178 | Ga0068864_1000101787 | 258 |
| 408 | 3300005618 | Ga0068864_100164672 | Ga0068864_1001646722 | 258 |
| 409 | 3300005618 | Ga0068864_100256742 | Ga0068864_1002567422 | 258 |
| 410 | 3300005841 | Ga0068863_100003703 | Ga0068863_10000370316 | 258 |
| 411 | 3300005841 | Ga0068863_100227911 | Ga0068863_1002279112 | 258 |
| 412 | 3300005841 | Ga0068863_100442277 | Ga0068863_1004422771 | 258 |
| 413 | 3300005843 | Ga0068860_100080022 | Ga0068860_1000800221 | 258 |
| 414 | 3300005844 | Ga0068862_100009153 | Ga0068862_1000091536 | 258 |
| 415 | 3300006186 | Ga0075369_10074029 | Ga0075369_100740292 | 258 |
| 416 | 3300006931 | Ga0097620_100188112 | Ga0097620_1001881122 | 258 |
| 417 | 3300006931 | Ga0097620_100544137 | Ga0097620_1005441371 | 258 |
| 418 | 3300009093 | Ga0105240_10001378 | Ga0105240_100013788 | 258 |
| 419 | 3300009098 | Ga0105245_10149508 | Ga0105245_101495082 | 258 |
| 420 | 3300009174 | Ga0105241_10098024 | Ga0105241_100980242 | 258 |
| 421 | 3300009177 | Ga0105248_10094819 | Ga0105248_100948193 | 258 |
| 422 | 3300009545 | Ga0105237_10001985 | Ga0105237_100019856 | 258 |
| 423 | 3300009545 | Ga0105237_10203965 | Ga0105237_102039652 | 258 |
| 424 | 3300009551 | Ga0105238_10083230 | Ga0105238_100832304 | 258 |
| 425 | 3300010375 | Ga0105239_10001251 | Ga0105239_100012518 | 258 |
| 426 | 3300010375 | Ga0105239_10121128 | Ga0105239_101211284 | 258 |
| 427 | 3300013297 | Ga0157378_10063147 | Ga0157378_100631472 | 258 |
| 428 | 3300013308 | Ga0157375_10188757 | Ga0157375_101887572 | 258 |
| 429 | 3300014325 | Ga0163163_10005824 | Ga0163163_100058246 | 258 |
| 430 | 3300014968 | Ga0157379_10000772 | Ga0157379_1000077220 | 258 |
| 431 | 3300014968 | Ga0157379_10054798 | Ga0157379_100547983 | 258 |
| 432 | 3300017792 | Ga0163161_10000304 | Ga0163161_1000030434 | 258 |
| 433 | 3300025258 | Ga0209129_1000055 | Ga0209129_1000055188 | 258 |
| 434 | 3300025284 | Ga0209130_1000457 | Ga0209130_100045711 | 258 |
| 435 | 3300025291 | Ga0209675_1001688 | Ga0209675_10016888 | 258 |
| 436 | 3300025292 | Ga0209676_1018248 | Ga0209676_10182481 | 258 |
| 437 | 3300025295 | Ga0209564_1000803 | Ga0209564_100080311 | 258 |
| 438 | 3300025297 | Ga0209758_1000042 | Ga0209758_1000042172 | 258 |
| 439 | 3300025299 | Ga0209256_1000124 | Ga0209256_100012432 | 258 |
| 440 | 3300025302 | Ga0207426_1000055 | Ga0207426_1000055159 | 258 |
| 441 | 3300025303 | Ga0209051_1013731 | Ga0209051_10137315 | 258 |
| 442 | 3300025304 | Ga0209257_1006666 | Ga0209257_10066664 | 258 |
| 443 | 3300025907 | Ga0207645_10054381 | Ga0207645_100543813 | 258 |
| 444 | 3300025922 | Ga0207646_10625590 | Ga0207646_106255901 | 258 |
| 445 | 3300025924 | Ga0207694_10011386 | Ga0207694_100113863 | 258 |
| 446 | 3300025927 | Ga0207687_10102983 | Ga0207687_101029832 | 258 |
| 447 | 3300025931 | Ga0207644_10100904 | Ga0207644_101009042 | 258 |
| 448 | 3300025940 | Ga0207691_10541561 | Ga0207691_105415611 | 258 |
| 449 | 3300025941 | Ga0207711_10066136 | Ga0207711_100661363 | 258 |
| 450 | 3300025942 | Ga0207689_10001840 | Ga0207689_1000184016 | 258 |
| 451 | 3300026035 | Ga0207703_10005673 | Ga0207703_100056737 | 258 |
| 452 | 3300026041 | Ga0207639_10327512 | Ga0207639_103275122 | 258 |
| 453 | 3300026088 | Ga0207641_10001425 | Ga0207641_1000142520 | 258 |
| 454 | 3300026088 | Ga0207641_10039299 | Ga0207641_100392993 | 258 |
| 455 | 3300026095 | Ga0207676_10127809 | Ga0207676_101278092 | 258 |
| 456 | 3300026118 | Ga0207675_100008948 | Ga0207675_1000089486 | 258 |
| 457 | 3300028379 | Ga0268266_10048942 | Ga0268266_100489422 | 258 |
| 458 | 3300028380 | Ga0268265_10263580 | Ga0268265_102635801 | 258 |
| 459 | 3300028381 | Ga0268264_10000840 | Ga0268264_1000084027 | 258 |
| 460 | 3300037068 | Ga0373925_0004630 | Ga0373925_0004630_6773_7612 | 258 |
| 461 | 3300037471 | Ga0395905_0025079 | Ga0395905_0025079_3064_3870 | 258 |
| 462 | 3300042007 | Ga0439449_0000129 | Ga0439449_0000129_372_1181 | 258 |
| 463 | 3300046535 | Ga0495586_0016921 | Ga0495586_0016921_2258_3094 | 258 |
| 464 | 3300046683 | Ga0495658_0094286 | Ga0495658_0094286_479_1318 | 258 |
| 465 | 3300048905 | Ga0496102_0011577 | Ga0496102_0011577_6410_7186 | 258 |
| 466 | 3300048921 | Ga0496118_0170571 | Ga0496118_0170571_11_919 | 258 |
| 467 | 3300050496 | nmdc:mga07m45_142984_c1 | nmdc:mga07m45_142984_c1_246_1052 | 258 |
| 468 | 3300053125 | Ga0500618_013199 | Ga0500618_013199_652_1494 | 258 |
| 469 | 3300053161 | Ga0500634_0074003 | Ga0500634_0074003_476_1303 | 258 |
| 470 | iso_pu_bacteria | 2599185214 | 2599622416 | 258 |
| 471 | iso_pu_bacteria | 2599185226 | 2599674492 | 258 |
| 472 | iso_pu_bacteria | 2599185227 | 2599680177 | 258 |
| 473 | iso_pu_bacteria | 2599185229 | 2599692193 | 258 |
| 474 | iso_pu_bacteria | 2643221654 | 2644301295 | 258 |
| 475 | iso_pu_bacteria | 2818991446 | 2819599106 | 258 |
| 476 | iso_pu_bacteria | 2899924645 | 2899929930 | 258 |
| 477 | iso_pu_bacteria | 2928037797 | 2928042136 | 258 |
| 478 | iso_pu_bacteria | 2928044640 | 2928049905 | 258 |
| 479 | iso_pu_bacteria | 2928051484 | 2928054472 | 258 |
| 480 | iso_pu_bacteria | 2928064002 | 2928070066 | 258 |
| 481 | iso_pu_bacteria | 2928070936 | 2928074325 | 258 |
| 482 | iso_pu_bacteria | 2945909444 | 2945915548 | 258 |
| 483 | 3300001989 | JGI24739J22299_10027556 | JGI24739J22299_100275562 | 259 |
| 484 | 3300003578 | Ga0006562J51391_1038713 | Ga0006562J51391_10387135 | 259 |
| 485 | 3300003578 | Ga0006562J51391_1038717 | Ga0006562J51391_10387173 | 259 |
| 486 | 3300003792 | Ga0055540_1002170 | Ga0055540_10021702 | 259 |
| 487 | 3300003792 | Ga0055540_1005927 | Ga0055540_10059275 | 259 |
| 488 | 3300003794 | Ga0055531_10009461 | Ga0055531_100094615 | 259 |
| 489 | 3300005288 | Ga0065714_10079881 | Ga0065714_100798812 | 259 |
| 490 | 3300005327 | Ga0070658_10146278 | Ga0070658_101462782 | 259 |
| 491 | 3300005333 | Ga0070677_10153572 | Ga0070677_101535721 | 259 |
| 492 | 3300005339 | Ga0070660_100349103 | Ga0070660_1003491031 | 259 |
| 493 | 3300005354 | Ga0070675_100172353 | Ga0070675_1001723532 | 259 |
| 494 | 3300005367 | Ga0070667_100184786 | Ga0070667_1001847863 | 259 |
| 495 | 3300005563 | Ga0068855_100002972 | Ga0068855_1000029726 | 259 |
| 496 | 3300005616 | Ga0068852_100693292 | Ga0068852_1006932921 | 259 |
| 497 | 3300006038 | Ga0075365_10117596 | Ga0075365_101175962 | 259 |
| 498 | 3300006177 | Ga0075362_10007616 | Ga0075362_100076166 | 259 |
| 499 | 3300006186 | Ga0075369_10043244 | Ga0075369_100432442 | 259 |
| 500 | 3300006353 | Ga0075370_10035722 | Ga0075370_100357222 | 259 |
| 501 | 3300006358 | Ga0068871_100129082 | Ga0068871_1001290822 | 259 |
| 502 | 3300009036 | Ga0105244_10018749 | Ga0105244_100187492 | 259 |
| 503 | 3300009098 | Ga0105245_10724920 | Ga0105245_107249201 | 259 |
| 504 | 3300009148 | Ga0105243_10001608 | Ga0105243_1000160811 | 259 |
| 505 | 3300009148 | Ga0105243_10004197 | Ga0105243_100041972 | 259 |
| 506 | 3300009148 | Ga0105243_10464133 | Ga0105243_104641332 | 259 |
| 507 | 3300009174 | Ga0105241_10237780 | Ga0105241_102377802 | 259 |
| 508 | 3300013100 | Ga0157373_10015591 | Ga0157373_100155912 | 259 |
| 509 | 3300013104 | Ga0157370_10492323 | Ga0157370_104923232 | 259 |
| 510 | 3300013308 | Ga0157375_11010774 | Ga0157375_110107741 | 259 |
| 511 | 3300014497 | Ga0182008_10001524 | Ga0182008_100015243 | 259 |
| 512 | 3300014969 | Ga0157376_10354300 | Ga0157376_103543002 | 259 |
| 513 | 3300015261 | Ga0182006_1003278 | Ga0182006_10032787 | 259 |
| 514 | 3300015261 | Ga0182006_1065298 | Ga0182006_10652982 | 259 |
| 515 | 3300015262 | Ga0182007_10000837 | Ga0182007_1000083717 | 259 |
| 516 | 3300015262 | Ga0182007_10003776 | Ga0182007_100037766 | 259 |
| 517 | 3300015683 | Ga0183362_10004 | Ga0183362_1000418 | 259 |
| 518 | 3300017792 | Ga0163161_10033820 | Ga0163161_100338203 | 259 |
| 519 | 3300017792 | Ga0163161_10203266 | Ga0163161_102032662 | 259 |
| 520 | 3300025292 | Ga0209676_1002233 | Ga0209676_10022335 | 259 |
| 521 | 3300025292 | Ga0209676_1018608 | Ga0209676_10186083 | 259 |
| 522 | 3300025298 | Ga0209050_1005317 | Ga0209050_10053176 | 259 |
| 523 | 3300025303 | Ga0209051_1000126 | Ga0209051_100012611 | 259 |
| 524 | 3300025303 | Ga0209051_1000284 | Ga0209051_10002846 | 259 |
| 525 | 3300025303 | Ga0209051_1000446 | Ga0209051_100044630 | 259 |
| 526 | 3300025304 | Ga0209257_1005730 | Ga0209257_10057305 | 259 |
| 527 | 3300025728 | Ga0207655_1001192 | Ga0207655_100119216 | 259 |
| 528 | 3300025903 | Ga0207680_10371595 | Ga0207680_103715952 | 259 |
| 529 | 3300025926 | Ga0207659_10179453 | Ga0207659_101794533 | 259 |
| 530 | 3300025933 | Ga0207706_10008446 | Ga0207706_100084465 | 259 |
| 531 | 3300025935 | Ga0207709_10000405 | Ga0207709_1000040530 | 259 |
| 532 | 3300025935 | Ga0207709_10000540 | Ga0207709_1000054011 | 259 |
| 533 | 3300025940 | Ga0207691_10202465 | Ga0207691_102024652 | 259 |
| 534 | 3300025945 | Ga0207679_10102797 | Ga0207679_101027973 | 259 |
| 535 | 3300025949 | Ga0207667_10006390 | Ga0207667_100063906 | 259 |
| 536 | 3300025986 | Ga0207658_10267498 | Ga0207658_102674982 | 259 |
| 537 | 3300026089 | Ga0207648_10205389 | Ga0207648_102053892 | 259 |
| 538 | 3300026116 | Ga0207674_10054335 | Ga0207674_100543352 | 259 |
| 539 | 3300026121 | Ga0207683_10180203 | Ga0207683_101802032 | 259 |
| 540 | 3300028794 | Ga0307515_10028818 | Ga0307515_100288189 | 259 |
| 541 | 3300030522 | Ga0307512_10084254 | Ga0307512_100842542 | 259 |
| 542 | 3300031251 | Ga0265327_10064913 | Ga0265327_100649131 | 259 |
| 543 | 3300031507 | Ga0307509_10002541 | Ga0307509_100025419 | 259 |
| 544 | 3300031507 | Ga0307509_10003190 | Ga0307509_1000319022 | 259 |
| 545 | 3300031507 | Ga0307509_10008176 | Ga0307509_1000817611 | 259 |
| 546 | 3300031616 | Ga0307508_10002422 | Ga0307508_1000242210 | 259 |
| 547 | 3300031616 | Ga0307508_10041228 | Ga0307508_100412281 | 259 |
| 548 | 3300031649 | Ga0307514_10030903 | Ga0307514_100309034 | 259 |
| 549 | 3300031649 | Ga0307514_10059933 | Ga0307514_100599333 | 259 |
| 550 | 3300031731 | Ga0307405_10155211 | Ga0307405_101552111 | 259 |
| 551 | 3300031901 | Ga0307406_10001733 | Ga0307406_1000173314 | 259 |
| 552 | 3300032005 | Ga0307411_10028523 | Ga0307411_100285232 | 259 |
| 553 | 3300033180 | Ga0307510_10034134 | Ga0307510_100341342 | 259 |
| 554 | 3300034820 | Ga0373959_0004443 | Ga0373959_0004443_704_1537 | 259 |
| 555 | 3300035691 | Ga0373931_0016995 | Ga0373931_0016995_933_1754 | 259 |
| 556 | 3300046459 | Ga0495629_0076852 | Ga0495629_0076852_1318_2145 | 259 |
| 557 | 3300046515 | Ga0495620_0133003 | Ga0495620_0133003_46_864 | 259 |
| 558 | 3300046517 | Ga0495630_0091176 | Ga0495630_0091176_624_1448 | 259 |
| 559 | 3300046535 | Ga0495586_0118713 | Ga0495586_0118713_437_1264 | 259 |
| 560 | 3300046539 | Ga0495621_0039969 | Ga0495621_0039969_233_1060 | 259 |
| 561 | 3300046558 | Ga0495633_0092218 | Ga0495633_0092218_57_884 | 259 |
| 562 | 3300046615 | Ga0495656_0002204 | Ga0495656_0002204_3352_4179 | 259 |
| 563 | 3300046660 | Ga0495625_0000136 | Ga0495625_0000136_91006_91869 | 259 |
| 564 | 3300046683 | Ga0495658_0055161 | Ga0495658_0055161_1327_2175 | 259 |
| 565 | 3300046691 | Ga0495670_0176558 | Ga0495670_0176558_11_838 | 259 |
| 566 | 3300048090 | Ga0495615_0002659 | Ga0495615_0002659_148_975 | 259 |
| 567 | 3300048903 | Ga0496100_0026056 | Ga0496100_0026056_2639_3466 | 259 |
| 568 | 3300048904 | Ga0496101_0013253 | Ga0496101_0013253_3741_4568 | 259 |
| 569 | 3300048905 | Ga0496102_0008824 | Ga0496102_0008824_7062_7889 | 259 |
| 570 | 3300048907 | Ga0496104_0049293 | Ga0496104_0049293_1744_2571 | 259 |
| 571 | 3300048908 | Ga0496105_0035902 | Ga0496105_0035902_974_1801 | 259 |
| 572 | 3300048909 | Ga0496106_0008083 | Ga0496106_0008083_6414_7241 | 259 |
| 573 | 3300048911 | Ga0496108_0701730 | Ga0496108_0701730_37_864 | 259 |
| 574 | 3300048914 | Ga0496111_0092473 | Ga0496111_0092473_1354_2181 | 259 |
| 575 | 3300048921 | Ga0496118_0010997 | Ga0496118_0010997_6405_7250 | 259 |
| 576 | 3300048924 | Ga0496121_0154007 | Ga0496121_0154007_557_1402 | 259 |
| 577 | 3300048928 | Ga0496125_0043450 | Ga0496125_0043450_1970_2815 | 259 |
| 578 | 3300050489 | nmdc:mga03683_4303_c1 | nmdc:mga03683_4303_c1_2217_3080 | 259 |
| 579 | 3300050493 | nmdc:mga0k408_54674_c1 | nmdc:mga0k408_54674_c1_1148_2011 | 259 |
| 580 | 3300050494 | nmdc:mga06z11_129189_c1 | nmdc:mga06z11_129189_c1_426_1271 | 259 |
| 581 | 3300050496 | nmdc:mga07m45_168746_c1 | nmdc:mga07m45_168746_c1_326_1156 | 259 |
| 582 | 3300050516 | nmdc:mga0sz30_16457_c1 | nmdc:mga0sz30_16457_c1_668_1531 | 259 |
| 583 | 3300053121 | Ga0500607_060158 | Ga0500607_060158_1112_1951 | 259 |
| 584 | 3300002705 | JGI25156J39149_1000064 | JGI25156J39149_100006411 | 260 |
| 585 | 3300002738 | JGI25154J39366_1002258 | JGI25154J39366_10022583 | 260 |
| 586 | 3300002741 | JGI25157J39369_1000083 | JGI25157J39369_100008311 | 260 |
| 587 | 3300003752 | Ga0055539_1000154 | Ga0055539_100015427 | 260 |
| 588 | 3300003752 | Ga0055539_1000635 | Ga0055539_10006357 | 260 |
| 589 | 3300003756 | Ga0055533_1000011 | Ga0055533_1000011420 | 260 |
| 590 | 3300005334 | Ga0068869_100105892 | Ga0068869_1001058922 | 260 |
| 591 | 3300005356 | Ga0070674_100253115 | Ga0070674_1002531151 | 260 |
| 592 | 3300005539 | Ga0068853_100220761 | Ga0068853_1002207611 | 260 |
| 593 | 3300005543 | Ga0070672_100125337 | Ga0070672_1001253372 | 260 |
| 594 | 3300005577 | Ga0068857_100008364 | Ga0068857_1000083641 | 260 |
| 595 | 3300005578 | Ga0068854_100004287 | Ga0068854_1000042873 | 260 |
| 596 | 3300005614 | Ga0068856_100000510 | Ga0068856_1000005106 | 260 |
| 597 | 3300009093 | Ga0105240_10083345 | Ga0105240_100833451 | 260 |
| 598 | 3300009176 | Ga0105242_10108770 | Ga0105242_101087703 | 260 |
| 599 | 3300010375 | Ga0105239_10086515 | Ga0105239_100865153 | 260 |
| 600 | 3300011119 | Ga0105246_10105651 | Ga0105246_101056512 | 260 |
| 601 | 3300025226 | Ga0209674_100003 | Ga0209674_100003719 | 260 |
| 602 | 3300025230 | Ga0209563_100010 | Ga0209563_100010449 | 260 |
| 603 | 3300025242 | Ga0209258_100424 | Ga0209258_10042444 | 260 |
| 604 | 3300025246 | Ga0209646_1000129 | Ga0209646_100012955 | 260 |
| 605 | 3300025250 | Ga0209026_1000059 | Ga0209026_100005955 | 260 |
| 606 | 3300025253 | Ga0209677_100044 | Ga0209677_100044154 | 260 |
| 607 | 3300025253 | Ga0209677_100126 | Ga0209677_10012640 | 260 |
| 608 | 3300025256 | Ga0209759_1000081 | Ga0209759_100008199 | 260 |
| 609 | 3300025911 | Ga0207654_10070195 | Ga0207654_100701952 | 260 |
| 610 | 3300025913 | Ga0207695_10005596 | Ga0207695_100055961 | 260 |
| 611 | 3300025937 | Ga0207669_10231741 | Ga0207669_102317412 | 260 |
| 612 | 3300025942 | Ga0207689_10087242 | Ga0207689_100872423 | 260 |
| 613 | 3300025981 | Ga0207640_10087059 | Ga0207640_100870592 | 260 |
| 614 | 3300026078 | Ga0207702_10001084 | Ga0207702_1000108432 | 260 |
| 615 | 3300026116 | Ga0207674_10004452 | Ga0207674_100044525 | 260 |
| 616 | 3300026118 | Ga0207675_100024421 | Ga0207675_1000244214 | 260 |
| 617 | 3300030732 | Ga0316176_1042109 | Ga0316176_10421094 | 260 |
| 618 | 3300030735 | Ga0316178_1061531 | Ga0316178_10615312 | 260 |
| 619 | 3300030744 | Ga0316181_1195265 | Ga0316181_11952651 | 260 |
| 620 | 3300031731 | Ga0307405_10232283 | Ga0307405_102322831 | 260 |
| 621 | 3300032004 | Ga0307414_10182326 | Ga0307414_101823262 | 260 |
| 622 | 3300047321 | Ga0495676_0208650 | Ga0495676_0208650_119_958 | 260 |
| 623 | 3300048908 | Ga0496105_0338849 | Ga0496105_0338849_82_924 | 260 |
| 624 | 3300048917 | Ga0496114_0438276 | Ga0496114_0438276_131_970 | 260 |
| 625 | 3300055283 | Ga0500661_016978 | Ga0500661_016978_396_1235 | 260 |
| 626 | 3300030734 | Ga0316179_1063319 | Ga0316179_10633192 | 261 |
| 627 | 3300030736 | Ga0316180_1072720 | Ga0316180_10727202 | 261 |
| 628 | 3300031731 | Ga0307405_10006552 | Ga0307405_100065525 | 261 |
| 629 | 3300032002 | Ga0307416_100488055 | Ga0307416_1004880552 | 261 |
| 630 | 3300049679 | Ga0501249_008246 | Ga0501249_008246_1053_1964 | 261 |
| 631 | 3300049705 | Ga0501225_0011240 | Ga0501225_0011240_611_1522 | 261 |
| 632 | 3300053080 | Ga0500635_0000029 | Ga0500635_0000029_54541_55401 | 261 |
| 633 | 3300053122 | Ga0500608_034025 | Ga0500608_034025_1513_2391 | 261 |
| 634 | 3300053136 | Ga0500559_0002006 | Ga0500559_0002006_5879_6757 | 261 |
| 635 | iso_pu_bacteria | 2945984333 | 2945989042 | 261 |
| 636 | 3300005293 | Ga0065715_10370311 | Ga0065715_103703111 | 262 |
| 637 | 3300005331 | Ga0070670_100109513 | Ga0070670_1001095132 | 262 |
| 638 | 3300005347 | Ga0070668_100034898 | Ga0070668_1000348984 | 262 |
| 639 | 3300013104 | Ga0157370_10046236 | Ga0157370_100462366 | 262 |
| 640 | 3300025940 | Ga0207691_10051486 | Ga0207691_100514862 | 262 |
| 641 | 3300005366 | Ga0070659_100027906 | Ga0070659_1000279061 | 263 |
| 642 | 3300005577 | Ga0068857_100308444 | Ga0068857_1003084442 | 263 |
| 643 | 3300048925 | Ga0496122_0000080 | Ga0496122_0000080_71153_72043 | 263 |
| 644 | 3300048926 | Ga0496123_0000072 | Ga0496123_0000072_140343_141233 | 263 |
| 645 | 3300003773 | Ga0055537_1000487 | Ga0055537_100048710 | 264 |
| 646 | 3300003784 | Ga0055534_1000037 | Ga0055534_100003710 | 264 |
| 647 | 3300006195 | Ga0075366_10018013 | Ga0075366_100180135 | 264 |
| 648 | 3300006353 | Ga0075370_10162383 | Ga0075370_101623832 | 264 |
| 649 | 3300006948 | Ga0099826_10007091 | Ga0099826_100070918 | 264 |
| 650 | 3300017792 | Ga0163161_10003838 | Ga0163161_100038382 | 264 |
| 651 | 3300025263 | Ga0209565_1000131 | Ga0209565_100013188 | 264 |
| 652 | 3300025273 | Ga0209673_1000170 | Ga0209673_100017088 | 264 |
| 653 | 3300025291 | Ga0209675_1000055 | Ga0209675_100005588 | 264 |
| 654 | 3300025294 | Ga0209025_1054000 | Ga0209025_10540002 | 264 |
| 655 | 3300027666 | Ga0209282_1015251 | Ga0209282_10152512 | 264 |
| 656 | 3300032004 | Ga0307414_10061159 | Ga0307414_100611592 | 264 |
| 657 | 3300032005 | Ga0307411_10088536 | Ga0307411_100885361 | 264 |
| 658 | 3300032005 | Ga0307411_10230712 | Ga0307411_102307122 | 264 |
| 659 | 3300047472 | Ga0495686_0001817 | Ga0495686_0001817_15211_16074 | 264 |
| 660 | 3300049759 | Ga0501262_000864 | Ga0501262_000864_1069_1980 | 264 |
| 661 | iso_pu_bacteria | 2643221628 | 2644160874 | 264 |
| 662 | iso_pu_bacteria | 2842677519 | 2842679262 | 264 |
| 663 | iso_pu_bacteria | 2842747753 | 2842750110 | 264 |
| 664 | iso_pu_bacteria | 2904479285 | 2904481322 | 264 |
| 665 | iso_pu_bacteria | 2919462493 | 2919464507 | 264 |
| 666 | 3300006948 | Ga0099826_10052996 | Ga0099826_100529964 | 265 |
| 667 | 3300025256 | Ga0209759_1004174 | Ga0209759_10041745 | 265 |
| 668 | 3300046460 | Ga0495638_0136434 | Ga0495638_0136434_111_968 | 265 |
| 669 | 3300046512 | Ga0495610_0071874 | Ga0495610_0071874_171_1028 | 265 |
| 670 | 3300053086 | Ga0500578_0023086 | Ga0500578_0023086_853_1725 | 265 |
| 671 | 3300053088 | Ga0500644_0011292 | Ga0500644_0011292_895_1752 | 265 |
| 672 | 3300053093 | Ga0500651_0072746 | Ga0500651_0072746_501_1358 | 265 |
| 673 | 3300053118 | Ga0500594_0000520 | Ga0500594_0000520_1681_2538 | 265 |
| 674 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_53527_54384 | 265 |
| 675 | 3300053138 | Ga0500564_046051 | Ga0500564_046051_169_1044 | 265 |
| 676 | 3300053154 | Ga0500619_048723 | Ga0500619_048723_164_1039 | 265 |
| 677 | 3300053156 | Ga0500622_0015369 | Ga0500622_0015369_2436_3293 | 265 |
| 678 | 3300053730 | Ga0500645_006788 | Ga0500645_006788_1735_2607 | 265 |
| 679 | 3300009176 | Ga0105242_10273390 | Ga0105242_102733901 | 266 |
| 680 | 3300014497 | Ga0182008_10161193 | Ga0182008_101611931 | 266 |
| 681 | 3300017792 | Ga0163161_10046519 | Ga0163161_100465193 | 266 |
| 682 | 3300025923 | Ga0207681_10011830 | Ga0207681_100118304 | 266 |
| 683 | 3300046506 | Ga0495583_0000149 | Ga0495583_0000149_18979_19938 | 266 |
| 684 | 3300046507 | Ga0495606_0007595 | Ga0495606_0007595_4196_5155 | 266 |
| 685 | 3300046616 | Ga0495668_0135105 | Ga0495668_0135105_73_1032 | 266 |
| 686 | 3300046660 | Ga0495625_0008517 | Ga0495625_0008517_7304_8227 | 266 |
| 687 | 3300046694 | Ga0495649_0000946 | Ga0495649_0000946_19662_20621 | 266 |
| 688 | 3300048927 | Ga0496124_0051736 | Ga0496124_0051736_456_1346 | 266 |
| 689 | iso_pu_bacteria | 2643221683 | 2644469441 | 266 |
| 690 | 2162886012 | MBSR1b_contig_7730667 | MBSR1b_0222.00004540 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wcg-assembly1.cif.gz_B | the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna | 0.8896 | 20 | 76 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.8865 | 21 | 76 |
| 4kmf-assembly1.cif.gz_A-2 | crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna | 0.8845 | 17 | 76 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.877 | 17 | 77 |
| 7c0i-assembly1.cif.gz_A | crystal structure of chimeric mutant of e3l in complex with z-dna | 0.8746 | 22 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xrnA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9385 | 19 | 78 | 1.10.10.10 |
| af_P0ACN4_17_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9273 | 12 | 86 | 1.10.10.10 |
| 2xroE01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9167 | 17 | 83 | 1.10.10.10 |
| 2g7uD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9106 | 17 | 76 | 1.10.10.10 |
| af_P0ACN4_17_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9049 | 12 | 86 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2DX48-F1-model_v4 | p-hydroxyphenylacetate 3-hydroxylase, reductase component (EC 1.5.1.36) | 0.8897 | 90 | 267 |
GO:0010181
GO:0036382 GO:0042602 |
| AF-A0A3N9XVZ6-F1-model_v4 | IclR family transcriptional regulator | 0.8869 | 93 | 267 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A2V9QTZ5-F1-model_v4 | IclR-ED domain-containing protein | 0.8826 | 93 | 263 |
GO:0003677
GO:0003700 GO:0045892 |
| AF-A0A840RTQ4-F1-model_v4 | Flavin reductase (DIM6/NTAB) family NADH-FMN oxidoreductase RutF | 0.8649 | 92 | 267 |
GO:0010181
GO:0042602 |
| AF-A0A532VDM2-F1-model_v4 | IclR-ED domain-containing protein | 0.8643 | 103 | 266 |
GO:0003677
GO:0003700 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar