F475429

General Info

Members Datasets Scaffolds Average Seq Length
690 372 1380 209

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100825830|Ga0070678_1008258301
Length 231
Sequence VKDNTHPAPPGRVRILIIDDHYVVRQGLKMILNEQFEHAQFGEAATGQEGLNHVWDHDWDVVLVDISMPGRGGLDVLKDIKHSKPKLPVIILSMHSEDQYAIRALKLGACGYIRKDSVGQELVQAVTTALTGARYITPSIAQKLAVHLQHEQEGPPHDALADREYQVMCMIALGKTVSEIGNELSLSVKTISTHRARILKKLSVANNEQIMRYAVMHGLVDVESGITAREE

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
178 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
194 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
205 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
206 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
207 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
212 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
213 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
214 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
220 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
241 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
244 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
245 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
246 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
247 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
248 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
249 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
252 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
253 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
254 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
255 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
256 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
260 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
274 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
319 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
340 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
341 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
342 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
343 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
344 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
364 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
369 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
370 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
371 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
372 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.87
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 1.3
Rhizosphere 95.65
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100825830 3300005456 Unclassified 843
2 JGI25406J46586_10043687 3300003203 Bacteria 1558
3 Ga0058859_10033578 3300004798 Bacteria 2286
4 Ga0058861_10058411 3300004800 Bacteria 1436
5 Ga0058860_12196631 3300004801 Bacteria 943
6 Ga0065715_10560032 3300005293 Unclassified 734
7 Ga0065707_10146536 3300005295 Unclassified 1707
8 Ga0070676_10022726 3300005328 Unclassified 3518
9 Ga0070676_10391663 3300005328 Bacteria 964
10 Ga0070690_100004639 3300005330 Bacteria 7648
11 Ga0070690_100034888 3300005330 Unclassified 3155
12 Ga0070690_100080021 3300005330 Bacteria 2137
13 Ga0070690_100180716 3300005330 Bacteria 1457
14 Ga0070670_100022786 3300005331 Bacteria 5389
15 Ga0070670_100031414 3300005331 Bacteria 4573
16 Ga0070670_100967256 3300005331 Bacteria 773
17 Ga0070677_10042471 3300005333 Unclassified 1801
18 Ga0068869_100001704 3300005334 Bacteria 13134
19 Ga0068869_100552509 3300005334 Unclassified 967
20 Ga0070666_10004229 3300005335 Bacteria 8718
21 Ga0070666_10562615 3300005335 Bacteria 830
22 Ga0070680_100002230 3300005336 Bacteria 14302
23 Ga0070680_100147061 3300005336 Bacteria 1977
24 Ga0070680_100151862 3300005336 Bacteria 1944
25 Ga0070680_100259184 3300005336 Unclassified 1471
26 Ga0070680_100646845 3300005336 Bacteria 909
27 Ga0070682_100000067 3300005337 Bacteria 96458
28 Ga0068868_100044416 3300005338 Unclassified 3474
29 Ga0068868_100057979 3300005338 Bacteria 3060
30 Ga0070689_100057603 3300005340 Bacteria 3016
31 Ga0070689_100221966 3300005340 Bacteria 1550
32 Ga0070691_10001570 3300005341 Bacteria 9865
33 Ga0070687_100000821 3300005343 Bacteria 10354
34 Ga0070687_100141480 3300005343 Bacteria 1402
35 Ga0070687_100506623 3300005343 Bacteria 813
36 Ga0070661_100074138 3300005344 Unclassified 2506
37 Ga0070692_10095755 3300005345 Bacteria 1620
38 Ga0070668_100079471 3300005347 Bacteria 2568
39 Ga0070669_100087566 3300005353 Unclassified 2329
40 Ga0070669_100495355 3300005353 Bacteria 1013
41 Ga0070675_100031415 3300005354 Bacteria 4293
42 Ga0070671_100012951 3300005355 Bacteria 6720
43 Ga0070674_100000282 3300005356 Bacteria 24872
44 Ga0070674_100044977 3300005356 Bacteria 3014
45 Ga0070673_100000027 3300005364 Bacteria 71407
46 Ga0070673_100160848 3300005364 Bacteria 1910
47 Ga0070659_100033076 3300005366 Bacteria 4015
48 Ga0070667_100053508 3300005367 Unclassified 3407
49 Ga0070709_10277519 3300005434 Bacteria 1217
50 Ga0070714_100121445 3300005435 Bacteria 2324
51 Ga0070710_10101677 3300005437 Bacteria 1713
52 Ga0070701_10012125 3300005438 Bacteria 3877
53 Ga0070705_100012874 3300005440 Bacteria 4267
54 Ga0070705_100014567 3300005440 Bacteria 4048
55 Ga0070705_100021347 3300005440 Bacteria 3443
56 Ga0070705_100095597 3300005440 Bacteria 1863
57 Ga0070705_100105337 3300005440 Bacteria 1790
58 Ga0070700_100004048 3300005441 Bacteria 7630
59 Ga0070700_100076611 3300005441 Bacteria 2148
60 Ga0070694_100004096 3300005444 Bacteria 8749
61 Ga0070694_100019702 3300005444 Bacteria 4293
62 Ga0070694_100236780 3300005444 Bacteria 1375
63 Ga0070694_100255878 3300005444 Bacteria 1326
64 Ga0070694_100362047 3300005444 Bacteria 1127
65 Ga0070708_100286305 3300005445 Bacteria 1551
66 Ga0070663_100168805 3300005455 Unclassified 1690
67 Ga0070678_100003474 3300005456 Bacteria 8782
68 Ga0070678_100687157 3300005456 Bacteria 921
69 Ga0070662_100069089 3300005457 Unclassified 2599
70 Ga0070681_10000720 3300005458 Bacteria 27395
71 Ga0070681_10181712 3300005458 Bacteria 2025
72 Ga0068867_100006962 3300005459 Bacteria 7995
73 Ga0068867_100007000 3300005459 Bacteria 7969
74 Ga0068867_100688865 3300005459 Bacteria 901
75 Ga0070706_100300453 3300005467 Bacteria 1498
76 Ga0070707_100067608 3300005468 Bacteria 3438
77 Ga0070699_100113399 3300005518 Bacteria 2381
78 Ga0070679_100041060 3300005530 Bacteria 4605
79 Ga0070684_100066324 3300005535 Bacteria 3169
80 Ga0070697_100032296 3300005536 Bacteria 4212
81 Ga0070697_100089743 3300005536 Bacteria 2540
82 Ga0068853_100434192 3300005539 Bacteria 1233
83 Ga0070672_100000655 3300005543 Bacteria 20239
84 Ga0070672_100028480 3300005543 Bacteria 4179
85 Ga0070686_100003451 3300005544 Bacteria 8670
86 Ga0070686_100024914 3300005544 Bacteria 3591
87 Ga0070695_100001782 3300005545 Bacteria 12122
88 Ga0070695_100161565 3300005545 Bacteria 1573
89 Ga0070695_100230913 3300005545 Bacteria 1337
90 Ga0070696_100006269 3300005546 Bacteria 7963
91 Ga0070696_100031211 3300005546 Bacteria 3651
92 Ga0070693_100027535 3300005547 Bacteria 3082
93 Ga0070693_100234627 3300005547 Unclassified 1209
94 Ga0070665_100029569 3300005548 Bacteria 5515
95 Ga0070704_100004949 3300005549 Bacteria 7734
96 Ga0070704_100019763 3300005549 Bacteria 4333
97 Ga0070704_100057954 3300005549 Bacteria 2757
98 Ga0070704_100112577 3300005549 Unclassified 2074
99 Ga0070704_100115794 3300005549 Bacteria 2049
100 Ga0070704_100225158 3300005549 Bacteria 1527
101 Ga0070704_100619072 3300005549 Bacteria 953
102 Ga0068855_100005265 3300005563 Bacteria 15795
103 Ga0070664_100040877 3300005564 Unclassified 3911
104 Ga0068854_100070570 3300005578 Bacteria 2553
105 Ga0068856_100013045 3300005614 Bacteria 8048
106 Ga0068856_100769210 3300005614 Bacteria 983
107 Ga0070702_100001902 3300005615 Bacteria 8761
108 Ga0070702_100033529 3300005615 Bacteria 2824
109 Ga0068852_100221920 3300005616 Bacteria 1798
110 Ga0068852_100347120 3300005616 Unclassified 1448
111 Ga0068859_100033006 3300005617 Bacteria 5199
112 Ga0068859_100050635 3300005617 Bacteria 4172
113 Ga0068859_100258639 3300005617 Bacteria 1832
114 Ga0068864_100104887 3300005618 Bacteria 2512
115 Ga0068866_10001148 3300005718 Bacteria 11632
116 Ga0068866_10021798 3300005718 Bacteria 2955
117 Ga0068866_10642434 3300005718 Bacteria 721
118 Ga0068861_100034873 3300005719 Bacteria 3723
119 Ga0068863_100345866 3300005841 Bacteria 1447
120 Ga0068863_100684378 3300005841 Unclassified 1019
121 Ga0068858_100071360 3300005842 Bacteria 3221
122 Ga0068860_100176973 3300005843 Bacteria 2062
123 Ga0068860_100190370 3300005843 Bacteria 1985
124 Ga0068860_100431537 3300005843 Bacteria 1307
125 Ga0068862_100018223 3300005844 Bacteria 5845
126 Ga0068862_100136303 3300005844 Bacteria 2175
127 Ga0081538_10036883 3300005981 Bacteria 3182
128 Ga0081539_10002158 3300005985 Bacteria 28978
129 Ga0070717_10919836 3300006028 Bacteria 796
130 Ga0070715_10054753 3300006163 Bacteria 1729
131 Ga0097621_100101724 3300006237 Bacteria 2418
132 Ga0097621_100158256 3300006237 Bacteria 1946
133 Ga0097621_100181536 3300006237 Unclassified 1818
134 Ga0068871_100009825 3300006358 Bacteria 6944
135 Ga0068871_100018921 3300006358 Bacteria 5248
136 Ga0068871_100036675 3300006358 Bacteria 3905
137 Ga0068871_100547569 3300006358 Unclassified 1048
138 Ga0075428_100005942 3300006844 Bacteria 13563
139 Ga0075428_100016454 3300006844 Bacteria 8167
140 Ga0075428_100032886 3300006844 Bacteria 5727
141 Ga0075428_100322043 3300006844 Unclassified 1661
142 Ga0075430_100013066 3300006846 Bacteria 7075
143 Ga0075430_100075634 3300006846 Bacteria 2823
144 Ga0075430_100142818 3300006846 Bacteria 1993
145 Ga0075430_100271399 3300006846 Bacteria 1404
146 Ga0075430_100331034 3300006846 Unclassified 1258
147 Ga0075430_100441106 3300006846 Bacteria 1075
148 Ga0075431_100007501 3300006847 Bacteria 10858
149 Ga0075431_100229406 3300006847 Bacteria 1892
150 Ga0075431_100508616 3300006847 Bacteria 1195
151 Ga0075433_10146331 3300006852 Bacteria 2100
152 Ga0075433_10376498 3300006852 Bacteria 1253
153 Ga0075434_100000637 3300006871 Bacteria 27077
154 Ga0075434_100027268 3300006871 Bacteria 5606
155 Ga0075434_100400539 3300006871 Bacteria 1393
156 Ga0075434_100408239 3300006871 Bacteria 1379
157 Ga0075429_100002429 3300006880 Bacteria 15689
158 Ga0075429_100047465 3300006880 Bacteria 3736
159 Ga0075429_100165976 3300006880 Bacteria 1934
160 Ga0075429_100733082 3300006880 Bacteria 866
161 Ga0068865_100020691 3300006881 Bacteria 4270
162 Ga0075436_100002105 3300006914 Bacteria 13742
163 Ga0075436_100009310 3300006914 Bacteria 6717
164 Ga0075436_100020187 3300006914 Bacteria 4573
165 Ga0075436_100333261 3300006914 Bacteria 1092
166 Ga0075436_100355268 3300006914 Bacteria 1056
167 Ga0097620_100033005 3300006931 Bacteria 5199
168 Ga0097620_100050640 3300006931 Bacteria 4172
169 Ga0097620_100258639 3300006931 Bacteria 1832
170 Ga0075435_100011829 3300007076 Bacteria 6442
171 Ga0075435_100022586 3300007076 Bacteria 4853
172 Ga0075435_100219341 3300007076 Bacteria 1615
173 Ga0075435_100481979 3300007076 Bacteria 1071
174 Ga0075435_100648213 3300007076 Bacteria 917
175 Ga0099794_10016647 3300007265 Bacteria 3263
176 Ga0105240_10719459 3300009093 Unclassified 1088
177 Ga0111539_10008078 3300009094 Bacteria 13411
178 Ga0111539_10008809 3300009094 Bacteria 12795
179 Ga0111539_10013111 3300009094 Bacteria 10367
180 Ga0111539_10142557 3300009094 Unclassified 2805
181 Ga0111539_10254824 3300009094 Bacteria 2043
182 Ga0105245_10004171 3300009098 Bacteria 12837
183 Ga0114129_10007266 3300009147 Bacteria 15761
184 Ga0114129_10077350 3300009147 Bacteria 4628
185 Ga0114129_10311632 3300009147 Bacteria 2095
186 Ga0105243_10084982 3300009148 Bacteria 2593
187 Ga0105243_10175536 3300009148 Bacteria 1859
188 Ga0105243_10286988 3300009148 Bacteria 1485
189 Ga0105243_10810670 3300009148 Bacteria 923
190 Ga0105241_10011280 3300009174 Bacteria 6551
191 Ga0105242_10003038 3300009176 Bacteria 13114
192 Ga0105248_10111632 3300009177 Bacteria 3083
193 Ga0105237_10000137 3300009545 Bacteria 102639
194 Ga0105249_10035913 3300009553 Bacteria 4495
195 Ga0105239_10657321 3300010375 Bacteria 1197
196 Ga0157329_1008665 3300012491 Bacteria 765
197 Ga0157371_10017208 3300013102 Bacteria 5374
198 Ga0157370_10268514 3300013104 Bacteria 1576
199 Ga0157369_10778625 3300013105 Bacteria 983
200 Ga0157374_10057328 3300013296 Unclassified 3638
201 Ga0157378_10000235 3300013297 Bacteria 53980
202 Ga0157378_10011451 3300013297 Bacteria 7762
203 Ga0157378_10023055 3300013297 Bacteria 5479
204 Ga0163162_10134166 3300013306 Bacteria 2586
205 Ga0163162_10527884 3300013306 Bacteria 1309
206 Ga0157375_10256775 3300013308 Unclassified 1909
207 Ga0157380_10042501 3300014326 Bacteria 3553
208 Ga0157380_10146740 3300014326 Bacteria 2034
209 Ga0157380_10239130 3300014326 Bacteria 1636
210 Ga0157377_10212957 3300014745 Bacteria 1233
211 Ga0157379_10004082 3300014968 Bacteria 12455
212 Ga0157379_10132788 3300014968 Bacteria 2241
213 Ga0157376_10001991 3300014969 Bacteria 13678
214 Ga0157376_10008195 3300014969 Bacteria 7520
215 Ga0157376_10633135 3300014969 Bacteria 1068
216 Ga0163161_10090480 3300017792 Bacteria 2264
217 Ga0163161_10517028 3300017792 Bacteria 974
218 Ga0207697_10048717 3300025315 Unclassified 1748
219 Ga0207653_10013523 3300025885 Bacteria 2555
220 Ga0207682_10017696 3300025893 Bacteria 2783
221 Ga0207682_10085437 3300025893 Unclassified 1359
222 Ga0207692_10072042 3300025898 Bacteria 1824
223 Ga0207642_10019300 3300025899 Bacteria 2638
224 Ga0207642_10019861 3300025899 Bacteria 2611
225 Ga0207680_10117382 3300025903 Unclassified 1735
226 Ga0207685_10003876 3300025905 Bacteria 3708
227 Ga0207645_10017450 3300025907 Unclassified 4737
228 Ga0207645_10059989 3300025907 Bacteria 2430
229 Ga0207645_10279262 3300025907 Bacteria 1109
230 Ga0207643_10022173 3300025908 Bacteria 3494
231 Ga0207643_10087835 3300025908 Bacteria 1809
232 Ga0207707_10015506 3300025912 Bacteria 6638
233 Ga0207671_10001268 3300025914 Bacteria 29771
234 Ga0207660_10036650 3300025917 Bacteria 3411
235 Ga0207660_10096295 3300025917 Bacteria 2203
236 Ga0207660_10251222 3300025917 Bacteria 1396
237 Ga0207660_10543360 3300025917 Bacteria 945
238 Ga0207662_10000163 3300025918 Bacteria 31537
239 Ga0207662_10185761 3300025918 Bacteria 1339
240 Ga0207649_10070531 3300025920 Unclassified 2229
241 Ga0207652_10048128 3300025921 Bacteria 3644
242 Ga0207681_10013598 3300025923 Bacteria 5039
243 Ga0207681_10134109 3300025923 Unclassified 1835
244 Ga0207650_10008640 3300025925 Bacteria 6954
245 Ga0207650_10037338 3300025925 Unclassified 3540
246 Ga0207659_10196133 3300025926 Unclassified 1609
247 Ga0207687_10005036 3300025927 Bacteria 8749
248 Ga0207700_10492873 3300025928 Bacteria 1084
249 Ga0207690_10174189 3300025932 Unclassified 1614
250 Ga0207706_10233043 3300025933 Unclassified 1610
251 Ga0207706_10364202 3300025933 Bacteria 1256
252 Ga0207686_10009441 3300025934 Bacteria 5293
253 Ga0207709_10005265 3300025935 Bacteria 7357
254 Ga0207709_10151407 3300025935 Bacteria 1607
255 Ga0207709_10388809 3300025935 Bacteria 1063
256 Ga0207670_10039813 3300025936 Bacteria 3081
257 Ga0207669_10012036 3300025937 Bacteria 4237
258 Ga0207669_10067790 3300025937 Bacteria 2225
259 Ga0207669_10180198 3300025937 Bacteria 1514
260 Ga0207704_10002799 3300025938 Bacteria 7866
261 Ga0207665_10162150 3300025939 Unclassified 1609
262 Ga0207691_10000759 3300025940 Bacteria 31911
263 Ga0207691_10112465 3300025940 Bacteria 2420
264 Ga0207691_10253063 3300025940 Bacteria 1520
265 Ga0207711_10384812 3300025941 Bacteria 1302
266 Ga0207689_10004260 3300025942 Bacteria 13011
267 Ga0207689_10155942 3300025942 Bacteria 1882
268 Ga0207667_10023823 3300025949 Bacteria 6737
269 Ga0207651_10000073 3300025960 Bacteria 45927
270 Ga0207712_10013646 3300025961 Bacteria 5210
271 Ga0207712_10073959 3300025961 Bacteria 2459
272 Ga0207668_10440326 3300025972 Bacteria 1110
273 Ga0207640_10013576 3300025981 Bacteria 4674
274 Ga0207658_10017462 3300025986 Unclassified 4945
275 Ga0207677_10004527 3300026023 Bacteria 7478
276 Ga0207703_10130021 3300026035 Bacteria 2173
277 Ga0207639_10779526 3300026041 Bacteria 890
278 Ga0207678_10208210 3300026067 Unclassified 1673
279 Ga0207708_10000681 3300026075 Bacteria 25817
280 Ga0207708_10025718 3300026075 Bacteria 4454
281 Ga0207708_10384773 3300026075 Bacteria 1157
282 Ga0207708_10769210 3300026075 Bacteria 827
283 Ga0207702_10245149 3300026078 Bacteria 1680
284 Ga0207702_10416792 3300026078 Bacteria 1298
285 Ga0207648_10003529 3300026089 Bacteria 16372
286 Ga0207648_10024014 3300026089 Bacteria 5449
287 Ga0207648_10032369 3300026089 Bacteria 4617
288 Ga0207674_10276961 3300026116 Bacteria 1625
289 Ga0207675_100008285 3300026118 Bacteria 9791
290 Ga0207675_100036108 3300026118 Bacteria 4609
291 Ga0207675_100456804 3300026118 Bacteria 1266
292 Ga0207683_10000596 3300026121 Bacteria 33293
293 Ga0207683_10475970 3300026121 Bacteria 1152
294 Ga0207698_10137664 3300026142 Bacteria 2098
295 Ga0207698_10204282 3300026142 Unclassified 1772
296 Ga0207698_10776746 3300026142 Unclassified 958
297 Ga0209969_1001056 3300027360 Bacteria 3767
298 Ga0209969_1003774 3300027360 Bacteria 2102
299 Ga0209967_1001952 3300027364 Bacteria 2656
300 Ga0209967_1003896 3300027364 Bacteria 1969
301 Ga0209967_1006633 3300027364 Unclassified 1575
302 Ga0209981_1003912 3300027378 Bacteria 1939
303 Ga0209981_1024359 3300027378 Bacteria 873
304 Ga0210000_1001599 3300027462 Bacteria 3203
305 Ga0209995_1007921 3300027471 Bacteria 1713
306 Ga0209968_1011259 3300027526 Unclassified 1384
307 Ga0209968_1021452 3300027526 Bacteria 1048
308 Ga0209999_1002337 3300027543 Bacteria 3342
309 Ga0209999_1003514 3300027543 Bacteria 2807
310 Ga0209982_1006927 3300027552 Bacteria 1655
311 Ga0209970_1010270 3300027614 Bacteria 1531
312 Ga0209983_1012983 3300027665 Bacteria 1712
313 Ga0209588_1027513 3300027671 Bacteria 1809
314 Ga0209971_1002199 3300027682 Bacteria 4737
315 Ga0209966_1072428 3300027695 Bacteria 756
316 Ga0209974_10023562 3300027876 Bacteria 2037
317 Ga0209974_10034481 3300027876 Bacteria 1681
318 Ga0207428_10009598 3300027907 Bacteria 8669
319 Ga0207428_10014118 3300027907 Bacteria 6954
320 Ga0207428_10104029 3300027907 Bacteria 2192
321 Ga0268266_10162047 3300028379 Unclassified 2024
322 Ga0268265_10009420 3300028380 Bacteria 6595
323 Ga0268265_10023106 3300028380 Bacteria 4379
324 Ga0268264_10063281 3300028381 Bacteria 3109
325 Ga0268264_10536139 3300028381 Bacteria 1146
326 Ga0265319_1000048 3300028563 Bacteria 99817
327 Ga0265318_10001434 3300028577 Bacteria 14053
328 Ga0265330_10000212 3300031235 Bacteria 45086
329 Ga0265332_10000598 3300031238 Bacteria 23662
330 Ga0265328_10003938 3300031239 Bacteria 6531
331 Ga0265320_10030637 3300031240 Bacteria 2771
332 Ga0265325_10015634 3300031241 Bacteria 4263
333 Ga0265340_10008554 3300031247 Bacteria 5521
334 Ga0265339_10004976 3300031249 Bacteria 8947
335 Ga0265331_10001346 3300031250 Bacteria 18107
336 Ga0265316_10000330 3300031344 Bacteria 52881
337 Ga0307513_10427459 3300031456 Bacteria 1053
338 Ga0307509_10012348 3300031507 Bacteria 10227
339 Ga0307509_10038670 3300031507 Bacteria 5203
340 Ga0307509_10121638 3300031507 Bacteria 2586
341 Ga0307408_100109086 3300031548 Unclassified 2123
342 Ga0307408_100185101 3300031548 Bacteria 1673
343 Ga0307408_100623193 3300031548 Bacteria 961
344 Ga0307408_100729174 3300031548 Bacteria 893
345 Ga0265313_10000573 3300031595 Bacteria 38431
346 Ga0307508_10000041 3300031616 Bacteria 147868
347 Ga0307508_10135153 3300031616 Unclassified 2069
348 Ga0316575_10014375 3300031665 Bacteria 2971
349 Ga0316575_10016338 3300031665 Bacteria 2807
350 Ga0316575_10030340 3300031665 Unclassified 2113
351 Ga0316575_10061954 3300031665 Bacteria 1495
352 Ga0316575_10134426 3300031665 Bacteria 1016
353 Ga0316579_10001192 3300031691 Bacteria 9303
354 Ga0316579_10002152 3300031691 Bacteria 7397
355 Ga0316579_10024820 3300031691 Unclassified 2701
356 Ga0316579_10059253 3300031691 Bacteria 1799
357 Ga0265314_10000159 3300031711 Bacteria 102733
358 Ga0265342_10002265 3300031712 Bacteria 16808
359 Ga0316576_10000791 3300031727 Bacteria 15916
360 Ga0316576_10007685 3300031727 Bacteria 6799
361 Ga0316576_10012284 3300031727 Bacteria 5652
362 Ga0316576_10021593 3300031727 Bacteria 4455
363 Ga0316576_10054697 3300031727 Unclassified 2911
364 Ga0316576_10061095 3300031727 Bacteria 2761
365 Ga0316576_10068242 3300031727 Unclassified 2619
366 Ga0316576_10085697 3300031727 Bacteria 2342
367 Ga0316578_10001317 3300031728 Bacteria 9949
368 Ga0316578_10003814 3300031728 Bacteria 6982
369 Ga0316578_10021545 3300031728 Unclassified 3578
370 Ga0316578_10090709 3300031728 Bacteria 1824
371 Ga0316577_10000496 3300031733 Bacteria 15596
372 Ga0316577_10004035 3300031733 Bacteria 7519
373 Ga0316577_10006976 3300031733 Bacteria 6005
374 Ga0316577_10049143 3300031733 Unclassified 2354
375 Ga0316577_10062444 3300031733 Unclassified 2080
376 Ga0316577_10206292 3300031733 Bacteria 1111
377 Ga0307413_10271587 3300031824 Unclassified 1270
378 Ga0307407_10130411 3300031903 Bacteria 1607
379 Ga0307416_100025015 3300032002 Unclassified 4370
380 Ga0307416_100037889 3300032002 Unclassified 3715
381 Ga0307416_100696797 3300032002 Bacteria 1104
382 Ga0307411_10078731 3300032005 Unclassified 2261
383 Ga0316583_10000414 3300032133 Bacteria 12499
384 Ga0316583_10007526 3300032133 Bacteria 3921
385 Ga0316583_10049303 3300032133 Bacteria 1482
386 Ga0316583_10055019 3300032133 Bacteria 1399
387 Ga0316583_10058208 3300032133 Bacteria 1356
388 Ga0316585_10001691 3300032137 Bacteria 5862
389 Ga0316585_10003135 3300032137 Bacteria 4512
390 Ga0316585_10021417 3300032137 Bacteria 1985
391 Ga0316580_10000480 3300032139 Bacteria 9215
392 Ga0316580_10020135 3300032139 Unclassified 2053
393 Ga0316580_10023377 3300032139 Bacteria 1908
394 Ga0316580_10023444 3300032139 Bacteria 1906
395 Ga0316580_10029729 3300032139 Bacteria 1691
396 Ga0316593_10001966 3300032168 Bacteria 4726
397 Ga0307507_10066250 3300033179 Bacteria 3313
398 Ga0316592_1010923 3300033524 Bacteria 1837
399 Ga0316596_1049048 3300033541 Bacteria 1116
400 Ga0373930_0011207 3300034816 Bacteria 1616
401 Ga0373948_0009510 3300034817 Bacteria 1677
402 Ga0373950_0043071 3300034818 Unclassified 869
403 Ga0373959_0031152 3300034820 Unclassified 1078
404 Ga0373926_0026171 3300035083 Bacteria 2039
405 Ga0373934_0014776 3300035086 Bacteria 2957
406 Ga0373934_0169594 3300035086 Unclassified 896
407 Ga0373940_0024035 3300035088 Bacteria 1577
408 Ga0373940_0076769 3300035088 Bacteria 981
409 Ga0373944_0045043 3300035089 Bacteria 1375
410 Ga0373949_0008362 3300035090 Bacteria 2265
411 Ga0373951_0070860 3300035091 Unclassified 888
412 Ga0373932_0012620 3300035112 Bacteria 2083
413 Ga0373936_0012256 3300035113 Bacteria 3259
414 Ga0373939_0026251 3300035114 Bacteria 1640
415 Ga0373941_0175270 3300035115 Unclassified 801
416 Ga0373941_0269533 3300035115 Unclassified 670
417 Ga0373941_0326412 3300035115 Bacteria 619
418 Ga0373945_0020753 3300035116 Bacteria 2252
419 Ga0373953_0081136 3300035117 Bacteria 1348
420 Ga0373954_0000129 3300035118 Bacteria 25852
421 Ga0373956_0034205 3300035119 Bacteria 2238
422 Ga0373956_0120504 3300035119 Bacteria 1225
423 Ga0373956_0131704 3300035119 Unclassified 1171
424 Ga0373960_0031189 3300035121 Bacteria 1489
425 Ga0373943_0030426 3300035170 Bacteria 2554
426 Ga0373946_0000875 3300035171 Bacteria 10362
427 Ga0373942_0009933 3300035207 Bacteria 2231
428 Ga0316574_0040587 3300035398 Bacteria 2866
429 Ga0316574_0128857 3300035398 Bacteria 1627
430 Ga0316574_0205754 3300035398 Bacteria 1263
431 Ga0316574_0245780 3300035398 Bacteria 1143
432 Ga0373924_0002317 3300035410 Bacteria 6391
433 Ga0373924_0120630 3300035410 Bacteria 1137
434 Ga0373931_0007034 3300035691 Bacteria 5294
435 Ga0373931_0029995 3300035691 Bacteria 2797
436 Ga0373931_0047102 3300035691 Bacteria 2281
437 Ga0373931_0049956 3300035691 Bacteria 2224
438 Ga0373931_0073419 3300035691 Bacteria 1872
439 Ga0373935_0071557 3300035692 Bacteria 2237
440 Ga0373927_0038597 3300035695 Bacteria 3100
441 Ga0373927_0207439 3300035695 Bacteria 1287
442 Ga0373933_0034476 3300035724 Bacteria 2950
443 Ga0373933_0138993 3300035724 Bacteria 1532
444 Ga0373933_0459378 3300035724 Unclassified 833
445 Ga0373937_0011632 3300036401 Bacteria 7726
446 Ga0373937_0022637 3300036401 Bacteria 5651
447 Ga0373937_0023653 3300036401 Bacteria 5536
448 Ga0373937_0108522 3300036401 Bacteria 2581
449 Ga0316582_0000895 3300036647 Bacteria 12221
450 Ga0316582_0001725 3300036647 Bacteria 9827
451 Ga0316582_0005625 3300036647 Bacteria 6481
452 Ga0316582_0031205 3300036647 Unclassified 3255
453 Ga0316582_0080297 3300036647 Unclassified 2128
454 Ga0316582_0124810 3300036647 Bacteria 1725
455 Ga0316582_0310280 3300036647 Unclassified 1084
456 Ga0316582_0566369 3300036647 Bacteria 782
457 Ga0316584_0007262 3300036712 Bacteria 7562
458 Ga0316584_0015186 3300036712 Bacteria 5503
459 Ga0316584_0019256 3300036712 Unclassified 4934
460 Ga0316584_0044087 3300036712 Unclassified 3326
461 Ga0316584_0072735 3300036712 Bacteria 2576
462 Ga0316584_0101218 3300036712 Bacteria 2157
463 Ga0316584_0196948 3300036712 Bacteria 1488
464 Ga0316584_0217255 3300036712 Unclassified 1406
465 Ga0316584_0270471 3300036712 Bacteria 1237
466 Ga0316584_0278246 3300036712 Bacteria 1216
467 Ga0316584_0360637 3300036712 Unclassified 1042
468 Ga0316584_0476269 3300036712 Bacteria 880
469 Ga0373925_0062474 3300037068 Bacteria 2800
470 Ga0373925_0070593 3300037068 Bacteria 2641
471 Ga0373925_0429752 3300037068 Bacteria 1080
472 Ga0316581_0043788 3300037588 Bacteria 1366
473 Ga0400491_09172 3300038727 Bacteria 1646
474 Ga0400485_04042 3300038735 Bacteria 23120
475 Ga0400486_04029 3300038742 Bacteria 63930
476 Ga0400483_203037 3300039062 Bacteria 1371
477 Ga0400489_19166 3300039093 Bacteria 10110
478 Ga0400489_83885 3300039093 Bacteria 14482
479 Ga0400487_56445 3300039110 Bacteria 32953
480 Ga0436365_0486298 3300039437 Bacteria 8040
481 Ga0439461_0002003 3300041410 Bacteria 3224
482 Ga0451807_0370026 3300041486 Bacteria 1518
483 Ga0439441_001358 3300042001 Bacteria 3167
484 Ga0439443_003421 3300042003 Bacteria 1998
485 Ga0439443_010585 3300042003 Unclassified 1338
486 Ga0439462_0040778 3300042015 Bacteria 1239
487 Ga0450910_053371 3300042147 Bacteria 671
488 Ga0439434_0000967 3300042435 Bacteria 8277
489 Ga0439435_0000371 3300042436 Bacteria 6877
490 Ga0439435_0000649 3300042436 Bacteria 5726
491 Ga0439435_0013916 3300042436 Bacteria 1979
492 Ga0439444_0005828 3300042437 Bacteria 1840
493 Ga0439460_0000878 3300042461 Bacteria 6875
494 Ga0439460_0011586 3300042461 Bacteria 2276
495 Ga0451577_0179412 3300042876 Bacteria 1909
496 Ga0451577_0410102 3300042876 Bacteria 1230
497 Ga0451577_0905730 3300042876 Bacteria 794
498 Ga0453683_0070980 3300044673 Unclassified 2178
499 Ga0466965_0434744 3300044683 Bacteria 729
500 Ga0453684_0040799 3300044712 Bacteria 6294
501 Ga0453684_0394056 3300044712 Bacteria 1552
502 Ga0466957_0077752 3300044842 Bacteria 2062
503 Ga0466960_0219048 3300044901 Bacteria 1047
504 Ga0451576_0004013 3300045051 Bacteria 19582
505 Ga0451576_0124571 3300045051 Unclassified 2685
506 Ga0451576_0145578 3300045051 Bacteria 2470
507 Ga0451576_0403650 3300045051 Bacteria 1433
508 Ga0466967_0158572 3300045976 Bacteria 2122
509 Ga0495592_0009905 3300046454 Bacteria 7176
510 Ga0495603_0010186 3300046455 Bacteria 5690
511 Ga0495580_0019598 3300046472 Bacteria 5025
512 Ga0495639_0053008 3300046475 Bacteria 1847
513 Ga0495662_0029234 3300046476 Bacteria 2661
514 Ga0495664_0133674 3300046477 Bacteria 1503
515 Ga0495608_0003736 3300046511 Bacteria 10928
516 Ga0495628_0000665 3300046516 Bacteria 31450
517 Ga0495628_0003842 3300046516 Bacteria 13395
518 Ga0495630_0089946 3300046517 Bacteria 2319
519 Ga0495632_0217553 3300046519 Bacteria 865
520 Ga0495666_0053849 3300046526 Bacteria 1930
521 Ga0495666_0078290 3300046526 Unclassified 1566
522 Ga0495642_0182622 3300046528 Bacteria 913
523 Ga0495652_0018806 3300046529 Bacteria 6157
524 Ga0495640_0005611 3300046533 Bacteria 9980
525 Ga0495640_0131338 3300046533 Bacteria 1621
526 Ga0495586_0002877 3300046535 Bacteria 9299
527 Ga0495586_0012202 3300046535 Bacteria 4562
528 Ga0495598_0003954 3300046537 Bacteria 3182
529 Ga0495598_0060408 3300046537 Bacteria 1168
530 Ga0495621_0128236 3300046539 Bacteria 985
531 Ga0495667_0018592 3300046559 Bacteria 4692
532 Ga0495667_0341931 3300046559 Bacteria 946
533 Ga0495634_0003859 3300046642 Bacteria 11899
534 Ga0495611_0128742 3300046648 Bacteria 1181
535 Ga0495635_0124275 3300046663 Bacteria 1759
536 Ga0495659_0073984 3300046664 Bacteria 1281
537 Ga0495588_0102297 3300046674 Bacteria 1506
538 Ga0495657_0112898 3300046675 Bacteria 1720
539 Ga0495599_0048412 3300046678 Bacteria 2665
540 Ga0495623_0220155 3300046679 Bacteria 1082
541 Ga0495647_0004536 3300046681 Bacteria 4518
542 Ga0495658_0002976 3300046683 Bacteria 8485
543 Ga0495658_0034744 3300046683 Bacteria 2768
544 Ga0495669_0018505 3300046684 Bacteria 2995
545 Ga0495613_0022572 3300046689 Bacteria 4687
546 Ga0495670_0240531 3300046691 Bacteria 964
547 Ga0495600_0085276 3300046809 Bacteria 2061
548 Ga0495581_0055652 3300047315 Bacteria 2283
549 Ga0495581_0215584 3300047315 Bacteria 1122
550 Ga0495604_0023166 3300047317 Bacteria 4956
551 Ga0495636_0001503 3300047318 Bacteria 8839
552 Ga0495674_0841876 3300047319 Unclassified 711
553 Ga0495680_0003153 3300047322 Bacteria 16423
554 Ga0495684_0080609 3300047471 Bacteria 2471
555 Ga0495593_0091221 3300047673 Bacteria 1569
556 Ga0495593_0158601 3300047673 Bacteria 1143
557 Ga0495615_0025724 3300048090 Bacteria 1369
558 Ga0495626_0071561 3300048091 Bacteria 1558
559 Ga0496100_0088854 3300048903 Unclassified 2104
560 Ga0496105_0171524 3300048908 Unclassified 1778
561 Ga0496108_0010030 3300048911 Bacteria 7681
562 Ga0496109_0047620 3300048912 Unclassified 3898
563 Ga0496110_0438354 3300048913 Unclassified 1191
564 Ga0496111_0742683 3300048914 Unclassified 712
565 Ga0496112_0435113 3300048915 Unclassified 1250
566 Ga0496114_0047310 3300048917 Unclassified 3578
567 Ga0501295_063308 3300049518 Bacteria 814
568 Ga0501303_020804 3300049526 Bacteria 698
569 Ga0501031_0569402 3300049568 Bacteria 729
570 Ga0501033_0004302 3300049570 Bacteria 11431
571 Ga0501033_0202638 3300049570 Bacteria 1417
572 Ga0501034_0248880 3300049571 Bacteria 1722
573 Ga0501036_0007640 3300049572 Bacteria 8825
574 Ga0501037_0077038 3300049573 Bacteria 2420
575 Ga0501038_0009797 3300049574 Bacteria 8773
576 Ga0501038_0083392 3300049574 Bacteria 2691
577 Ga0501038_0109946 3300049574 Bacteria 2284
578 Ga0501039_0040577 3300049575 Bacteria 3593
579 Ga0501039_0043405 3300049575 Bacteria 3473
580 Ga0501040_0010363 3300049576 Bacteria 6092
581 Ga0501040_0778790 3300049576 Unclassified 692
582 Ga0501041_0022283 3300049577 Bacteria 3791
583 Ga0501041_0072755 3300049577 Bacteria 2112
584 Ga0501041_0158155 3300049577 Bacteria 1416
585 Ga0501041_0423129 3300049577 Bacteria 845
586 Ga0501042_0036886 3300049578 Bacteria 3468
587 Ga0501042_0073104 3300049578 Bacteria 2453
588 Ga0501042_0525863 3300049578 Bacteria 859
589 Ga0501043_0206279 3300049579 Bacteria 1524
590 Ga0501046_0005657 3300049580 Bacteria 11155
591 Ga0501046_0699481 3300049580 Bacteria 714
592 Ga0501047_0039645 3300049581 Bacteria 4555
593 Ga0501048_0000710 3300049582 Bacteria 24338
594 Ga0501048_0049078 3300049582 Bacteria 3009
595 Ga0501068_0111785 3300049584 Bacteria 1699
596 Ga0501068_0122354 3300049584 Bacteria 1623
597 Ga0501071_0003868 3300049587 Bacteria 9430
598 Ga0501071_0006673 3300049587 Bacteria 7499
599 Ga0501071_0095521 3300049587 Bacteria 2187
600 Ga0501072_0005751 3300049588 Bacteria 9443
601 Ga0501072_0083125 3300049588 Bacteria 2538
602 Ga0501072_0138639 3300049588 Bacteria 1939
603 Ga0501073_0095529 3300049589 Bacteria 2064
604 Ga0501074_0012747 3300049590 Bacteria 6112
605 Ga0501075_0015580 3300049591 Bacteria 5456
606 Ga0501075_0020387 3300049591 Bacteria 4822
607 Ga0501075_0114606 3300049591 Bacteria 2049
608 Ga0501076_0006184 3300049592 Bacteria 8666
609 Ga0501076_0008009 3300049592 Bacteria 7717
610 Ga0501076_0016851 3300049592 Bacteria 5547
611 Ga0501076_0463939 3300049592 Bacteria 1043
612 Ga0501077_0023718 3300049593 Bacteria 3889
613 Ga0501077_0371600 3300049593 Unclassified 913
614 Ga0501208_037513 3300049655 Bacteria 884
615 Ga0501249_006974 3300049679 Bacteria 2328
616 Ga0501234_047494 3300049707 Bacteria 710
617 Ga0501079_0010905 3300049741 Bacteria 6922
618 Ga0501079_0022602 3300049741 Bacteria 4823
619 Ga0501079_0167374 3300049741 Bacteria 1714
620 Ga0501080_0007156 3300049742 Bacteria 10071
621 Ga0501080_0062202 3300049742 Bacteria 3474
622 Ga0501080_0227766 3300049742 Bacteria 1704
623 Ga0501081_0000714 3300049743 Bacteria 19270
624 Ga0501081_0006055 3300049743 Bacteria 7835
625 Ga0501081_0179226 3300049743 Bacteria 1532
626 Ga0501081_0933845 3300049743 Bacteria 655
627 Ga0501035_0061537 3300049822 Bacteria 3341
628 Ga0501035_0595198 3300049822 Bacteria 902
629 Ga0501044_0532326 3300049823 Bacteria 1074
630 Ga0501045_0004736 3300049824 Bacteria 9386
631 Ga0501045_0208343 3300049824 Bacteria 1456
632 Ga0501045_0275279 3300049824 Bacteria 1253
633 Ga0501045_0419573 3300049824 Unclassified 995
634 nmdc:mga0k408_206347_c1 3300050493 Unclassified 1173
635 nmdc:mga05p37_159_c1 3300050507 Bacteria 65013
636 nmdc:mga05p37_258357_c1 3300050507 Bacteria 2086
637 nmdc:mga05p37_336349_c1 3300050507 Bacteria 1782
638 nmdc:mga05p37_498195_c1 3300050507 Bacteria 1399
639 nmdc:mga09592_117342_c1 3300050508 Bacteria 2284
640 nmdc:mga09592_1447_c1 3300050508 Bacteria 19043
641 nmdc:mga09592_1672_c1 3300050508 Bacteria 17873
642 nmdc:mga09592_6035_c1 3300050508 Bacteria 9883
643 nmdc:mga09592_877384_c1 3300050508 Unclassified 755
644 nmdc:mga0qj67_145171_c1 3300050509 Bacteria 1924
645 nmdc:mga0qj67_18024_c1 3300050509 Bacteria 5378
646 nmdc:mga0qj67_645753_c1 3300050509 Bacteria 844
647 nmdc:mga0qj67_9360_c1 3300050509 Bacteria 7286
648 nmdc:mga06r32_11486_c1 3300050510 Bacteria 7976
649 nmdc:mga06r32_516208_c1 3300050510 Bacteria 1171
650 nmdc:mga06r32_91110_c1 3300050510 Bacteria 2979
651 nmdc:mga08y16_10893_c1 3300050511 Bacteria 9552
652 nmdc:mga08y16_14255_c1 3300050511 Bacteria 8365
653 nmdc:mga08y16_15839_c1 3300050511 Bacteria 7923
654 nmdc:mga08y16_159352_c1 3300050511 Bacteria 2345
655 nmdc:mga08y16_430243_c1 3300050511 Bacteria 1348
656 nmdc:mga08y16_7728_c1 3300050511 Bacteria 11261
657 nmdc:mga08y16_81071_c1 3300050511 Bacteria 3383
658 nmdc:mga0n895_201894_c1 3300050512 Bacteria 2019
659 nmdc:mga0n895_2433_c1 3300050512 Bacteria 14531
660 nmdc:mga0n895_9411_c1 3300050512 Bacteria 8548
661 nmdc:mga0rr50_210556_c1 3300050513 Bacteria 1601
662 nmdc:mga0rr50_24328_c1 3300050513 Bacteria 4194
663 nmdc:mga0rr50_25242_c1 3300050513 Bacteria 4129
664 nmdc:mga08x19_1548_c1 3300050514 Bacteria 14256
665 nmdc:mga08x19_18755_c1 3300050514 Bacteria 4241
666 nmdc:mga08x19_203710_c1 3300050514 Bacteria 1357
667 nmdc:mga08x19_38836_c1 3300050514 Bacteria 2464
668 nmdc:mga08x19_4750_c1 3300050514 Bacteria 8057
669 nmdc:mga0a205_1388_c1 3300050515 Bacteria 20474
670 nmdc:mga0a205_188178_c1 3300050515 Bacteria 1957
671 nmdc:mga0a205_74483_c1 3300050515 Bacteria 851
672 Ga0495601_0009858 3300053077 Bacteria 5656
673 Ga0495601_0124911 3300053077 Bacteria 1674
674 Ga0495619_0507850 3300053085 Bacteria 829
675 Ga0500583_0271088 3300053092 Bacteria 835
676 Ga0500594_0061966 3300053118 Unclassified 1081
677 Ga0501084_0031840 3300054114 Bacteria 4410
678 Ga0501084_0064215 3300054114 Bacteria 3073
679 Ga0501084_0105588 3300054114 Bacteria 2366
680 Ga0501084_0988669 3300054114 Bacteria 707
681 Ga0590071_062098 3300059421 Bacteria 914
682 Ga0501082_0215835 3300060353 Bacteria 1669
683 Ga0501082_0270301 3300060353 Bacteria 1479
684 Ga0501082_0343780 3300060353 Bacteria 1300
685 Ga0530510_0000803 3300061734 Bacteria 20450
686 Ga0530510_0003054 3300061734 Bacteria 11495
687 2857607966 2857604169 Bacteria 5111450
688 2945991989 2945991243 Bacteria 7008369
689 2946054235 2946053406 Bacteria 6978655
690 8022954019 8022948649 Bacteria 5366783
691 Ga0070678_100825830
692 JGI25406J46586_10043687
693 Ga0058859_10033578
694 Ga0058861_10058411
695 Ga0058860_12196631
696 Ga0065715_10560032
697 Ga0065707_10146536
698 Ga0070676_10022726
699 Ga0070676_10391663
700 Ga0070690_100004639
701 Ga0070690_100034888
702 Ga0070690_100080021
703 Ga0070690_100180716
704 Ga0070670_100022786
705 Ga0070670_100031414
706 Ga0070670_100967256
707 Ga0070677_10042471
708 Ga0068869_100001704
709 Ga0068869_100552509
710 Ga0070666_10004229
711 Ga0070666_10562615
712 Ga0070680_100002230
713 Ga0070680_100147061
714 Ga0070680_100151862
715 Ga0070680_100259184
716 Ga0070680_100646845
717 Ga0070682_100000067
718 Ga0068868_100044416
719 Ga0068868_100057979
720 Ga0070689_100057603
721 Ga0070689_100221966
722 Ga0070691_10001570
723 Ga0070687_100000821
724 Ga0070687_100141480
725 Ga0070687_100506623
726 Ga0070661_100074138
727 Ga0070692_10095755
728 Ga0070668_100079471
729 Ga0070669_100087566
730 Ga0070669_100495355
731 Ga0070675_100031415
732 Ga0070671_100012951
733 Ga0070674_100000282
734 Ga0070674_100044977
735 Ga0070673_100000027
736 Ga0070673_100160848
737 Ga0070659_100033076
738 Ga0070667_100053508
739 Ga0070709_10277519
740 Ga0070714_100121445
741 Ga0070710_10101677
742 Ga0070701_10012125
743 Ga0070705_100012874
744 Ga0070705_100014567
745 Ga0070705_100021347
746 Ga0070705_100095597
747 Ga0070705_100105337
748 Ga0070700_100004048
749 Ga0070700_100076611
750 Ga0070694_100004096
751 Ga0070694_100019702
752 Ga0070694_100236780
753 Ga0070694_100255878
754 Ga0070694_100362047
755 Ga0070708_100286305
756 Ga0070663_100168805
757 Ga0070678_100003474
758 Ga0070678_100687157
759 Ga0070662_100069089
760 Ga0070681_10000720
761 Ga0070681_10181712
762 Ga0068867_100006962
763 Ga0068867_100007000
764 Ga0068867_100688865
765 Ga0070706_100300453
766 Ga0070707_100067608
767 Ga0070699_100113399
768 Ga0070679_100041060
769 Ga0070684_100066324
770 Ga0070697_100032296
771 Ga0070697_100089743
772 Ga0068853_100434192
773 Ga0070672_100000655
774 Ga0070672_100028480
775 Ga0070686_100003451
776 Ga0070686_100024914
777 Ga0070695_100001782
778 Ga0070695_100161565
779 Ga0070695_100230913
780 Ga0070696_100006269
781 Ga0070696_100031211
782 Ga0070693_100027535
783 Ga0070693_100234627
784 Ga0070665_100029569
785 Ga0070704_100004949
786 Ga0070704_100019763
787 Ga0070704_100057954
788 Ga0070704_100112577
789 Ga0070704_100115794
790 Ga0070704_100225158
791 Ga0070704_100619072
792 Ga0068855_100005265
793 Ga0070664_100040877
794 Ga0068854_100070570
795 Ga0068856_100013045
796 Ga0068856_100769210
797 Ga0070702_100001902
798 Ga0070702_100033529
799 Ga0068852_100221920
800 Ga0068852_100347120
801 Ga0068859_100033006
802 Ga0068859_100050635
803 Ga0068859_100258639
804 Ga0068864_100104887
805 Ga0068866_10001148
806 Ga0068866_10021798
807 Ga0068866_10642434
808 Ga0068861_100034873
809 Ga0068863_100345866
810 Ga0068863_100684378
811 Ga0068858_100071360
812 Ga0068860_100176973
813 Ga0068860_100190370
814 Ga0068860_100431537
815 Ga0068862_100018223
816 Ga0068862_100136303
817 Ga0081538_10036883
818 Ga0081539_10002158
819 Ga0070717_10919836
820 Ga0070715_10054753
821 Ga0097621_100101724
822 Ga0097621_100158256
823 Ga0097621_100181536
824 Ga0068871_100009825
825 Ga0068871_100018921
826 Ga0068871_100036675
827 Ga0068871_100547569
828 Ga0075428_100005942
829 Ga0075428_100016454
830 Ga0075428_100032886
831 Ga0075428_100322043
832 Ga0075430_100013066
833 Ga0075430_100075634
834 Ga0075430_100142818
835 Ga0075430_100271399
836 Ga0075430_100331034
837 Ga0075430_100441106
838 Ga0075431_100007501
839 Ga0075431_100229406
840 Ga0075431_100508616
841 Ga0075433_10146331
842 Ga0075433_10376498
843 Ga0075434_100000637
844 Ga0075434_100027268
845 Ga0075434_100400539
846 Ga0075434_100408239
847 Ga0075429_100002429
848 Ga0075429_100047465
849 Ga0075429_100165976
850 Ga0075429_100733082
851 Ga0068865_100020691
852 Ga0075436_100002105
853 Ga0075436_100009310
854 Ga0075436_100020187
855 Ga0075436_100333261
856 Ga0075436_100355268
857 Ga0097620_100033005
858 Ga0097620_100050640
859 Ga0097620_100258639
860 Ga0075435_100011829
861 Ga0075435_100022586
862 Ga0075435_100219341
863 Ga0075435_100481979
864 Ga0075435_100648213
865 Ga0099794_10016647
866 Ga0105240_10719459
867 Ga0111539_10008078
868 Ga0111539_10008809
869 Ga0111539_10013111
870 Ga0111539_10142557
871 Ga0111539_10254824
872 Ga0105245_10004171
873 Ga0114129_10007266
874 Ga0114129_10077350
875 Ga0114129_10311632
876 Ga0105243_10084982
877 Ga0105243_10175536
878 Ga0105243_10286988
879 Ga0105243_10810670
880 Ga0105241_10011280
881 Ga0105242_10003038
882 Ga0105248_10111632
883 Ga0105237_10000137
884 Ga0105249_10035913
885 Ga0105239_10657321
886 Ga0157329_1008665
887 Ga0157371_10017208
888 Ga0157370_10268514
889 Ga0157369_10778625
890 Ga0157374_10057328
891 Ga0157378_10000235
892 Ga0157378_10011451
893 Ga0157378_10023055
894 Ga0163162_10134166
895 Ga0163162_10527884
896 Ga0157375_10256775
897 Ga0157380_10042501
898 Ga0157380_10146740
899 Ga0157380_10239130
900 Ga0157377_10212957
901 Ga0157379_10004082
902 Ga0157379_10132788
903 Ga0157376_10001991
904 Ga0157376_10008195
905 Ga0157376_10633135
906 Ga0163161_10090480
907 Ga0163161_10517028
908 Ga0207697_10048717
909 Ga0207653_10013523
910 Ga0207682_10017696
911 Ga0207682_10085437
912 Ga0207692_10072042
913 Ga0207642_10019300
914 Ga0207642_10019861
915 Ga0207680_10117382
916 Ga0207685_10003876
917 Ga0207645_10017450
918 Ga0207645_10059989
919 Ga0207645_10279262
920 Ga0207643_10022173
921 Ga0207643_10087835
922 Ga0207707_10015506
923 Ga0207671_10001268
924 Ga0207660_10036650
925 Ga0207660_10096295
926 Ga0207660_10251222
927 Ga0207660_10543360
928 Ga0207662_10000163
929 Ga0207662_10185761
930 Ga0207649_10070531
931 Ga0207652_10048128
932 Ga0207681_10013598
933 Ga0207681_10134109
934 Ga0207650_10008640
935 Ga0207650_10037338
936 Ga0207659_10196133
937 Ga0207687_10005036
938 Ga0207700_10492873
939 Ga0207690_10174189
940 Ga0207706_10233043
941 Ga0207706_10364202
942 Ga0207686_10009441
943 Ga0207709_10005265
944 Ga0207709_10151407
945 Ga0207709_10388809
946 Ga0207670_10039813
947 Ga0207669_10012036
948 Ga0207669_10067790
949 Ga0207669_10180198
950 Ga0207704_10002799
951 Ga0207665_10162150
952 Ga0207691_10000759
953 Ga0207691_10112465
954 Ga0207691_10253063
955 Ga0207711_10384812
956 Ga0207689_10004260
957 Ga0207689_10155942
958 Ga0207667_10023823
959 Ga0207651_10000073
960 Ga0207712_10013646
961 Ga0207712_10073959
962 Ga0207668_10440326
963 Ga0207640_10013576
964 Ga0207658_10017462
965 Ga0207677_10004527
966 Ga0207703_10130021
967 Ga0207639_10779526
968 Ga0207678_10208210
969 Ga0207708_10000681
970 Ga0207708_10025718
971 Ga0207708_10384773
972 Ga0207708_10769210
973 Ga0207702_10245149
974 Ga0207702_10416792
975 Ga0207648_10003529
976 Ga0207648_10024014
977 Ga0207648_10032369
978 Ga0207674_10276961
979 Ga0207675_100008285
980 Ga0207675_100036108
981 Ga0207675_100456804
982 Ga0207683_10000596
983 Ga0207683_10475970
984 Ga0207698_10137664
985 Ga0207698_10204282
986 Ga0207698_10776746
987 Ga0209969_1001056
988 Ga0209969_1003774
989 Ga0209967_1001952
990 Ga0209967_1003896
991 Ga0209967_1006633
992 Ga0209981_1003912
993 Ga0209981_1024359
994 Ga0210000_1001599
995 Ga0209995_1007921
996 Ga0209968_1011259
997 Ga0209968_1021452
998 Ga0209999_1002337
999 Ga0209999_1003514
1000 Ga0209982_1006927
1001 Ga0209970_1010270
1002 Ga0209983_1012983
1003 Ga0209588_1027513
1004 Ga0209971_1002199
1005 Ga0209966_1072428
1006 Ga0209974_10023562
1007 Ga0209974_10034481
1008 Ga0207428_10009598
1009 Ga0207428_10014118
1010 Ga0207428_10104029
1011 Ga0268266_10162047
1012 Ga0268265_10009420
1013 Ga0268265_10023106
1014 Ga0268264_10063281
1015 Ga0268264_10536139
1016 Ga0265319_1000048
1017 Ga0265318_10001434
1018 Ga0265330_10000212
1019 Ga0265332_10000598
1020 Ga0265328_10003938
1021 Ga0265320_10030637
1022 Ga0265325_10015634
1023 Ga0265340_10008554
1024 Ga0265339_10004976
1025 Ga0265331_10001346
1026 Ga0265316_10000330
1027 Ga0307513_10427459
1028 Ga0307509_10012348
1029 Ga0307509_10038670
1030 Ga0307509_10121638
1031 Ga0307408_100109086
1032 Ga0307408_100185101
1033 Ga0307408_100623193
1034 Ga0307408_100729174
1035 Ga0265313_10000573
1036 Ga0307508_10000041
1037 Ga0307508_10135153
1038 Ga0316575_10014375
1039 Ga0316575_10016338
1040 Ga0316575_10030340
1041 Ga0316575_10061954
1042 Ga0316575_10134426
1043 Ga0316579_10001192
1044 Ga0316579_10002152
1045 Ga0316579_10024820
1046 Ga0316579_10059253
1047 Ga0265314_10000159
1048 Ga0265342_10002265
1049 Ga0316576_10000791
1050 Ga0316576_10007685
1051 Ga0316576_10012284
1052 Ga0316576_10021593
1053 Ga0316576_10054697
1054 Ga0316576_10061095
1055 Ga0316576_10068242
1056 Ga0316576_10085697
1057 Ga0316578_10001317
1058 Ga0316578_10003814
1059 Ga0316578_10021545
1060 Ga0316578_10090709
1061 Ga0316577_10000496
1062 Ga0316577_10004035
1063 Ga0316577_10006976
1064 Ga0316577_10049143
1065 Ga0316577_10062444
1066 Ga0316577_10206292
1067 Ga0307413_10271587
1068 Ga0307407_10130411
1069 Ga0307416_100025015
1070 Ga0307416_100037889
1071 Ga0307416_100696797
1072 Ga0307411_10078731
1073 Ga0316583_10000414
1074 Ga0316583_10007526
1075 Ga0316583_10049303
1076 Ga0316583_10055019
1077 Ga0316583_10058208
1078 Ga0316585_10001691
1079 Ga0316585_10003135
1080 Ga0316585_10021417
1081 Ga0316580_10000480
1082 Ga0316580_10020135
1083 Ga0316580_10023377
1084 Ga0316580_10023444
1085 Ga0316580_10029729
1086 Ga0316593_10001966
1087 Ga0307507_10066250
1088 Ga0316592_1010923
1089 Ga0316596_1049048
1090 Ga0373930_0011207
1091 Ga0373948_0009510
1092 Ga0373950_0043071
1093 Ga0373959_0031152
1094 Ga0373926_0026171
1095 Ga0373934_0014776
1096 Ga0373934_0169594
1097 Ga0373940_0024035
1098 Ga0373940_0076769
1099 Ga0373944_0045043
1100 Ga0373949_0008362
1101 Ga0373951_0070860
1102 Ga0373932_0012620
1103 Ga0373936_0012256
1104 Ga0373939_0026251
1105 Ga0373941_0175270
1106 Ga0373941_0269533
1107 Ga0373941_0326412
1108 Ga0373945_0020753
1109 Ga0373953_0081136
1110 Ga0373954_0000129
1111 Ga0373956_0034205
1112 Ga0373956_0120504
1113 Ga0373956_0131704
1114 Ga0373960_0031189
1115 Ga0373943_0030426
1116 Ga0373946_0000875
1117 Ga0373942_0009933
1118 Ga0316574_0040587
1119 Ga0316574_0128857
1120 Ga0316574_0205754
1121 Ga0316574_0245780
1122 Ga0373924_0002317
1123 Ga0373924_0120630
1124 Ga0373931_0007034
1125 Ga0373931_0029995
1126 Ga0373931_0047102
1127 Ga0373931_0049956
1128 Ga0373931_0073419
1129 Ga0373935_0071557
1130 Ga0373927_0038597
1131 Ga0373927_0207439
1132 Ga0373933_0034476
1133 Ga0373933_0138993
1134 Ga0373933_0459378
1135 Ga0373937_0011632
1136 Ga0373937_0022637
1137 Ga0373937_0023653
1138 Ga0373937_0108522
1139 Ga0316582_0000895
1140 Ga0316582_0001725
1141 Ga0316582_0005625
1142 Ga0316582_0031205
1143 Ga0316582_0080297
1144 Ga0316582_0124810
1145 Ga0316582_0310280
1146 Ga0316582_0566369
1147 Ga0316584_0007262
1148 Ga0316584_0015186
1149 Ga0316584_0019256
1150 Ga0316584_0044087
1151 Ga0316584_0072735
1152 Ga0316584_0101218
1153 Ga0316584_0196948
1154 Ga0316584_0217255
1155 Ga0316584_0270471
1156 Ga0316584_0278246
1157 Ga0316584_0360637
1158 Ga0316584_0476269
1159 Ga0373925_0062474
1160 Ga0373925_0070593
1161 Ga0373925_0429752
1162 Ga0316581_0043788
1163 Ga0400491_09172
1164 Ga0400485_04042
1165 Ga0400486_04029
1166 Ga0400483_203037
1167 Ga0400489_19166
1168 Ga0400489_83885
1169 Ga0400487_56445
1170 Ga0436365_0486298
1171 Ga0439461_0002003
1172 Ga0451807_0370026
1173 Ga0439441_001358
1174 Ga0439443_003421
1175 Ga0439443_010585
1176 Ga0439462_0040778
1177 Ga0450910_053371
1178 Ga0439434_0000967
1179 Ga0439435_0000371
1180 Ga0439435_0000649
1181 Ga0439435_0013916
1182 Ga0439444_0005828
1183 Ga0439460_0000878
1184 Ga0439460_0011586
1185 Ga0451577_0179412
1186 Ga0451577_0410102
1187 Ga0451577_0905730
1188 Ga0453683_0070980
1189 Ga0466965_0434744
1190 Ga0453684_0040799
1191 Ga0453684_0394056
1192 Ga0466957_0077752
1193 Ga0466960_0219048
1194 Ga0451576_0004013
1195 Ga0451576_0124571
1196 Ga0451576_0145578
1197 Ga0451576_0403650
1198 Ga0466967_0158572
1199 Ga0495592_0009905
1200 Ga0495603_0010186
1201 Ga0495580_0019598
1202 Ga0495639_0053008
1203 Ga0495662_0029234
1204 Ga0495664_0133674
1205 Ga0495608_0003736
1206 Ga0495628_0000665
1207 Ga0495628_0003842
1208 Ga0495630_0089946
1209 Ga0495632_0217553
1210 Ga0495666_0053849
1211 Ga0495666_0078290
1212 Ga0495642_0182622
1213 Ga0495652_0018806
1214 Ga0495640_0005611
1215 Ga0495640_0131338
1216 Ga0495586_0002877
1217 Ga0495586_0012202
1218 Ga0495598_0003954
1219 Ga0495598_0060408
1220 Ga0495621_0128236
1221 Ga0495667_0018592
1222 Ga0495667_0341931
1223 Ga0495634_0003859
1224 Ga0495611_0128742
1225 Ga0495635_0124275
1226 Ga0495659_0073984
1227 Ga0495588_0102297
1228 Ga0495657_0112898
1229 Ga0495599_0048412
1230 Ga0495623_0220155
1231 Ga0495647_0004536
1232 Ga0495658_0002976
1233 Ga0495658_0034744
1234 Ga0495669_0018505
1235 Ga0495613_0022572
1236 Ga0495670_0240531
1237 Ga0495600_0085276
1238 Ga0495581_0055652
1239 Ga0495581_0215584
1240 Ga0495604_0023166
1241 Ga0495636_0001503
1242 Ga0495674_0841876
1243 Ga0495680_0003153
1244 Ga0495684_0080609
1245 Ga0495593_0091221
1246 Ga0495593_0158601
1247 Ga0495615_0025724
1248 Ga0495626_0071561
1249 Ga0496100_0088854
1250 Ga0496105_0171524
1251 Ga0496108_0010030
1252 Ga0496109_0047620
1253 Ga0496110_0438354
1254 Ga0496111_0742683
1255 Ga0496112_0435113
1256 Ga0496114_0047310
1257 Ga0501295_063308
1258 Ga0501303_020804
1259 Ga0501031_0569402
1260 Ga0501033_0004302
1261 Ga0501033_0202638
1262 Ga0501034_0248880
1263 Ga0501036_0007640
1264 Ga0501037_0077038
1265 Ga0501038_0009797
1266 Ga0501038_0083392
1267 Ga0501038_0109946
1268 Ga0501039_0040577
1269 Ga0501039_0043405
1270 Ga0501040_0010363
1271 Ga0501040_0778790
1272 Ga0501041_0022283
1273 Ga0501041_0072755
1274 Ga0501041_0158155
1275 Ga0501041_0423129
1276 Ga0501042_0036886
1277 Ga0501042_0073104
1278 Ga0501042_0525863
1279 Ga0501043_0206279
1280 Ga0501046_0005657
1281 Ga0501046_0699481
1282 Ga0501047_0039645
1283 Ga0501048_0000710
1284 Ga0501048_0049078
1285 Ga0501068_0111785
1286 Ga0501068_0122354
1287 Ga0501071_0003868
1288 Ga0501071_0006673
1289 Ga0501071_0095521
1290 Ga0501072_0005751
1291 Ga0501072_0083125
1292 Ga0501072_0138639
1293 Ga0501073_0095529
1294 Ga0501074_0012747
1295 Ga0501075_0015580
1296 Ga0501075_0020387
1297 Ga0501075_0114606
1298 Ga0501076_0006184
1299 Ga0501076_0008009
1300 Ga0501076_0016851
1301 Ga0501076_0463939
1302 Ga0501077_0023718
1303 Ga0501077_0371600
1304 Ga0501208_037513
1305 Ga0501249_006974
1306 Ga0501234_047494
1307 Ga0501079_0010905
1308 Ga0501079_0022602
1309 Ga0501079_0167374
1310 Ga0501080_0007156
1311 Ga0501080_0062202
1312 Ga0501080_0227766
1313 Ga0501081_0000714
1314 Ga0501081_0006055
1315 Ga0501081_0179226
1316 Ga0501081_0933845
1317 Ga0501035_0061537
1318 Ga0501035_0595198
1319 Ga0501044_0532326
1320 Ga0501045_0004736
1321 Ga0501045_0208343
1322 Ga0501045_0275279
1323 Ga0501045_0419573
1324 nmdc:mga0k408_206347_c1
1325 nmdc:mga05p37_159_c1
1326 nmdc:mga05p37_258357_c1
1327 nmdc:mga05p37_336349_c1
1328 nmdc:mga05p37_498195_c1
1329 nmdc:mga09592_117342_c1
1330 nmdc:mga09592_1447_c1
1331 nmdc:mga09592_1672_c1
1332 nmdc:mga09592_6035_c1
1333 nmdc:mga09592_877384_c1
1334 nmdc:mga0qj67_145171_c1
1335 nmdc:mga0qj67_18024_c1
1336 nmdc:mga0qj67_645753_c1
1337 nmdc:mga0qj67_9360_c1
1338 nmdc:mga06r32_11486_c1
1339 nmdc:mga06r32_516208_c1
1340 nmdc:mga06r32_91110_c1
1341 nmdc:mga08y16_10893_c1
1342 nmdc:mga08y16_14255_c1
1343 nmdc:mga08y16_15839_c1
1344 nmdc:mga08y16_159352_c1
1345 nmdc:mga08y16_430243_c1
1346 nmdc:mga08y16_7728_c1
1347 nmdc:mga08y16_81071_c1
1348 nmdc:mga0n895_201894_c1
1349 nmdc:mga0n895_2433_c1
1350 nmdc:mga0n895_9411_c1
1351 nmdc:mga0rr50_210556_c1
1352 nmdc:mga0rr50_24328_c1
1353 nmdc:mga0rr50_25242_c1
1354 nmdc:mga08x19_1548_c1
1355 nmdc:mga08x19_18755_c1
1356 nmdc:mga08x19_203710_c1
1357 nmdc:mga08x19_38836_c1
1358 nmdc:mga08x19_4750_c1
1359 nmdc:mga0a205_1388_c1
1360 nmdc:mga0a205_188178_c1
1361 nmdc:mga0a205_74483_c1
1362 Ga0495601_0009858
1363 Ga0495601_0124911
1364 Ga0495619_0507850
1365 Ga0500583_0271088
1366 Ga0500594_0061966
1367 Ga0501084_0031840
1368 Ga0501084_0064215
1369 Ga0501084_0105588
1370 Ga0501084_0988669
1371 Ga0590071_062098
1372 Ga0501082_0215835
1373 Ga0501082_0270301
1374 Ga0501082_0343780
1375 Ga0530510_0000803
1376 Ga0530510_0003054
1377 2857607966
1378 2945991989
1379 2946054235
1380 8022954019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

158

214

0.97

PF00072

Response_reg

Response regulator receiver domain

15

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.971 147 206
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9646 148 211
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9607 147 211
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9581 147 212
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9578 147 211
ID Description Score Start End Superfamily
3p7nA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9681 147 206 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9644 151 207 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9499 151 207 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9486 151 207 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9482 145 212 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G0EEL3-F1-model_v4 DNA-binding response regulator 0.9846 4 140 GO:0000160
GO:0003677
AF-A0A7Z2G7W5-F1-model_v4 Response regulator 0.9803 4 212 GO:0000160
GO:0003677
GO:0006355
AF-A0A3D3PPS9-F1-model_v4 DNA-binding response regulator 0.9768 3 136 GO:0000160
GO:0003677
AF-A0A7J6Z2T9-F1-model_v4 deleted 0.9732 4 212
AF-A0A258NGY1-F1-model_v4 DNA-binding response regulator 0.9727 4 212 GO:0000160
GO:0003677
GO:0006355

Map