metagRoot

F475386

General Info

Members	Datasets	Scaffolds	Average Seq Length
689	243	689	158

Family's Representative Sequence

Representative Sequence	3300025931\|Ga0207644_10302342\|Ga0207644_103023423
Length	155
Sequence	MVMSESGIGLKRLQHLVLWVSDVDRSVRFYCDVLGFEVKTRYPNAAFLRIAGSSDDHHLGLFEQATGRPDERGPRMYHAAWEVGEITDLVRARQRLLEAGSLVGQSDHGVSLSLYAKDPDGLEFEVFWTVPGGLPVGTRALDLDAEVARWATRSV

Samples

	Sample ID	Description	Type	Environment
1	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
2	3300003503	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM	Metagenome	Rhizosphere
3	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
4	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
5	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
6	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
7	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
8	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
9	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
19	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
23	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
24	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
25	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
26	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
27	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
28	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
31	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
32	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
47	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
48	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
49	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
56	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
57	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
66	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
67	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
68	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
69	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
70	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
76	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
77	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
78	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
79	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
80	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
81	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
82	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
83	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
85	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
86	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
88	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
89	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
90	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
91	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
92	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
93	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
94	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
95	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
99	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
100	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
101	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
102	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
103	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
158	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
161	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
162	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
163	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
164	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
165	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
166	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
167	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
168	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
169	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
170	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
171	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
172	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
173	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
174	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
175	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
176	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
177	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
178	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
179	3300042003	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551	Metagenome	Rhizosphere
180	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
181	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
182	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
183	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
184	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
185	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
186	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
187	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
188	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
189	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
190	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
191	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
192	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
193	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
194	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
195	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
196	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
197	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
198	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
199	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
200	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
201	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
202	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
203	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
204	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
205	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
206	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
207	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
212	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
214	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
215	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
216	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
217	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
218	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
219	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
220	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
221	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
223	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
228	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
231	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
232	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
233	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
234	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
235	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
236	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
237	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
238	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
239	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
240	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
241	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
242	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
243	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	0.87
Rhizosphere	99.13
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25406J46586_10003357	3300003203	Bacteria	7539
2	JGI26141J51220_1001332	3300003503	Bacteria	1487
3	JGI25405J52794_10092724	3300003911	Unclassified	670
4	Ga0065712_10565359	3300005290	Bacteria	609
5	Ga0065715_10115701	3300005293	Bacteria	2406
6	Ga0065707_10144990	3300005295	Bacteria	1725
7	Ga0070676_10000311	3300005328	Bacteria	21977
8	Ga0070676_10098693	3300005328	Bacteria	1801
9	Ga0070683_100077367	3300005329	Bacteria	3111
10	Ga0070690_100037292	3300005330	Bacteria	3062
11	Ga0068869_100000372	3300005334	Bacteria	24206
12	Ga0070680_100000565	3300005336	Bacteria	25380
13	Ga0070680_100020227	3300005336	Bacteria	5282
14	Ga0070680_100107906	3300005336	Bacteria	2316
15	Ga0070682_100029098	3300005337	Bacteria	3325
16	Ga0068868_100150460	3300005338	Bacteria	1916
17	Ga0070660_100000083	3300005339	Bacteria	56648
18	Ga0070689_100013201	3300005340	Bacteria	5973
19	Ga0070689_101356183	3300005340	Bacteria	642
20	Ga0070691_10019730	3300005341	Bacteria	3113
21	Ga0070691_10302016	3300005341	Bacteria	875
22	Ga0070661_100000993	3300005344	Bacteria	20123
23	Ga0070692_10002520	3300005345	Bacteria	7127
24	Ga0070692_10023227	3300005345	Bacteria	3037
25	Ga0070692_10282239	3300005345	Bacteria	1007
26	Ga0070669_100110899	3300005353	Bacteria	2082
27	Ga0070669_100132839	3300005353	Bacteria	1912
28	Ga0070669_100707084	3300005353	Bacteria	851
29	Ga0070675_101198655	3300005354	Bacteria	699
30	Ga0070671_100339259	3300005355	Unclassified	1282
31	Ga0070673_100652791	3300005364	Unclassified	963
32	Ga0070688_100133987	3300005365	Bacteria	1675
33	Ga0070659_100000377	3300005366	Bacteria	33695
34	Ga0070709_10069843	3300005434	Bacteria	2263
35	Ga0070709_10129814	3300005434	Bacteria	1719
36	Ga0070701_10173702	3300005438	Bacteria	1256
37	Ga0070701_10272530	3300005438	Bacteria	1030
38	Ga0070711_100262366	3300005439	Bacteria	1360
39	Ga0070705_100003528	3300005440	Bacteria	7660
40	Ga0070705_100007493	3300005440	Bacteria	5372
41	Ga0070705_100034109	3300005440	Bacteria	2843
42	Ga0070705_100062551	3300005440	Bacteria	2217
43	Ga0070705_100232339	3300005440	Unclassified	1284
44	Ga0070705_100714373	3300005440	Unclassified	789
45	Ga0070700_100069531	3300005441	Bacteria	2242
46	Ga0070694_100003804	3300005444	Bacteria	9007
47	Ga0070694_100008450	3300005444	Bacteria	6297
48	Ga0070694_100044003	3300005444	Bacteria	2987
49	Ga0070694_100044269	3300005444	Bacteria	2978
50	Ga0070694_100097039	3300005444	Bacteria	2079
51	Ga0070694_100344922	3300005444	Bacteria	1152
52	Ga0070694_100492088	3300005444	Bacteria	975
53	Ga0070694_100614499	3300005444	Unclassified	876
54	Ga0070708_100010797	3300005445	Bacteria	7417
55	Ga0070708_100040198	3300005445	Bacteria	4095
56	Ga0070708_100151981	3300005445	Bacteria	2153
57	Ga0070708_100155641	3300005445	Bacteria	2128
58	Ga0070708_100288589	3300005445	Unclassified	1545
59	Ga0070708_100541086	3300005445	Bacteria	1099
60	Ga0070708_100548632	3300005445	Bacteria	1090
61	Ga0070708_100918062	3300005445	Unclassified	822
62	Ga0070708_101473186	3300005445	Unclassified	634
63	Ga0070663_100001928	3300005455	Bacteria	11583
64	Ga0070662_100274659	3300005457	Bacteria	1362
65	Ga0070662_100331422	3300005457	Bacteria	1243
66	Ga0070681_10214446	3300005458	Bacteria	1841
67	Ga0068867_100003302	3300005459	Bacteria	11361
68	Ga0070685_10192065	3300005466	Bacteria	1322
69	Ga0070706_100037281	3300005467	Bacteria	4490
70	Ga0070706_100066260	3300005467	Bacteria	3341
71	Ga0070706_100631636	3300005467	Bacteria	994
72	Ga0070706_100958292	3300005467	Bacteria	790
73	Ga0070707_100004378	3300005468	Bacteria	13222
74	Ga0070707_100029902	3300005468	Bacteria	5184
75	Ga0070707_100052528	3300005468	Bacteria	3907
76	Ga0070707_100074928	3300005468	Bacteria	3264
77	Ga0070707_100092200	3300005468	Bacteria	2933
78	Ga0070707_100721664	3300005468	Bacteria	960
79	Ga0070707_100761885	3300005468	Bacteria	931
80	Ga0070698_100011570	3300005471	Bacteria	9363
81	Ga0070698_100011940	3300005471	Bacteria	9217
82	Ga0070698_100054205	3300005471	Bacteria	4072
83	Ga0070698_100136302	3300005471	Bacteria	2408
84	Ga0070698_101148713	3300005471	Unclassified	725
85	Ga0070698_101517826	3300005471	Unclassified	621
86	Ga0070699_100000858	3300005518	Bacteria	28228
87	Ga0070699_100007833	3300005518	Bacteria	9282
88	Ga0070699_100015393	3300005518	Bacteria	6573
89	Ga0070699_100020082	3300005518	Bacteria	5757
90	Ga0070699_100052883	3300005518	Bacteria	3514
91	Ga0070699_100087230	3300005518	Bacteria	2724
92	Ga0070699_100115800	3300005518	Bacteria	2355
93	Ga0070699_100335471	3300005518	Bacteria	1360
94	Ga0070699_100335794	3300005518	Bacteria	1360
95	Ga0070699_100401087	3300005518	Bacteria	1240
96	Ga0070679_100005861	3300005530	Bacteria	11407
97	Ga0070684_100026394	3300005535	Bacteria	4893
98	Ga0070697_100022371	3300005536	Bacteria	5018
99	Ga0070697_100034147	3300005536	Bacteria	4100
100	Ga0070697_100298602	3300005536	Bacteria	1384
101	Ga0070697_100399486	3300005536	Bacteria	1192
102	Ga0070697_100496497	3300005536	Unclassified	1067
103	Ga0070697_100576454	3300005536	Bacteria	988
104	Ga0070697_101117830	3300005536	Unclassified	701
105	Ga0070697_101429770	3300005536	Bacteria	618
106	Ga0068853_100002000	3300005539	Bacteria	15055
107	Ga0070672_101207509	3300005543	Bacteria	674
108	Ga0070686_101150449	3300005544	Bacteria	643
109	Ga0070695_100000479	3300005545	Bacteria	20781
110	Ga0070695_100007902	3300005545	Bacteria	6297
111	Ga0070695_100029303	3300005545	Bacteria	3419
112	Ga0070695_100191565	3300005545	Unclassified	1456
113	Ga0070695_100459013	3300005545	Bacteria	978
114	Ga0070695_100899149	3300005545	Bacteria	715
115	Ga0070695_101024043	3300005545	Bacteria	672
116	Ga0070696_100004112	3300005546	Bacteria	9700
117	Ga0070696_100017813	3300005546	Bacteria	4795
118	Ga0070696_100066139	3300005546	Bacteria	2535
119	Ga0070696_100131151	3300005546	Bacteria	1823
120	Ga0070696_100152020	3300005546	Bacteria	1700
121	Ga0070696_101358962	3300005546	Bacteria	605
122	Ga0070693_100006470	3300005547	Bacteria	5681
123	Ga0070693_100007425	3300005547	Bacteria	5359
124	Ga0070704_100002122	3300005549	Bacteria	11035
125	Ga0070704_100231229	3300005549	Bacteria	1508
126	Ga0070704_100398594	3300005549	Bacteria	1174
127	Ga0070704_100622371	3300005549	Bacteria	951
128	Ga0070704_100884209	3300005549	Bacteria	803
129	Ga0070704_101477549	3300005549	Bacteria	625
130	Ga0068855_100017721	3300005563	Bacteria	8563
131	Ga0068855_100496897	3300005563	Bacteria	1326
132	Ga0070664_100204183	3300005564	Bacteria	1764
133	Ga0068857_100195821	3300005577	Bacteria	1841
134	Ga0068857_101040676	3300005577	Bacteria	789
135	Ga0068854_100004148	3300005578	Bacteria	9108
136	Ga0068856_100020276	3300005614	Bacteria	6456
137	Ga0068859_100001495	3300005617	Bacteria	23817
138	Ga0068859_100151751	3300005617	Bacteria	2392
139	Ga0068859_100259482	3300005617	Bacteria	1829
140	Ga0068859_100561485	3300005617	Bacteria	1235
141	Ga0068859_101358286	3300005617	Unclassified	783
142	Ga0068859_101731190	3300005617	Bacteria	690
143	Ga0068864_100030243	3300005618	Bacteria	4589
144	Ga0068861_100011013	3300005719	Bacteria	6286
145	Ga0068861_100106140	3300005719	Bacteria	2243
146	Ga0068870_10000942	3300005840	Bacteria	11409
147	Ga0068863_100115930	3300005841	Unclassified	2553
148	Ga0068858_100013717	3300005842	Bacteria	7649
149	Ga0068860_100003613	3300005843	Bacteria	15900
150	Ga0068860_100085941	3300005843	Bacteria	2993
151	Ga0068860_100665413	3300005843	Bacteria	1049
152	Ga0068860_100905738	3300005843	Unclassified	898
153	Ga0068862_100004332	3300005844	Bacteria	12014
154	Ga0068862_100005041	3300005844	Bacteria	11111
155	Ga0068862_100150470	3300005844	Bacteria	2071
156	Ga0068862_100182123	3300005844	Bacteria	1886
157	Ga0081455_10000135	3300005937	Bacteria	87177
158	Ga0081539_10000009	3300005985	Bacteria	509286
159	Ga0075432_10183393	3300006058	Bacteria	820
160	Ga0075432_10249307	3300006058	Bacteria	720
161	Ga0070715_10196315	3300006163	Bacteria	1022
162	Ga0070716_100007463	3300006173	Bacteria	5387
163	Ga0070712_100022869	3300006175	Bacteria	4122
164	Ga0097621_100471943	3300006237	Bacteria	1133
165	Ga0068871_100582199	3300006358	Bacteria	1016
166	Ga0075428_100011921	3300006844	Bacteria	9670
167	Ga0075428_100094955	3300006844	Bacteria	3251
168	Ga0075428_100123147	3300006844	Bacteria	2822
169	Ga0075428_100200627	3300006844	Bacteria	2157
170	Ga0075428_101539365	3300006844	Bacteria	696
171	Ga0075430_100004972	3300006846	Bacteria	11190
172	Ga0075430_100013495	3300006846	Bacteria	6964
173	Ga0075430_100091473	3300006846	Bacteria	2544
174	Ga0075430_100403840	3300006846	Bacteria	1128
175	Ga0075430_100466589	3300006846	Bacteria	1042
176	Ga0075431_100000061	3300006847	Bacteria	61386
177	Ga0075431_100008963	3300006847	Bacteria	10029
178	Ga0075431_100017393	3300006847	Bacteria	7306
179	Ga0075431_100053788	3300006847	Bacteria	4151
180	Ga0075431_100066439	3300006847	Bacteria	3723
181	Ga0075431_100107336	3300006847	Bacteria	2881
182	Ga0075431_100190888	3300006847	Bacteria	2099
183	Ga0075433_10022826	3300006852	Bacteria	5257
184	Ga0075433_10034009	3300006852	Bacteria	4374
185	Ga0075433_10073645	3300006852	Bacteria	3005
186	Ga0075433_10186481	3300006852	Bacteria	1846
187	Ga0075434_100011554	3300006871	Bacteria	8333
188	Ga0075434_100025904	3300006871	Bacteria	5741
189	Ga0075434_100060112	3300006871	Bacteria	3779
190	Ga0075434_100209492	3300006871	Bacteria	1970
191	Ga0075434_100259995	3300006871	Bacteria	1755
192	Ga0075434_100395243	3300006871	Bacteria	1403
193	Ga0075434_100770174	3300006871	Unclassified	979
194	Ga0075434_100956398	3300006871	Bacteria	871
195	Ga0075434_101308293	3300006871	Bacteria	736
196	Ga0075434_101802348	3300006871	Bacteria	619
197	Ga0075429_100000216	3300006880	Bacteria	38851
198	Ga0075429_100020603	3300006880	Bacteria	5722
199	Ga0075429_100050925	3300006880	Bacteria	3603
200	Ga0075429_100101864	3300006880	Bacteria	2507
201	Ga0075429_100123575	3300006880	Bacteria	2263
202	Ga0068865_100136193	3300006881	Bacteria	1846
203	Ga0075436_100064178	3300006914	Bacteria	2538
204	Ga0075436_100074529	3300006914	Bacteria	2350
205	Ga0075436_100107677	3300006914	Bacteria	1944
206	Ga0097620_100001495	3300006931	Bacteria	23817
207	Ga0097620_100151749	3300006931	Bacteria	2392
208	Ga0097620_100259491	3300006931	Bacteria	1829
209	Ga0097620_100561483	3300006931	Bacteria	1235
210	Ga0097620_101358260	3300006931	Unclassified	783
211	Ga0097620_101731488	3300006931	Bacteria	690
212	Ga0075435_100102048	3300007076	Bacteria	2377
213	Ga0075435_100204559	3300007076	Bacteria	1673
214	Ga0075435_100704501	3300007076	Bacteria	878
215	Ga0075435_101065249	3300007076	Bacteria	706
216	Ga0099794_10013456	3300007265	Bacteria	3562
217	Ga0099794_10021257	3300007265	Bacteria	2946
218	Ga0111539_10003143	3300009094	Bacteria	21843
219	Ga0111539_10005934	3300009094	Bacteria	15774
220	Ga0111539_10087916	3300009094	Bacteria	3651
221	Ga0111539_10467717	3300009094	Bacteria	1468
222	Ga0105245_11685150	3300009098	Bacteria	686
223	Ga0105247_10073999	3300009101	Bacteria	2136
224	Ga0114129_10009961	3300009147	Bacteria	13546
225	Ga0114129_10019007	3300009147	Bacteria	9788
226	Ga0114129_10043833	3300009147	Bacteria	6295
227	Ga0114129_10061964	3300009147	Bacteria	5227
228	Ga0114129_10066735	3300009147	Bacteria	5018
229	Ga0114129_10081643	3300009147	Bacteria	4494
230	Ga0114129_10098089	3300009147	Bacteria	4056
231	Ga0114129_10104605	3300009147	Bacteria	3912
232	Ga0114129_10118302	3300009147	Bacteria	3650
233	Ga0114129_10359436	3300009147	Bacteria	1927
234	Ga0114129_11058274	3300009147	Bacteria	1018
235	Ga0105243_10044844	3300009148	Bacteria	3472
236	Ga0105243_12239788	3300009148	Archaea	583
237	Ga0105241_10000389	3300009174	Bacteria	33246
238	Ga0105241_10238985	3300009174	Bacteria	1535
239	Ga0105241_10357307	3300009174	Bacteria	1270
240	Ga0105242_10945630	3300009176	Unclassified	865
241	Ga0105248_10519680	3300009177	Bacteria	1342
242	Ga0105248_10762277	3300009177	Unclassified	1092
243	Ga0105248_11488312	3300009177	Bacteria	766
244	Ga0105249_10070993	3300009553	Bacteria	3216
245	Ga0105249_10103083	3300009553	Bacteria	2686
246	Ga0105249_10152196	3300009553	Bacteria	2228
247	Ga0105249_10294771	3300009553	Bacteria	1625
248	Ga0105246_10133447	3300011119	Bacteria	1858
249	Ga0105246_11288868	3300011119	Bacteria	677
250	Ga0157373_10000671	3300013100	Bacteria	26720
251	Ga0157371_10076239	3300013102	Bacteria	2374
252	Ga0157369_10042992	3300013105	Bacteria	4926
253	Ga0163162_11363502	3300013306	Unclassified	806
254	Ga0163162_11751082	3300013306	Bacteria	710
255	Ga0163162_11938380	3300013306	Bacteria	675
256	Ga0157372_10000646	3300013307	Bacteria	38275
257	Ga0157372_10102738	3300013307	Bacteria	3265
258	Ga0157375_10127648	3300013308	Bacteria	2660
259	Ga0157375_11955199	3300013308	Bacteria	697
260	Ga0163163_12364508	3300014325	Unclassified	590
261	Ga0157380_12733725	3300014326	Bacteria	560
262	Ga0182008_10163737	3300014497	Bacteria	1120
263	Ga0157379_10349217	3300014968	Bacteria	1354
264	Ga0207653_10004972	3300025885	Bacteria	4152
265	Ga0207653_10047346	3300025885	Bacteria	1424
266	Ga0207682_10096697	3300025893	Bacteria	1287
267	Ga0207642_10489374	3300025899	Bacteria	751
268	Ga0207688_10068370	3300025901	Bacteria	2011
269	Ga0207647_10152267	3300025904	Bacteria	1351
270	Ga0207699_11118293	3300025906	Bacteria	583
271	Ga0207645_10004131	3300025907	Bacteria	10801
272	Ga0207643_10000355	3300025908	Bacteria	30699
273	Ga0207684_10000142	3300025910	Bacteria	127367
274	Ga0207684_10015127	3300025910	Bacteria	6644
275	Ga0207684_10018668	3300025910	Bacteria	5934
276	Ga0207684_10041854	3300025910	Bacteria	3883
277	Ga0207684_10067107	3300025910	Bacteria	3048
278	Ga0207684_10090289	3300025910	Bacteria	2610
279	Ga0207684_10109339	3300025910	Unclassified	2366
280	Ga0207684_10123975	3300025910	Bacteria	2216
281	Ga0207684_10133104	3300025910	Bacteria	2134
282	Ga0207654_10001718	3300025911	Bacteria	11411
283	Ga0207654_10072744	3300025911	Bacteria	2047
284	Ga0207654_10797016	3300025911	Bacteria	682
285	Ga0207707_10000047	3300025912	Bacteria	118016
286	Ga0207693_10032257	3300025915	Bacteria	4135
287	Ga0207693_10802442	3300025915	Bacteria	725
288	Ga0207663_10319928	3300025916	Bacteria	1165
289	Ga0207663_10762573	3300025916	Bacteria	769
290	Ga0207660_10000509	3300025917	Bacteria	25960
291	Ga0207660_10024405	3300025917	Bacteria	4094
292	Ga0207660_10175198	3300025917	Bacteria	1663
293	Ga0207660_11251893	3300025917	Bacteria	603
294	Ga0207657_10000021	3300025919	Bacteria	155900
295	Ga0207652_10000582	3300025921	Bacteria	36770
296	Ga0207646_10000707	3300025922	Bacteria	43305
297	Ga0207646_10012477	3300025922	Bacteria	8167
298	Ga0207646_10025341	3300025922	Bacteria	5426
299	Ga0207646_10027744	3300025922	Bacteria	5161
300	Ga0207646_10045410	3300025922	Bacteria	3944
301	Ga0207646_10075690	3300025922	Bacteria	3008
302	Ga0207646_10083865	3300025922	Bacteria	2850
303	Ga0207646_10119341	3300025922	Unclassified	2369
304	Ga0207646_10290193	3300025922	Bacteria	1478
305	Ga0207646_10378777	3300025922	Bacteria	1278
306	Ga0207646_10799841	3300025922	Bacteria	840
307	Ga0207681_10135782	3300025923	Bacteria	1825
308	Ga0207681_10392025	3300025923	Unclassified	1120
309	Ga0207681_10798363	3300025923	Bacteria	788
310	Ga0207644_10302342	3300025931	Bacteria	1290
311	Ga0207690_10054146	3300025932	Bacteria	2696
312	Ga0207706_10011731	3300025933	Bacteria	7986
313	Ga0207706_10371545	3300025933	Bacteria	1242
314	Ga0207706_10394751	3300025933	Unclassified	1200
315	Ga0207709_10030100	3300025935	Bacteria	3155
316	Ga0207709_10135801	3300025935	Bacteria	1683
317	Ga0207704_10231069	3300025938	Bacteria	1375
318	Ga0207665_10000411	3300025939	Bacteria	29470
319	Ga0207691_10112667	3300025940	Bacteria	2418
320	Ga0207691_10844467	3300025940	Bacteria	768
321	Ga0207711_10813091	3300025941	Unclassified	870
322	Ga0207689_10005688	3300025942	Bacteria	11088
323	Ga0207689_10219569	3300025942	Bacteria	1570
324	Ga0207689_10625200	3300025942	Bacteria	907
325	Ga0207661_10034113	3300025944	Bacteria	3955
326	Ga0207679_10001442	3300025945	Bacteria	14946
327	Ga0207667_10000620	3300025949	Bacteria	45914
328	Ga0207667_11107853	3300025949	Bacteria	775
329	Ga0207651_10050709	3300025960	Bacteria	2820
330	Ga0207651_11315553	3300025960	Unclassified	650
331	Ga0207712_10251294	3300025961	Bacteria	1429
332	Ga0207712_10481984	3300025961	Bacteria	1057
333	Ga0207712_10805782	3300025961	Bacteria	826
334	Ga0207640_10007524	3300025981	Bacteria	6015
335	Ga0207640_11705288	3300025981	Bacteria	569
336	Ga0207677_10066924	3300026023	Bacteria	2514
337	Ga0207703_10554188	3300026035	Bacteria	1084
338	Ga0207639_10020994	3300026041	Bacteria	4683
339	Ga0207678_10005240	3300026067	Bacteria	11613
340	Ga0207708_10052980	3300026075	Bacteria	3090
341	Ga0207708_10098181	3300026075	Bacteria	2264
342	Ga0207702_10001414	3300026078	Bacteria	23966
343	Ga0207641_10175329	3300026088	Bacteria	1960
344	Ga0207641_12500062	3300026088	Bacteria	515
345	Ga0207648_10001227	3300026089	Bacteria	28750
346	Ga0207648_10161512	3300026089	Bacteria	1979
347	Ga0207674_10000137	3300026116	Bacteria	84955
348	Ga0207674_10022186	3300026116	Bacteria	6823
349	Ga0207674_10210183	3300026116	Bacteria	1895
350	Ga0207675_100005398	3300026118	Bacteria	12247
351	Ga0207675_100119012	3300026118	Bacteria	2498
352	Ga0209996_1009192	3300027395	Bacteria	1302
353	Ga0209968_1000231	3300027526	Bacteria	9629
354	Ga0209982_1044691	3300027552	Bacteria	710
355	Ga0209970_1000392	3300027614	Bacteria	7397
356	Ga0210002_1005452	3300027617	Bacteria	1908
357	Ga0209983_1000027	3300027665	Bacteria	19821
358	Ga0209588_1009570	3300027671	Bacteria	2899
359	Ga0209588_1027744	3300027671	Bacteria	1802
360	Ga0209971_1000018	3300027682	Bacteria	65254
361	Ga0209966_1000141	3300027695	Bacteria	30369
362	Ga0209998_10000062	3300027717	Bacteria	43841
363	Ga0209974_10001104	3300027876	Bacteria	9548
364	Ga0207428_10094600	3300027907	Bacteria	2316
365	Ga0207428_10106648	3300027907	Bacteria	2160
366	Ga0207428_10116774	3300027907	Bacteria	2049
367	Ga0268265_10003878	3300028380	Bacteria	10557
368	Ga0268265_10006914	3300028380	Bacteria	7674
369	Ga0268265_10026147	3300028380	Bacteria	4149
370	Ga0268265_10757266	3300028380	Bacteria	943
371	Ga0268264_10208767	3300028381	Bacteria	1791
372	Ga0307408_100384436	3300031548	Bacteria	1201
373	Ga0307405_11101248	3300031731	Bacteria	683
374	Ga0307410_10938186	3300031852	Bacteria	743
375	Ga0307407_11072060	3300031903	Bacteria	625
376	Ga0373948_0024587	3300034817	Bacteria	1176
377	Ga0373948_0026625	3300034817	Bacteria	1141
378	Ga0373928_0027705	3300035084	Bacteria	1235
379	Ga0373949_0008613	3300035090	Bacteria	2232
380	Ga0373949_0011009	3300035090	Bacteria	1989
381	Ga0373949_0087121	3300035090	Unclassified	840
382	Ga0373951_0083740	3300035091	Bacteria	828
383	Ga0373952_0007298	3300035092	Bacteria	2068
384	Ga0373941_0068812	3300035115	Bacteria	1170
385	Ga0373961_0001441	3300035241	Bacteria	7016
386	Ga0373962_0123382	3300035242	Unclassified	828
387	Ga0373931_0113521	3300035691	Bacteria	1540
388	Ga0395899_0151275	3300037312	Unclassified	1645
389	Ga0395900_0044173	3300037418	Bacteria	4593
390	Ga0395905_0222762	3300037471	Bacteria	1765
391	Ga0395901_0357315	3300038443	Bacteria	1507
392	Ga0395901_0432242	3300038443	Bacteria	1349
393	Ga0242420_005251	3300038996	Bacteria	1998
394	Ga0439441_001047	3300042001	Bacteria	3432
395	Ga0439441_006700	3300042001	Bacteria	1835
396	Ga0439443_037290	3300042003	Bacteria	820
397	Ga0439448_0023701	3300042005	Bacteria	1917
398	Ga0439455_0009005	3300042012	Bacteria	2156
399	Ga0439455_0026634	3300042012	Bacteria	1412
400	Ga0439463_014905	3300042016	Bacteria	1920
401	Ga0439458_0006243	3300042157	Bacteria	2659
402	Ga0439459_0015895	3300042438	Bacteria	1384
403	Ga0439460_0000312	3300042461	Bacteria	10222
404	Ga0451577_0001628	3300042876	Bacteria	29133
405	Ga0451577_0007935	3300042876	Bacteria	10374
406	Ga0451577_0090023	3300042876	Bacteria	2738
407	Ga0451577_0330112	3300042876	Bacteria	1383
408	Ga0451577_0385095	3300042876	Bacteria	1273
409	Ga0451577_1183402	3300042876	Bacteria	682
410	Ga0439440_0015076	3300042993	Bacteria	1677
411	Ga0439440_0225139	3300042993	Unclassified	564
412	Ga0453683_0021446	3300044673	Bacteria	4125
413	Ga0453683_0056431	3300044673	Unclassified	2458
414	Ga0453683_0075431	3300044673	Bacteria	2111
415	Ga0453683_0132614	3300044673	Bacteria	1570
416	Ga0453683_0543199	3300044673	Bacteria	756
417	Ga0453683_0817735	3300044673	Bacteria	614
418	Ga0453684_0038634	3300044712	Bacteria	6521
419	Ga0453684_0174894	3300044712	Bacteria	2526
420	Ga0451576_0002399	3300045051	Bacteria	28145
421	Ga0451576_0066171	3300045051	Bacteria	3762
422	Ga0451576_0096371	3300045051	Bacteria	3077
423	Ga0451576_0114163	3300045051	Bacteria	2811
424	Ga0451576_0125299	3300045051	Bacteria	2676
425	Ga0451576_0900875	3300045051	Unclassified	928
426	Ga0451576_1341688	3300045051	Bacteria	745
427	Ga0495580_0151758	3300046472	Bacteria	1605
428	Ga0495580_0374154	3300046472	Bacteria	963
429	Ga0495580_0384467	3300046472	Unclassified	948
430	Ga0495584_0625521	3300046491	Unclassified	549
431	Ga0495644_0382009	3300046523	Bacteria	556
432	Ga0495656_0014319	3300046615	Bacteria	2972
433	Ga0495670_0109995	3300046691	Bacteria	1425
434	Ga0496102_0026905	3300048905	Bacteria	5135
435	Ga0496102_0730685	3300048905	Bacteria	913
436	Ga0496108_1339091	3300048911	Unclassified	601
437	Ga0496110_0102949	3300048913	Bacteria	2561
438	Ga0496112_0175045	3300048915	Bacteria	2111
439	Ga0496113_0282706	3300048916	Bacteria	1327
440	Ga0501031_0012184	3300049568	Bacteria	5606
441	Ga0501031_0790525	3300049568	Bacteria	608
442	Ga0501033_0124867	3300049570	Unclassified	1866
443	Ga0501033_0517715	3300049570	Bacteria	824
444	Ga0501036_0008896	3300049572	Bacteria	8249
445	Ga0501036_0104972	3300049572	Bacteria	2389
446	Ga0501036_0124143	3300049572	Bacteria	2180
447	Ga0501036_0168326	3300049572	Bacteria	1847
448	Ga0501036_0235394	3300049572	Bacteria	1536
449	Ga0501037_0075570	3300049573	Bacteria	2447
450	Ga0501037_0822578	3300049573	Unclassified	612
451	Ga0501037_0964894	3300049573	Bacteria	556
452	Ga0501038_0001796	3300049574	Bacteria	19881
453	Ga0501038_0043836	3300049574	Bacteria	3889
454	Ga0501038_0049933	3300049574	Bacteria	3615
455	Ga0501038_0676124	3300049574	Bacteria	775
456	Ga0501038_0900361	3300049574	Unclassified	653
457	Ga0501039_0013429	3300049575	Bacteria	6263
458	Ga0501039_0021986	3300049575	Bacteria	4894
459	Ga0501039_0276834	3300049575	Bacteria	1319
460	Ga0501039_0318412	3300049575	Bacteria	1223
461	Ga0501039_0486173	3300049575	Bacteria	969
462	Ga0501040_0000420	3300049576	Bacteria	25125
463	Ga0501040_0006432	3300049576	Bacteria	7630
464	Ga0501040_0010993	3300049576	Bacteria	5919
465	Ga0501040_0030963	3300049576	Bacteria	3616
466	Ga0501040_0085647	3300049576	Bacteria	2187
467	Ga0501040_0146878	3300049576	Bacteria	1662
468	Ga0501040_0187366	3300049576	Bacteria	1468
469	Ga0501040_0296410	3300049576	Bacteria	1156
470	Ga0501040_0647126	3300049576	Archaea	764
471	Ga0501041_0000886	3300049577	Bacteria	16197
472	Ga0501041_0020627	3300049577	Bacteria	3941
473	Ga0501041_0087673	3300049577	Bacteria	1921
474	Ga0501041_0149903	3300049577	Bacteria	1456
475	Ga0501041_0283520	3300049577	Bacteria	1043
476	Ga0501042_0002076	3300049578	Bacteria	12158
477	Ga0501042_0005062	3300049578	Bacteria	8458
478	Ga0501042_0013446	3300049578	Bacteria	5571
479	Ga0501042_0075275	3300049578	Bacteria	2416
480	Ga0501042_0261915	3300049578	Bacteria	1248
481	Ga0501042_0416731	3300049578	Bacteria	973
482	Ga0501043_0098011	3300049579	Bacteria	2304
483	Ga0501046_0000473	3300049580	Bacteria	40255
484	Ga0501046_0007190	3300049580	Bacteria	9793
485	Ga0501046_0008982	3300049580	Bacteria	8675
486	Ga0501046_0141385	3300049580	Bacteria	1821
487	Ga0501046_0188725	3300049580	Bacteria	1538
488	Ga0501046_0196598	3300049580	Bacteria	1502
489	Ga0501046_0257855	3300049580	Bacteria	1282
490	Ga0501046_0272959	3300049580	Bacteria	1240
491	Ga0501046_0925727	3300049580	Unclassified	607
492	Ga0501047_0261205	3300049581	Bacteria	1579
493	Ga0501048_0000622	3300049582	Bacteria	25274
494	Ga0501048_0005628	3300049582	Bacteria	9530
495	Ga0501048_0086872	3300049582	Bacteria	2206
496	Ga0501048_0748012	3300049582	Bacteria	702
497	Ga0501048_1121584	3300049582	Bacteria	566
498	Ga0501067_0006899	3300049583	Bacteria	6302
499	Ga0501068_0008572	3300049584	Bacteria	5695
500	Ga0501068_0024005	3300049584	Bacteria	3578
501	Ga0501068_0034595	3300049584	Bacteria	3013
502	Ga0501068_0112627	3300049584	Bacteria	1693
503	Ga0501068_0184498	3300049584	Bacteria	1320
504	Ga0501068_0198802	3300049584	Bacteria	1271
505	Ga0501068_0296214	3300049584	Bacteria	1035
506	Ga0501068_0429284	3300049584	Bacteria	854
507	Ga0501069_0413005	3300049585	Unclassified	799
508	Ga0501069_0698436	3300049585	Bacteria	612
509	Ga0501070_0057396	3300049586	Bacteria	3226
510	Ga0501070_0943243	3300049586	Bacteria	671
511	Ga0501071_0032787	3300049587	Bacteria	3690
512	Ga0501071_0088116	3300049587	Bacteria	2277
513	Ga0501071_0128834	3300049587	Bacteria	1879
514	Ga0501071_0209878	3300049587	Bacteria	1464
515	Ga0501071_0326873	3300049587	Bacteria	1165
516	Ga0501071_0602041	3300049587	Bacteria	845
517	Ga0501071_1153078	3300049587	Bacteria	599
518	Ga0501072_0000926	3300049588	Bacteria	21582
519	Ga0501072_0017521	3300049588	Bacteria	5505
520	Ga0501072_0034449	3300049588	Bacteria	3969
521	Ga0501072_0063742	3300049588	Bacteria	2908
522	Ga0501072_0138149	3300049588	Bacteria	1943
523	Ga0501072_0168793	3300049588	Bacteria	1746
524	Ga0501073_0049077	3300049589	Bacteria	2961
525	Ga0501073_0075983	3300049589	Bacteria	2338
526	Ga0501073_0123338	3300049589	Bacteria	1796
527	Ga0501074_0060278	3300049590	Bacteria	2734
528	Ga0501074_0060510	3300049590	Bacteria	2729
529	Ga0501074_0076446	3300049590	Bacteria	2403
530	Ga0501075_0000087	3300049591	Bacteria	42072
531	Ga0501075_0000677	3300049591	Bacteria	21038
532	Ga0501075_0004122	3300049591	Bacteria	9816
533	Ga0501075_0020850	3300049591	Bacteria	4771
534	Ga0501075_0040343	3300049591	Bacteria	3496
535	Ga0501075_0043915	3300049591	Bacteria	3352
536	Ga0501075_0072994	3300049591	Bacteria	2594
537	Ga0501075_0355991	3300049591	Unclassified	1115
538	Ga0501075_0373483	3300049591	Bacteria	1087
539	Ga0501076_0000193	3300049592	Bacteria	36447
540	Ga0501076_0006355	3300049592	Bacteria	8568
541	Ga0501076_0009906	3300049592	Bacteria	7044
542	Ga0501076_0016701	3300049592	Bacteria	5568
543	Ga0501076_0022314	3300049592	Bacteria	4865
544	Ga0501076_0036309	3300049592	Bacteria	3862
545	Ga0501076_0137459	3300049592	Bacteria	1984
546	Ga0501076_0200001	3300049592	Bacteria	1631
547	Ga0501076_0540095	3300049592	Bacteria	961
548	Ga0501076_0675821	3300049592	Bacteria	852
549	Ga0501077_0006722	3300049593	Bacteria	7076
550	Ga0501077_0008342	3300049593	Bacteria	6411
551	Ga0501077_0303357	3300049593	Bacteria	1017
552	Ga0501079_0000497	3300049741	Bacteria	25626
553	Ga0501079_0001001	3300049741	Bacteria	19537
554	Ga0501079_0001735	3300049741	Bacteria	15548
555	Ga0501079_0004073	3300049741	Bacteria	10828
556	Ga0501079_0020696	3300049741	Bacteria	5030
557	Ga0501079_0031830	3300049741	Bacteria	4054
558	Ga0501079_0067739	3300049741	Bacteria	2755
559	Ga0501079_0083152	3300049741	Bacteria	2476
560	Ga0501079_0182255	3300049741	Bacteria	1639
561	Ga0501079_0374457	3300049741	Bacteria	1116
562	Ga0501080_0003015	3300049742	Bacteria	14840
563	Ga0501080_0023228	3300049742	Bacteria	5750
564	Ga0501080_0036612	3300049742	Bacteria	4580
565	Ga0501080_0102265	3300049742	Bacteria	2658
566	Ga0501080_0111564	3300049742	Bacteria	2535
567	Ga0501080_0145480	3300049742	Bacteria	2191
568	Ga0501081_0001353	3300049743	Bacteria	14958
569	Ga0501081_0001928	3300049743	Bacteria	12878
570	Ga0501081_0003788	3300049743	Bacteria	9687
571	Ga0501081_0005528	3300049743	Bacteria	8158
572	Ga0501081_0006164	3300049743	Bacteria	7764
573	Ga0501081_0059069	3300049743	Bacteria	2654
574	Ga0501081_0066435	3300049743	Bacteria	2508
575	Ga0501081_0082665	3300049743	Bacteria	2250
576	Ga0501081_0090660	3300049743	Bacteria	2149
577	Ga0501081_0332719	3300049743	Unclassified	1117
578	Ga0501081_0426792	3300049743	Unclassified	983
579	Ga0501081_0451229	3300049743	Bacteria	955
580	Ga0501083_0016300	3300049744	Bacteria	5204
581	Ga0501083_0040777	3300049744	Bacteria	3151
582	Ga0501083_0079016	3300049744	Bacteria	2182
583	Ga0501083_0107053	3300049744	Bacteria	1840
584	Ga0501083_0153121	3300049744	Bacteria	1510
585	Ga0501083_0307168	3300049744	Bacteria	1032
586	Ga0501083_0547351	3300049744	Bacteria	753
587	Ga0501035_0054196	3300049822	Bacteria	3584
588	Ga0501035_0059303	3300049822	Bacteria	3408
589	Ga0501035_0131264	3300049822	Bacteria	2184
590	Ga0501044_1477886	3300049823	Bacteria	545
591	Ga0501045_0001532	3300049824	Bacteria	15398
592	Ga0501045_0002276	3300049824	Bacteria	13011
593	Ga0501045_0012658	3300049824	Bacteria	5940
594	Ga0501045_0038745	3300049824	Bacteria	3467
595	Ga0501045_0065022	3300049824	Bacteria	2678
596	Ga0501045_0089634	3300049824	Bacteria	2272
597	Ga0501045_0107172	3300049824	Bacteria	2071
598	Ga0501045_0208962	3300049824	Bacteria	1454
599	Ga0501045_0338229	3300049824	Bacteria	1120
600	nmdc:mga05p37_102397_c1	3300050507	Unclassified	3526
601	nmdc:mga05p37_1178968_c1	3300050507	Unclassified	794
602	nmdc:mga05p37_1316_c1	3300050507	Bacteria	28895
603	nmdc:mga05p37_164514_c1	3300050507	Bacteria	2708
604	nmdc:mga05p37_165625_c1	3300050507	Bacteria	2698
605	nmdc:mga05p37_1819_c1	3300050507	Bacteria	24861
606	nmdc:mga05p37_23131_c1	3300050507	Bacteria	7540
607	nmdc:mga05p37_256411_c1	3300050507	Bacteria	2096
608	nmdc:mga05p37_27022_c1	3300050507	Bacteria	6984
609	nmdc:mga05p37_500540_c1	3300050507	Bacteria	1395
610	nmdc:mga05p37_527135_c1	3300050507	Bacteria	1350
611	nmdc:mga05p37_66315_c1	3300050507	Bacteria	4440
612	nmdc:mga05p37_6867_c1	3300050507	Bacteria	13417
613	nmdc:mga05p37_80877_c1	3300050507	Bacteria	4002
614	nmdc:mga09592_24940_c1	3300050508	Bacteria	4946
615	nmdc:mga09592_29705_c1	3300050508	Bacteria	4545
616	nmdc:mga09592_44946_c1	3300050508	Bacteria	3719
617	nmdc:mga09592_5185_c1	3300050508	Bacteria	10591
618	nmdc:mga09592_57406_c1	3300050508	Bacteria	3290
619	nmdc:mga09592_626200_c1	3300050508	Bacteria	920
620	nmdc:mga0qj67_122321_c1	3300050509	Bacteria	2105
621	nmdc:mga0qj67_179132_c1	3300050509	Bacteria	1721
622	nmdc:mga0qj67_407085_c1	3300050509	Bacteria	1097
623	nmdc:mga0qj67_4529_c1	3300050509	Bacteria	10069
624	nmdc:mga0qj67_6307_c1	3300050509	Bacteria	8704
625	nmdc:mga06r32_1062_c1	3300050510	Bacteria	24771
626	nmdc:mga06r32_1077263_c1	3300050510	Bacteria	753
627	nmdc:mga06r32_144339_c1	3300050510	Bacteria	2357
628	nmdc:mga06r32_17589_c1	3300050510	Bacteria	6529
629	nmdc:mga06r32_187376_c1	3300050510	Bacteria	2056
630	nmdc:mga06r32_21924_c1	3300050510	Bacteria	5898
631	nmdc:mga06r32_29520_c1	3300050510	Bacteria	5141
632	nmdc:mga06r32_319_c1	3300050510	Bacteria	40297
633	nmdc:mga06r32_401856_c1	3300050510	Bacteria	1352
634	nmdc:mga06r32_83198_c1	3300050510	Bacteria	3119
635	nmdc:mga08y16_186406_c1	3300050511	Bacteria	2153
636	nmdc:mga08y16_467477_c1	3300050511	Bacteria	1284
637	nmdc:mga08y16_7089_c1	3300050511	Bacteria	11763
638	nmdc:mga08y16_73523_c1	3300050511	Bacteria	3563
639	nmdc:mga0n895_11592_c1	3300050512	Bacteria	7876
640	nmdc:mga0n895_1185_c1	3300050512	Bacteria	19167
641	nmdc:mga0n895_125500_c1	3300050512	Bacteria	2590
642	nmdc:mga0n895_162306_c1	3300050512	Bacteria	2266
643	nmdc:mga0n895_179618_c1	3300050512	Bacteria	2148
644	nmdc:mga0n895_397499_c1	3300050512	Bacteria	1394
645	nmdc:mga0n895_44133_c1	3300050512	Bacteria	4348
646	nmdc:mga0n895_85163_c1	3300050512	Bacteria	3155
647	nmdc:mga0rr50_233755_c1	3300050513	Bacteria	1522
648	nmdc:mga0rr50_401138_c1	3300050513	Bacteria	1158
649	nmdc:mga0rr50_681454_c1	3300050513	Bacteria	877
650	nmdc:mga0rr50_7254_c1	3300050513	Bacteria	6819
651	nmdc:mga0rr50_99998_c1	3300050513	Bacteria	2276
652	nmdc:mga08x19_278972_c1	3300050514	Bacteria	1158
653	nmdc:mga08x19_29166_c1	3300050514	Bacteria	3460
654	nmdc:mga08x19_3445_c1	3300050514	Bacteria	9433
655	nmdc:mga0a205_10742_c1	3300050515	Bacteria	5227
656	nmdc:mga0a205_128965_c1	3300050515	Bacteria	2430
657	nmdc:mga0a205_170014_c1	3300050515	Bacteria	2076
658	nmdc:mga0a205_17213_c1	3300050515	Bacteria	6771
659	nmdc:mga0a205_289388_c1	3300050515	Bacteria	1513
660	nmdc:mga0a205_353192_c1	3300050515	Unclassified	1337
661	nmdc:mga0a205_411_c1	3300050515	Bacteria	32848
662	nmdc:mga0a205_4561_c1	3300050515	Bacteria	12428
663	Ga0501084_0008118	3300054114	Bacteria	8649
664	Ga0501084_0026529	3300054114	Bacteria	4836
665	Ga0501084_0035171	3300054114	Bacteria	4187
666	Ga0501084_0119339	3300054114	Bacteria	2217
667	Ga0501084_0460534	3300054114	Bacteria	1075
668	Ga0501084_0625286	3300054114	Bacteria	909
669	Ga0501084_0833198	3300054114	Bacteria	776
670	Ga0501084_1125884	3300054114	Bacteria	659
671	Ga0501082_0000407	3300060353	Bacteria	38099
672	Ga0501082_0001594	3300060353	Bacteria	20004
673	Ga0501082_0005681	3300060353	Bacteria	10824
674	Ga0501082_0035854	3300060353	Bacteria	4275
675	Ga0501082_0060333	3300060353	Bacteria	3266
676	Ga0501082_0099703	3300060353	Bacteria	2512
677	Ga0501082_0234637	3300060353	Bacteria	1596
678	Ga0501082_0300790	3300060353	Bacteria	1397
679	Ga0501082_0645598	3300060353	Bacteria	926
680	Ga0530510_0000015	3300061734	Bacteria	104554
681	Ga0530510_0002671	3300061734	Bacteria	12251
682	Ga0530510_0025974	3300061734	Bacteria	4188
683	Ga0530510_0032504	3300061734	Bacteria	3754
684	Ga0530510_0087416	3300061734	Bacteria	2271
685	Ga0530510_0159867	3300061734	Bacteria	1666
686	Ga0530510_0177768	3300061734	Bacteria	1578
687	Ga0530510_0338535	3300061734	Bacteria	1129
688	Ga0530510_0434549	3300061734	Bacteria	991
689	Ga0530510_0909908	3300061734	Unclassified	672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300038996	Ga0242420_005251	Ga0242420_005251_1363_1785	139
2	3300049568	Ga0501031_0790525	Ga0501031_0790525_150_572	139
3	3300049573	Ga0501037_0822578	Ga0501037_0822578_168_590	139
4	3300005354	Ga0070675_101198655	Ga0070675_1011986551	148
5	3300005434	Ga0070709_10129814	Ga0070709_101298143	148
6	3300005439	Ga0070711_100262366	Ga0070711_1002623663	148
7	3300005440	Ga0070705_100232339	Ga0070705_1002323393	148
8	3300005617	Ga0068859_101731190	Ga0068859_1017311901	148
9	3300005841	Ga0068863_100115930	Ga0068863_1001159305	148
10	3300006175	Ga0070712_100022869	Ga0070712_1000228694	148
11	3300006931	Ga0097620_101731488	Ga0097620_1017314881	148
12	3300025906	Ga0207699_11118293	Ga0207699_111182931	148
13	3300025915	Ga0207693_10032257	Ga0207693_100322574	148
14	3300025916	Ga0207663_10762573	Ga0207663_107625732	148
15	3300026088	Ga0207641_10175329	Ga0207641_101753293	148
16	3300005445	Ga0070708_100040198	Ga0070708_1000401985	149
17	3300005445	Ga0070708_100288589	Ga0070708_1002885892	149
18	3300005467	Ga0070706_100631636	Ga0070706_1006316362	149
19	3300005468	Ga0070707_100761885	Ga0070707_1007618852	149
20	3300005471	Ga0070698_101517826	Ga0070698_1015178261	149
21	3300005518	Ga0070699_100015393	Ga0070699_1000153936	149
22	3300005536	Ga0070697_100496497	Ga0070697_1004964972	149
23	3300005545	Ga0070695_100899149	Ga0070695_1008991491	149
24	3300009147	Ga0114129_11058274	Ga0114129_110582742	149
25	3300025910	Ga0207684_10133104	Ga0207684_101331043	149
26	3300025922	Ga0207646_10045410	Ga0207646_100454102	149
27	3300025931	Ga0207644_10302342	Ga0207644_103023423	149
28	3300050507	nmdc:mga05p37_1178968_c1	nmdc:mga05p37_1178968_c1_129_590	149
29	3300003911	JGI25405J52794_10092724	JGI25405J52794_100927241	150
30	3300005444	Ga0070694_100344922	Ga0070694_1003449223	150
31	3300005536	Ga0070697_100399486	Ga0070697_1003994862	150
32	3300005937	Ga0081455_10000135	Ga0081455_1000013530	150
33	3300006163	Ga0070715_10196315	Ga0070715_101963152	150
34	3300006846	Ga0075430_100004972	Ga0075430_1000049726	150
35	3300006846	Ga0075430_100013495	Ga0075430_1000134956	150
36	3300006847	Ga0075431_100008963	Ga0075431_1000089634	150
37	3300006847	Ga0075431_100053788	Ga0075431_1000537885	150
38	3300006871	Ga0075434_100259995	Ga0075434_1002599953	150
39	3300006871	Ga0075434_100395243	Ga0075434_1003952432	150
40	3300006880	Ga0075429_100000216	Ga0075429_1000002165	150
41	3300006880	Ga0075429_100020603	Ga0075429_1000206032	150
42	3300009147	Ga0114129_10019007	Ga0114129_100190076	150
43	3300009147	Ga0114129_10066735	Ga0114129_100667354	150
44	3300009147	Ga0114129_10104605	Ga0114129_101046055	150
45	3300013306	Ga0163162_11938380	Ga0163162_119383801	150
46	3300025922	Ga0207646_10799841	Ga0207646_107998412	150
47	3300031731	Ga0307405_11101248	Ga0307405_111012481	150
48	3300031852	Ga0307410_10938186	Ga0307410_109381862	150
49	3300031903	Ga0307407_11072060	Ga0307407_110720601	150
50	3300044673	Ga0453683_0132614	Ga0453683_0132614_133_600	150
51	3300049572	Ga0501036_0124143	Ga0501036_0124143_1174_1632	150
52	3300049572	Ga0501036_0168326	Ga0501036_0168326_64_522	150
53	3300049573	Ga0501037_0964894	Ga0501037_0964894_21_479	150
54	3300049574	Ga0501038_0676124	Ga0501038_0676124_169_627	150
55	3300049575	Ga0501039_0318412	Ga0501039_0318412_288_746	150
56	3300049576	Ga0501040_0030963	Ga0501040_0030963_1864_2319	150
57	3300049576	Ga0501040_0146878	Ga0501040_0146878_1025_1510	150
58	3300049577	Ga0501041_0087673	Ga0501041_0087673_531_1016	150
59	3300049577	Ga0501041_0149903	Ga0501041_0149903_551_1009	150
60	3300049578	Ga0501042_0013446	Ga0501042_0013446_2196_2654	150
61	3300049578	Ga0501042_0075275	Ga0501042_0075275_749_1207	150
62	3300049578	Ga0501042_0416731	Ga0501042_0416731_451_936	150
63	3300049580	Ga0501046_0188725	Ga0501046_0188725_979_1464	150
64	3300049580	Ga0501046_0272959	Ga0501046_0272959_47_502	150
65	3300049583	Ga0501067_0006899	Ga0501067_0006899_2500_2958	150
66	3300049584	Ga0501068_0024005	Ga0501068_0024005_275_733	150
67	3300049584	Ga0501068_0112627	Ga0501068_0112627_15_473	150
68	3300049584	Ga0501068_0429284	Ga0501068_0429284_213_698	150
69	3300049585	Ga0501069_0413005	Ga0501069_0413005_253_711	150
70	3300049585	Ga0501069_0698436	Ga0501069_0698436_16_474	150
71	3300049586	Ga0501070_0943243	Ga0501070_0943243_129_614	150
72	3300049587	Ga0501071_0209878	Ga0501071_0209878_91_549	150
73	3300049588	Ga0501072_0017521	Ga0501072_0017521_3637_4095	150
74	3300049588	Ga0501072_0138149	Ga0501072_0138149_937_1395	150
75	3300049589	Ga0501073_0075983	Ga0501073_0075983_178_663	150
76	3300049589	Ga0501073_0123338	Ga0501073_0123338_917_1375	150
77	3300049591	Ga0501075_0040343	Ga0501075_0040343_1668_2126	150
78	3300049591	Ga0501075_0043915	Ga0501075_0043915_197_682	150
79	3300049591	Ga0501075_0072994	Ga0501075_0072994_1322_1780	150
80	3300049591	Ga0501075_0355991	Ga0501075_0355991_183_641	150
81	3300049592	Ga0501076_0006355	Ga0501076_0006355_298_756	150
82	3300049592	Ga0501076_0016701	Ga0501076_0016701_288_746	150
83	3300049592	Ga0501076_0022314	Ga0501076_0022314_3961_4446	150
84	3300049593	Ga0501077_0008342	Ga0501077_0008342_2661_3146	150
85	3300049741	Ga0501079_0001001	Ga0501079_0001001_7807_8292	150
86	3300049741	Ga0501079_0004073	Ga0501079_0004073_4084_4542	150
87	3300049741	Ga0501079_0031830	Ga0501079_0031830_885_1340	150
88	3300049741	Ga0501079_0067739	Ga0501079_0067739_2218_2676	150
89	3300049742	Ga0501080_0036612	Ga0501080_0036612_130_615	150
90	3300049742	Ga0501080_0145480	Ga0501080_0145480_1078_1536	150
91	3300049743	Ga0501081_0001353	Ga0501081_0001353_10821_11279	150
92	3300049743	Ga0501081_0005528	Ga0501081_0005528_5633_6118	150
93	3300049743	Ga0501081_0082665	Ga0501081_0082665_860_1318	150
94	3300049743	Ga0501081_0332719	Ga0501081_0332719_480_938	150
95	3300049744	Ga0501083_0079016	Ga0501083_0079016_454_912	150
96	3300049744	Ga0501083_0307168	Ga0501083_0307168_28_486	150
97	3300049744	Ga0501083_0547351	Ga0501083_0547351_110_595	150
98	3300049824	Ga0501045_0038745	Ga0501045_0038745_1106_1564	150
99	3300049824	Ga0501045_0065022	Ga0501045_0065022_161_619	150
100	3300049824	Ga0501045_0089634	Ga0501045_0089634_130_615	150
101	3300050507	nmdc:mga05p37_165625_c1	nmdc:mga05p37_165625_c1_429_914	150
102	3300050507	nmdc:mga05p37_256411_c1	nmdc:mga05p37_256411_c1_1573_2034	150
103	3300050507	nmdc:mga05p37_27022_c1	nmdc:mga05p37_27022_c1_1702_2160	150
104	3300050507	nmdc:mga05p37_6867_c1	nmdc:mga05p37_6867_c1_6038_6499	150
105	3300050507	nmdc:mga05p37_80877_c1	nmdc:mga05p37_80877_c1_1127_1612	150
106	3300050508	nmdc:mga09592_44946_c1	nmdc:mga09592_44946_c1_2950_3408	150
107	3300050508	nmdc:mga09592_5185_c1	nmdc:mga09592_5185_c1_6133_6594	150
108	3300050509	nmdc:mga0qj67_4529_c1	nmdc:mga0qj67_4529_c1_5637_6098	150
109	3300050509	nmdc:mga0qj67_6307_c1	nmdc:mga0qj67_6307_c1_5710_6168	150
110	3300050510	nmdc:mga06r32_1062_c1	nmdc:mga06r32_1062_c1_20313_20774	150
111	3300050510	nmdc:mga06r32_1077263_c1	nmdc:mga06r32_1077263_c1_82_567	150
112	3300050510	nmdc:mga06r32_21924_c1	nmdc:mga06r32_21924_c1_2764_3222	150
113	3300050512	nmdc:mga0n895_11592_c1	nmdc:mga0n895_11592_c1_5380_5865	150
114	3300050512	nmdc:mga0n895_162306_c1	nmdc:mga0n895_162306_c1_1567_2025	150
115	3300050513	nmdc:mga0rr50_99998_c1	nmdc:mga0rr50_99998_c1_930_1415	150
116	3300050514	nmdc:mga08x19_29166_c1	nmdc:mga08x19_29166_c1_1265_1750	150
117	3300050515	nmdc:mga0a205_128965_c1	nmdc:mga0a205_128965_c1_1356_1841	150
118	3300050515	nmdc:mga0a205_289388_c1	nmdc:mga0a205_289388_c1_190_648	150
119	3300054114	Ga0501084_0035171	Ga0501084_0035171_2383_2868	150
120	3300060353	Ga0501082_0001594	Ga0501082_0001594_18546_19004	150
121	3300060353	Ga0501082_0035854	Ga0501082_0035854_2827_3285	150
122	3300060353	Ga0501082_0060333	Ga0501082_0060333_2585_3070	150
123	3300061734	Ga0530510_0032504	Ga0530510_0032504_1605_2063	150
124	3300061734	Ga0530510_0087416	Ga0530510_0087416_135_593	150
125	3300061734	Ga0530510_0909908	Ga0530510_0909908_42_527	150
126	3300005336	Ga0070680_100107906	Ga0070680_1001079061	151
127	3300005440	Ga0070705_100714373	Ga0070705_1007143732	151
128	3300005444	Ga0070694_100008450	Ga0070694_1000084502	151
129	3300005445	Ga0070708_100548632	Ga0070708_1005486321	151
130	3300005445	Ga0070708_101473186	Ga0070708_1014731862	151
131	3300005467	Ga0070706_100958292	Ga0070706_1009582921	151
132	3300005468	Ga0070707_100029902	Ga0070707_1000299021	151
133	3300005468	Ga0070707_100092200	Ga0070707_1000922004	151
134	3300005471	Ga0070698_100054205	Ga0070698_1000542051	151
135	3300005518	Ga0070699_100052883	Ga0070699_1000528832	151
136	3300005518	Ga0070699_100115800	Ga0070699_1001158001	151
137	3300005536	Ga0070697_100034147	Ga0070697_1000341471	151
138	3300005536	Ga0070697_100298602	Ga0070697_1002986022	151
139	3300005536	Ga0070697_101117830	Ga0070697_1011178302	151
140	3300005545	Ga0070695_100007902	Ga0070695_1000079022	151
141	3300005546	Ga0070696_100131151	Ga0070696_1001311512	151
142	3300005549	Ga0070704_100398594	Ga0070704_1003985942	151
143	3300005549	Ga0070704_101477549	Ga0070704_1014775491	151
144	3300006847	Ga0075431_100107336	Ga0075431_1001073364	151
145	3300006871	Ga0075434_101308293	Ga0075434_1013082931	151
146	3300007265	Ga0099794_10013456	Ga0099794_100134562	151
147	3300009148	Ga0105243_12239788	Ga0105243_122397881	151
148	3300025910	Ga0207684_10015127	Ga0207684_100151274	151
149	3300025910	Ga0207684_10018668	Ga0207684_100186685	151
150	3300025910	Ga0207684_10123975	Ga0207684_101239753	151
151	3300025915	Ga0207693_10802442	Ga0207693_108024421	151
152	3300025917	Ga0207660_10175198	Ga0207660_101751982	151
153	3300025922	Ga0207646_10027744	Ga0207646_100277444	151
154	3300025922	Ga0207646_10290193	Ga0207646_102901932	151
155	3300025922	Ga0207646_10378777	Ga0207646_103787772	151
156	3300025935	Ga0207709_10135801	Ga0207709_101358012	151
157	3300027671	Ga0209588_1027744	Ga0209588_10277442	151
158	3300034817	Ga0373948_0024587	Ga0373948_0024587_19_504	151
159	3300035090	Ga0373949_0087121	Ga0373949_0087121_141_626	151
160	3300038443	Ga0395901_0432242	Ga0395901_0432242_107_562	151
161	3300042001	Ga0439441_006700	Ga0439441_006700_1266_1754	151
162	3300042876	Ga0451577_0330112	Ga0451577_0330112_794_1279	151
163	3300045051	Ga0451576_0002399	Ga0451576_0002399_2252_2737	151
164	3300049580	Ga0501046_0257855	Ga0501046_0257855_199_684	151
165	3300049582	Ga0501048_0086872	Ga0501048_0086872_1410_1895	151
166	3300049584	Ga0501068_0296214	Ga0501068_0296214_318_803	151
167	3300049587	Ga0501071_0128834	Ga0501071_0128834_1229_1714	151
168	3300049588	Ga0501072_0168793	Ga0501072_0168793_1187_1672	151
169	3300049590	Ga0501074_0076446	Ga0501074_0076446_93_578	151
170	3300049592	Ga0501076_0675821	Ga0501076_0675821_73_558	151
171	3300049741	Ga0501079_0083152	Ga0501079_0083152_1793_2278	151
172	3300049742	Ga0501080_0102265	Ga0501080_0102265_1867_2352	151
173	3300049743	Ga0501081_0059069	Ga0501081_0059069_1871_2356	151
174	3300049822	Ga0501035_0131264	Ga0501035_0131264_346_831	151
175	3300049823	Ga0501044_1477886	Ga0501044_1477886_38_523	151
176	3300049824	Ga0501045_0338229	Ga0501045_0338229_93_578	151
177	3300050510	nmdc:mga06r32_144339_c1	nmdc:mga06r32_144339_c1_1295_1756	151
178	3300061734	Ga0530510_0434549	Ga0530510_0434549_134_619	151
179	3300003203	JGI25406J46586_10003357	JGI25406J46586_100033572	152
180	3300003503	JGI26141J51220_1001332	JGI26141J51220_10013323	152
181	3300005290	Ga0065712_10565359	Ga0065712_105653591	152
182	3300005293	Ga0065715_10115701	Ga0065715_101157012	152
183	3300005295	Ga0065707_10144990	Ga0065707_101449902	152
184	3300005328	Ga0070676_10000311	Ga0070676_100003113	152
185	3300005328	Ga0070676_10098693	Ga0070676_100986931	152
186	3300005329	Ga0070683_100077367	Ga0070683_1000773672	152
187	3300005330	Ga0070690_100037292	Ga0070690_1000372924	152
188	3300005334	Ga0068869_100000372	Ga0068869_10000037221	152
189	3300005336	Ga0070680_100000565	Ga0070680_10000056521	152
190	3300005336	Ga0070680_100020227	Ga0070680_1000202274	152
191	3300005337	Ga0070682_100029098	Ga0070682_1000290984	152
192	3300005338	Ga0068868_100150460	Ga0068868_1001504603	152
193	3300005339	Ga0070660_100000083	Ga0070660_10000008364	152
194	3300005340	Ga0070689_100013201	Ga0070689_1000132014	152
195	3300005340	Ga0070689_101356183	Ga0070689_1013561831	152
196	3300005341	Ga0070691_10019730	Ga0070691_100197303	152
197	3300005341	Ga0070691_10302016	Ga0070691_103020162	152
198	3300005344	Ga0070661_100000993	Ga0070661_1000009936	152
199	3300005345	Ga0070692_10002520	Ga0070692_100025204	152
200	3300005345	Ga0070692_10023227	Ga0070692_100232274	152
201	3300005345	Ga0070692_10282239	Ga0070692_102822392	152
202	3300005353	Ga0070669_100110899	Ga0070669_1001108991	152
203	3300005353	Ga0070669_100132839	Ga0070669_1001328393	152
204	3300005353	Ga0070669_100707084	Ga0070669_1007070842	152
205	3300005355	Ga0070671_100339259	Ga0070671_1003392592	152
206	3300005364	Ga0070673_100652791	Ga0070673_1006527912	152
207	3300005365	Ga0070688_100133987	Ga0070688_1001339872	152
208	3300005366	Ga0070659_100000377	Ga0070659_10000037713	152
209	3300005434	Ga0070709_10069843	Ga0070709_100698432	152
210	3300005438	Ga0070701_10173702	Ga0070701_101737022	152
211	3300005438	Ga0070701_10272530	Ga0070701_102725301	152
212	3300005440	Ga0070705_100003528	Ga0070705_10000352810	152
213	3300005440	Ga0070705_100007493	Ga0070705_1000074935	152
214	3300005440	Ga0070705_100034109	Ga0070705_1000341093	152
215	3300005440	Ga0070705_100062551	Ga0070705_1000625514	152
216	3300005441	Ga0070700_100069531	Ga0070700_1000695312	152
217	3300005444	Ga0070694_100003804	Ga0070694_10000380410	152
218	3300005444	Ga0070694_100044003	Ga0070694_1000440034	152
219	3300005444	Ga0070694_100044269	Ga0070694_1000442693	152
220	3300005444	Ga0070694_100097039	Ga0070694_1000970392	152
221	3300005444	Ga0070694_100492088	Ga0070694_1004920882	152
222	3300005444	Ga0070694_100614499	Ga0070694_1006144991	152
223	3300005445	Ga0070708_100010797	Ga0070708_1000107972	152
224	3300005445	Ga0070708_100151981	Ga0070708_1001519812	152
225	3300005445	Ga0070708_100155641	Ga0070708_1001556413	152
226	3300005445	Ga0070708_100541086	Ga0070708_1005410861	152
227	3300005445	Ga0070708_100918062	Ga0070708_1009180622	152
228	3300005455	Ga0070663_100001928	Ga0070663_10000192813	152
229	3300005457	Ga0070662_100274659	Ga0070662_1002746592	152
230	3300005457	Ga0070662_100331422	Ga0070662_1003314221	152
231	3300005458	Ga0070681_10214446	Ga0070681_102144462	152
232	3300005459	Ga0068867_100003302	Ga0068867_1000033023	152
233	3300005466	Ga0070685_10192065	Ga0070685_101920651	152
234	3300005467	Ga0070706_100037281	Ga0070706_1000372815	152
235	3300005467	Ga0070706_100066260	Ga0070706_1000662603	152
236	3300005468	Ga0070707_100004378	Ga0070707_1000043789	152
237	3300005468	Ga0070707_100052528	Ga0070707_1000525284	152
238	3300005468	Ga0070707_100074928	Ga0070707_1000749284	152
239	3300005468	Ga0070707_100721664	Ga0070707_1007216642	152
240	3300005471	Ga0070698_100011570	Ga0070698_1000115709	152
241	3300005471	Ga0070698_100011940	Ga0070698_10001194010	152
242	3300005471	Ga0070698_100136302	Ga0070698_1001363024	152
243	3300005471	Ga0070698_101148713	Ga0070698_1011487131	152
244	3300005518	Ga0070699_100000858	Ga0070699_10000085822	152
245	3300005518	Ga0070699_100007833	Ga0070699_1000078332	152
246	3300005518	Ga0070699_100020082	Ga0070699_1000200823	152
247	3300005518	Ga0070699_100087230	Ga0070699_1000872302	152
248	3300005518	Ga0070699_100335471	Ga0070699_1003354712	152
249	3300005518	Ga0070699_100335794	Ga0070699_1003357942	152
250	3300005518	Ga0070699_100401087	Ga0070699_1004010872	152
251	3300005530	Ga0070679_100005861	Ga0070679_1000058614	152
252	3300005535	Ga0070684_100026394	Ga0070684_1000263942	152
253	3300005536	Ga0070697_100022371	Ga0070697_1000223714	152
254	3300005536	Ga0070697_100576454	Ga0070697_1005764541	152
255	3300005536	Ga0070697_101429770	Ga0070697_1014297701	152
256	3300005539	Ga0068853_100002000	Ga0068853_10000200017	152
257	3300005543	Ga0070672_101207509	Ga0070672_1012075092	152
258	3300005544	Ga0070686_101150449	Ga0070686_1011504491	152
259	3300005545	Ga0070695_100000479	Ga0070695_1000004792	152
260	3300005545	Ga0070695_100029303	Ga0070695_1000293034	152
261	3300005545	Ga0070695_100191565	Ga0070695_1001915652	152
262	3300005545	Ga0070695_100459013	Ga0070695_1004590132	152
263	3300005545	Ga0070695_101024043	Ga0070695_1010240432	152
264	3300005546	Ga0070696_100004112	Ga0070696_1000041127	152
265	3300005546	Ga0070696_100017813	Ga0070696_1000178134	152
266	3300005546	Ga0070696_100066139	Ga0070696_1000661394	152
267	3300005546	Ga0070696_100152020	Ga0070696_1001520204	152
268	3300005546	Ga0070696_101358962	Ga0070696_1013589621	152
269	3300005547	Ga0070693_100006470	Ga0070693_1000064706	152
270	3300005547	Ga0070693_100007425	Ga0070693_1000074252	152
271	3300005549	Ga0070704_100002122	Ga0070704_1000021226	152
272	3300005549	Ga0070704_100231229	Ga0070704_1002312291	152
273	3300005549	Ga0070704_100622371	Ga0070704_1006223712	152
274	3300005549	Ga0070704_100884209	Ga0070704_1008842091	152
275	3300005563	Ga0068855_100017721	Ga0068855_1000177214	152
276	3300005563	Ga0068855_100496897	Ga0068855_1004968972	152
277	3300005564	Ga0070664_100204183	Ga0070664_1002041833	152
278	3300005577	Ga0068857_100195821	Ga0068857_1001958212	152
279	3300005577	Ga0068857_101040676	Ga0068857_1010406761	152
280	3300005578	Ga0068854_100004148	Ga0068854_1000041487	152
281	3300005614	Ga0068856_100020276	Ga0068856_1000202762	152
282	3300005617	Ga0068859_100001495	Ga0068859_1000014952	152
283	3300005617	Ga0068859_100151751	Ga0068859_1001517515	152
284	3300005617	Ga0068859_100259482	Ga0068859_1002594823	152
285	3300005617	Ga0068859_100561485	Ga0068859_1005614851	152
286	3300005617	Ga0068859_101358286	Ga0068859_1013582861	152
287	3300005618	Ga0068864_100030243	Ga0068864_1000302432	152
288	3300005719	Ga0068861_100011013	Ga0068861_1000110137	152
289	3300005719	Ga0068861_100106140	Ga0068861_1001061402	152
290	3300005840	Ga0068870_10000942	Ga0068870_1000094212	152
291	3300005842	Ga0068858_100013717	Ga0068858_1000137175	152
292	3300005843	Ga0068860_100003613	Ga0068860_10000361319	152
293	3300005843	Ga0068860_100085941	Ga0068860_1000859414	152
294	3300005843	Ga0068860_100665413	Ga0068860_1006654132	152
295	3300005843	Ga0068860_100905738	Ga0068860_1009057382	152
296	3300005844	Ga0068862_100004332	Ga0068862_1000043325	152
297	3300005844	Ga0068862_100005041	Ga0068862_1000050414	152
298	3300005844	Ga0068862_100150470	Ga0068862_1001504704	152
299	3300005844	Ga0068862_100182123	Ga0068862_1001821233	152
300	3300005985	Ga0081539_10000009	Ga0081539_10000009336	152
301	3300006058	Ga0075432_10183393	Ga0075432_101833932	152
302	3300006058	Ga0075432_10249307	Ga0075432_102493072	152
303	3300006173	Ga0070716_100007463	Ga0070716_1000074634	152
304	3300006237	Ga0097621_100471943	Ga0097621_1004719432	152
305	3300006358	Ga0068871_100582199	Ga0068871_1005821992	152
306	3300006844	Ga0075428_100011921	Ga0075428_1000119216	152
307	3300006844	Ga0075428_100094955	Ga0075428_1000949553	152
308	3300006844	Ga0075428_100123147	Ga0075428_1001231472	152
309	3300006844	Ga0075428_100200627	Ga0075428_1002006273	152
310	3300006844	Ga0075428_101539365	Ga0075428_1015393651	152
311	3300006846	Ga0075430_100091473	Ga0075430_1000914732	152
312	3300006846	Ga0075430_100403840	Ga0075430_1004038402	152
313	3300006846	Ga0075430_100466589	Ga0075430_1004665892	152
314	3300006847	Ga0075431_100000061	Ga0075431_10000006131	152
315	3300006847	Ga0075431_100017393	Ga0075431_1000173937	152
316	3300006847	Ga0075431_100066439	Ga0075431_1000664394	152
317	3300006847	Ga0075431_100190888	Ga0075431_1001908882	152
318	3300006852	Ga0075433_10022826	Ga0075433_100228265	152
319	3300006852	Ga0075433_10034009	Ga0075433_100340093	152
320	3300006852	Ga0075433_10073645	Ga0075433_100736454	152
321	3300006852	Ga0075433_10186481	Ga0075433_101864812	152
322	3300006871	Ga0075434_100011554	Ga0075434_1000115543	152
323	3300006871	Ga0075434_100025904	Ga0075434_1000259042	152
324	3300006871	Ga0075434_100060112	Ga0075434_1000601124	152
325	3300006871	Ga0075434_100209492	Ga0075434_1002094923	152
326	3300006871	Ga0075434_100770174	Ga0075434_1007701742	152
327	3300006871	Ga0075434_100956398	Ga0075434_1009563982	152
328	3300006871	Ga0075434_101802348	Ga0075434_1018023481	152
329	3300006880	Ga0075429_100050925	Ga0075429_1000509252	152
330	3300006880	Ga0075429_100101864	Ga0075429_1001018642	152
331	3300006880	Ga0075429_100123575	Ga0075429_1001235752	152
332	3300006881	Ga0068865_100136193	Ga0068865_1001361931	152
333	3300006914	Ga0075436_100064178	Ga0075436_1000641784	152
334	3300006914	Ga0075436_100074529	Ga0075436_1000745292	152
335	3300006914	Ga0075436_100107677	Ga0075436_1001076773	152
336	3300006931	Ga0097620_100001495	Ga0097620_1000014952	152
337	3300006931	Ga0097620_100151749	Ga0097620_1001517495	152
338	3300006931	Ga0097620_100259491	Ga0097620_1002594913	152
339	3300006931	Ga0097620_100561483	Ga0097620_1005614831	152
340	3300006931	Ga0097620_101358260	Ga0097620_1013582601	152
341	3300007076	Ga0075435_100102048	Ga0075435_1001020482	152
342	3300007076	Ga0075435_100204559	Ga0075435_1002045593	152
343	3300007076	Ga0075435_100704501	Ga0075435_1007045011	152
344	3300007076	Ga0075435_101065249	Ga0075435_1010652491	152
345	3300007265	Ga0099794_10021257	Ga0099794_100212572	152
346	3300009094	Ga0111539_10003143	Ga0111539_100031439	152
347	3300009094	Ga0111539_10005934	Ga0111539_100059347	152
348	3300009094	Ga0111539_10087916	Ga0111539_100879164	152
349	3300009094	Ga0111539_10467717	Ga0111539_104677171	152
350	3300009098	Ga0105245_11685150	Ga0105245_116851502	152
351	3300009101	Ga0105247_10073999	Ga0105247_100739992	152
352	3300009147	Ga0114129_10009961	Ga0114129_1000996110	152
353	3300009147	Ga0114129_10043833	Ga0114129_100438334	152
354	3300009147	Ga0114129_10061964	Ga0114129_100619643	152
355	3300009147	Ga0114129_10081643	Ga0114129_100816434	152
356	3300009147	Ga0114129_10098089	Ga0114129_100980892	152
357	3300009147	Ga0114129_10118302	Ga0114129_101183024	152
358	3300009147	Ga0114129_10359436	Ga0114129_103594363	152
359	3300009148	Ga0105243_10044844	Ga0105243_100448442	152
360	3300009174	Ga0105241_10000389	Ga0105241_100003892	152
361	3300009174	Ga0105241_10238985	Ga0105241_102389852	152
362	3300009174	Ga0105241_10357307	Ga0105241_103573071	152
363	3300009176	Ga0105242_10945630	Ga0105242_109456302	152
364	3300009177	Ga0105248_10519680	Ga0105248_105196802	152
365	3300009177	Ga0105248_10762277	Ga0105248_107622772	152
366	3300009177	Ga0105248_11488312	Ga0105248_114883122	152
367	3300009553	Ga0105249_10070993	Ga0105249_100709932	152
368	3300009553	Ga0105249_10103083	Ga0105249_101030834	152
369	3300009553	Ga0105249_10152196	Ga0105249_101521964	152
370	3300009553	Ga0105249_10294771	Ga0105249_102947712	152
371	3300011119	Ga0105246_10133447	Ga0105246_101334473	152
372	3300011119	Ga0105246_11288868	Ga0105246_112888682	152
373	3300013100	Ga0157373_10000671	Ga0157373_100006718	152
374	3300013102	Ga0157371_10076239	Ga0157371_100762392	152
375	3300013105	Ga0157369_10042992	Ga0157369_100429922	152
376	3300013306	Ga0163162_11363502	Ga0163162_113635021	152
377	3300013306	Ga0163162_11751082	Ga0163162_117510821	152
378	3300013307	Ga0157372_10000646	Ga0157372_1000064619	152
379	3300013307	Ga0157372_10102738	Ga0157372_101027382	152
380	3300013308	Ga0157375_10127648	Ga0157375_101276482	152
381	3300013308	Ga0157375_11955199	Ga0157375_119551991	152
382	3300014325	Ga0163163_12364508	Ga0163163_123645081	152
383	3300014326	Ga0157380_12733725	Ga0157380_127337251	152
384	3300014497	Ga0182008_10163737	Ga0182008_101637372	152
385	3300014968	Ga0157379_10349217	Ga0157379_103492171	152
386	3300025885	Ga0207653_10004972	Ga0207653_100049723	152
387	3300025885	Ga0207653_10047346	Ga0207653_100473462	152
388	3300025893	Ga0207682_10096697	Ga0207682_100966972	152
389	3300025899	Ga0207642_10489374	Ga0207642_104893742	152
390	3300025901	Ga0207688_10068370	Ga0207688_100683702	152
391	3300025904	Ga0207647_10152267	Ga0207647_101522671	152
392	3300025907	Ga0207645_10004131	Ga0207645_1000413110	152
393	3300025908	Ga0207643_10000355	Ga0207643_1000035510	152
394	3300025910	Ga0207684_10000142	Ga0207684_1000014238	152
395	3300025910	Ga0207684_10041854	Ga0207684_100418545	152
396	3300025910	Ga0207684_10067107	Ga0207684_100671073	152
397	3300025910	Ga0207684_10090289	Ga0207684_100902892	152
398	3300025910	Ga0207684_10109339	Ga0207684_101093394	152
399	3300025911	Ga0207654_10001718	Ga0207654_1000171812	152
400	3300025911	Ga0207654_10072744	Ga0207654_100727443	152
401	3300025911	Ga0207654_10797016	Ga0207654_107970162	152
402	3300025912	Ga0207707_10000047	Ga0207707_10000047116	152
403	3300025916	Ga0207663_10319928	Ga0207663_103199282	152
404	3300025917	Ga0207660_10000509	Ga0207660_100005093	152
405	3300025917	Ga0207660_10024405	Ga0207660_100244057	152
406	3300025917	Ga0207660_11251893	Ga0207660_112518931	152
407	3300025919	Ga0207657_10000021	Ga0207657_1000002116	152
408	3300025921	Ga0207652_10000582	Ga0207652_100005827	152
409	3300025922	Ga0207646_10000707	Ga0207646_1000070723	152
410	3300025922	Ga0207646_10012477	Ga0207646_100124776	152
411	3300025922	Ga0207646_10025341	Ga0207646_100253416	152
412	3300025922	Ga0207646_10075690	Ga0207646_100756903	152
413	3300025922	Ga0207646_10083865	Ga0207646_100838655	152
414	3300025922	Ga0207646_10119341	Ga0207646_101193414	152
415	3300025923	Ga0207681_10135782	Ga0207681_101357823	152
416	3300025923	Ga0207681_10392025	Ga0207681_103920251	152
417	3300025923	Ga0207681_10798363	Ga0207681_107983632	152
418	3300025932	Ga0207690_10054146	Ga0207690_100541462	152
419	3300025933	Ga0207706_10011731	Ga0207706_100117317	152
420	3300025933	Ga0207706_10371545	Ga0207706_103715452	152
421	3300025933	Ga0207706_10394751	Ga0207706_103947512	152
422	3300025935	Ga0207709_10030100	Ga0207709_100301002	152
423	3300025938	Ga0207704_10231069	Ga0207704_102310692	152
424	3300025939	Ga0207665_10000411	Ga0207665_1000041124	152
425	3300025940	Ga0207691_10112667	Ga0207691_101126672	152
426	3300025940	Ga0207691_10844467	Ga0207691_108444672	152
427	3300025941	Ga0207711_10813091	Ga0207711_108130912	152
428	3300025942	Ga0207689_10005688	Ga0207689_1000568810	152
429	3300025942	Ga0207689_10219569	Ga0207689_102195693	152
430	3300025942	Ga0207689_10625200	Ga0207689_106252003	152
431	3300025944	Ga0207661_10034113	Ga0207661_100341134	152
432	3300025945	Ga0207679_10001442	Ga0207679_100014428	152
433	3300025949	Ga0207667_10000620	Ga0207667_100006207	152
434	3300025949	Ga0207667_11107853	Ga0207667_111078532	152
435	3300025960	Ga0207651_10050709	Ga0207651_100507092	152
436	3300025960	Ga0207651_11315553	Ga0207651_113155532	152
437	3300025961	Ga0207712_10251294	Ga0207712_102512943	152
438	3300025961	Ga0207712_10481984	Ga0207712_104819842	152
439	3300025961	Ga0207712_10805782	Ga0207712_108057821	152
440	3300025981	Ga0207640_10007524	Ga0207640_100075244	152
441	3300025981	Ga0207640_11705288	Ga0207640_117052881	152
442	3300026023	Ga0207677_10066924	Ga0207677_100669244	152
443	3300026035	Ga0207703_10554188	Ga0207703_105541882	152
444	3300026041	Ga0207639_10020994	Ga0207639_100209944	152
445	3300026067	Ga0207678_10005240	Ga0207678_100052402	152
446	3300026075	Ga0207708_10052980	Ga0207708_100529804	152
447	3300026075	Ga0207708_10098181	Ga0207708_100981812	152
448	3300026078	Ga0207702_10001414	Ga0207702_100014142	152
449	3300026088	Ga0207641_12500062	Ga0207641_125000621	152
450	3300026089	Ga0207648_10001227	Ga0207648_1000122710	152
451	3300026089	Ga0207648_10161512	Ga0207648_101615122	152
452	3300026116	Ga0207674_10000137	Ga0207674_1000013791	152
453	3300026116	Ga0207674_10022186	Ga0207674_100221864	152
454	3300026116	Ga0207674_10210183	Ga0207674_102101832	152
455	3300026118	Ga0207675_100005398	Ga0207675_1000053986	152
456	3300026118	Ga0207675_100119012	Ga0207675_1001190122	152
457	3300027395	Ga0209996_1009192	Ga0209996_10091923	152
458	3300027526	Ga0209968_1000231	Ga0209968_100023111	152
459	3300027552	Ga0209982_1044691	Ga0209982_10446912	152
460	3300027614	Ga0209970_1000392	Ga0209970_10003927	152
461	3300027617	Ga0210002_1005452	Ga0210002_10054523	152
462	3300027665	Ga0209983_1000027	Ga0209983_100002717	152
463	3300027671	Ga0209588_1009570	Ga0209588_10095702	152
464	3300027682	Ga0209971_1000018	Ga0209971_100001836	152
465	3300027695	Ga0209966_1000141	Ga0209966_10001414	152
466	3300027717	Ga0209998_10000062	Ga0209998_1000006247	152
467	3300027876	Ga0209974_10001104	Ga0209974_1000110410	152
468	3300027907	Ga0207428_10094600	Ga0207428_100946003	152
469	3300027907	Ga0207428_10106648	Ga0207428_101066484	152
470	3300027907	Ga0207428_10116774	Ga0207428_101167743	152
471	3300028380	Ga0268265_10003878	Ga0268265_1000387810	152
472	3300028380	Ga0268265_10006914	Ga0268265_1000691412	152
473	3300028380	Ga0268265_10026147	Ga0268265_100261472	152
474	3300028380	Ga0268265_10757266	Ga0268265_107572662	152
475	3300028381	Ga0268264_10208767	Ga0268264_102087672	152
476	3300031548	Ga0307408_100384436	Ga0307408_1003844362	152
477	3300034817	Ga0373948_0026625	Ga0373948_0026625_182_679	152
478	3300035084	Ga0373928_0027705	Ga0373928_0027705_32_529	152
479	3300035090	Ga0373949_0008613	Ga0373949_0008613_1628_2110	152
480	3300035090	Ga0373949_0011009	Ga0373949_0011009_1134_1631	152
481	3300035091	Ga0373951_0083740	Ga0373951_0083740_186_683	152
482	3300035092	Ga0373952_0007298	Ga0373952_0007298_638_1135	152
483	3300035115	Ga0373941_0068812	Ga0373941_0068812_271_768	152
484	3300035241	Ga0373961_0001441	Ga0373961_0001441_6386_6877	152
485	3300035242	Ga0373962_0123382	Ga0373962_0123382_147_638	152
486	3300035691	Ga0373931_0113521	Ga0373931_0113521_450_941	152
487	3300037312	Ga0395899_0151275	Ga0395899_0151275_58_516	152
488	3300037418	Ga0395900_0044173	Ga0395900_0044173_3842_4300	152
489	3300037471	Ga0395905_0222762	Ga0395905_0222762_674_1132	152
490	3300038443	Ga0395901_0357315	Ga0395901_0357315_934_1392	152
491	3300042001	Ga0439441_001047	Ga0439441_001047_1308_1778	152
492	3300042003	Ga0439443_037290	Ga0439443_037290_246_716	152
493	3300042005	Ga0439448_0023701	Ga0439448_0023701_1393_1890	152
494	3300042012	Ga0439455_0009005	Ga0439455_0009005_696_1187	152
495	3300042012	Ga0439455_0026634	Ga0439455_0026634_748_1245	152
496	3300042016	Ga0439463_014905	Ga0439463_014905_266_757	152
497	3300042157	Ga0439458_0006243	Ga0439458_0006243_109_606	152
498	3300042438	Ga0439459_0015895	Ga0439459_0015895_34_531	152
499	3300042461	Ga0439460_0000312	Ga0439460_0000312_9424_9915	152
500	3300042876	Ga0451577_0001628	Ga0451577_0001628_8217_8687	152
501	3300042876	Ga0451577_0007935	Ga0451577_0007935_7887_8369	152
502	3300042876	Ga0451577_0090023	Ga0451577_0090023_67_564	152
503	3300042876	Ga0451577_0385095	Ga0451577_0385095_659_1150	152
504	3300042876	Ga0451577_1183402	Ga0451577_1183402_32_523	152
505	3300042993	Ga0439440_0015076	Ga0439440_0015076_1097_1588	152
506	3300042993	Ga0439440_0225139	Ga0439440_0225139_70_534	152
507	3300044673	Ga0453683_0021446	Ga0453683_0021446_51_533	152
508	3300044673	Ga0453683_0056431	Ga0453683_0056431_202_672	152
509	3300044673	Ga0453683_0075431	Ga0453683_0075431_1459_1929	152
510	3300044673	Ga0453683_0543199	Ga0453683_0543199_126_614	152
511	3300044673	Ga0453683_0817735	Ga0453683_0817735_85_561	152
512	3300044712	Ga0453684_0038634	Ga0453684_0038634_2947_3417	152
513	3300044712	Ga0453684_0174894	Ga0453684_0174894_380_862	152
514	3300045051	Ga0451576_0066171	Ga0451576_0066171_2553_3023	152
515	3300045051	Ga0451576_0096371	Ga0451576_0096371_144_641	152
516	3300045051	Ga0451576_0114163	Ga0451576_0114163_957_1448	152
517	3300045051	Ga0451576_0125299	Ga0451576_0125299_1188_1679	152
518	3300045051	Ga0451576_0900875	Ga0451576_0900875_359_841	152
519	3300045051	Ga0451576_1341688	Ga0451576_1341688_191_661	152
520	3300046472	Ga0495580_0151758	Ga0495580_0151758_939_1430	152
521	3300046472	Ga0495580_0374154	Ga0495580_0374154_204_695	152
522	3300046472	Ga0495580_0384467	Ga0495580_0384467_112_600	152
523	3300046491	Ga0495584_0625521	Ga0495584_0625521_24_488	152
524	3300046523	Ga0495644_0382009	Ga0495644_0382009_25_498	152
525	3300046615	Ga0495656_0014319	Ga0495656_0014319_1230_1703	152
526	3300046691	Ga0495670_0109995	Ga0495670_0109995_282_755	152
527	3300048905	Ga0496102_0026905	Ga0496102_0026905_3063_3560	152
528	3300048905	Ga0496102_0730685	Ga0496102_0730685_369_833	152
529	3300048911	Ga0496108_1339091	Ga0496108_1339091_62_562	152
530	3300048913	Ga0496110_0102949	Ga0496110_0102949_24_494	152
531	3300048915	Ga0496112_0175045	Ga0496112_0175045_311_802	152
532	3300048916	Ga0496113_0282706	Ga0496113_0282706_51_542	152
533	3300049568	Ga0501031_0012184	Ga0501031_0012184_4553_5017	152
534	3300049570	Ga0501033_0124867	Ga0501033_0124867_177_641	152
535	3300049570	Ga0501033_0517715	Ga0501033_0517715_202_693	152
536	3300049572	Ga0501036_0008896	Ga0501036_0008896_4706_5170	152
537	3300049572	Ga0501036_0104972	Ga0501036_0104972_1384_1848	152
538	3300049572	Ga0501036_0235394	Ga0501036_0235394_246_737	152
539	3300049573	Ga0501037_0075570	Ga0501037_0075570_388_852	152
540	3300049574	Ga0501038_0001796	Ga0501038_0001796_2183_2647	152
541	3300049574	Ga0501038_0043836	Ga0501038_0043836_2083_2574	152
542	3300049574	Ga0501038_0049933	Ga0501038_0049933_708_1172	152
543	3300049574	Ga0501038_0900361	Ga0501038_0900361_104_568	152
544	3300049575	Ga0501039_0013429	Ga0501039_0013429_5655_6119	152
545	3300049575	Ga0501039_0021986	Ga0501039_0021986_2664_3155	152
546	3300049575	Ga0501039_0276834	Ga0501039_0276834_713_1195	152
547	3300049575	Ga0501039_0486173	Ga0501039_0486173_346_810	152
548	3300049576	Ga0501040_0000420	Ga0501040_0000420_9732_10196	152
549	3300049576	Ga0501040_0006432	Ga0501040_0006432_1015_1506	152
550	3300049576	Ga0501040_0010993	Ga0501040_0010993_1902_2384	152
551	3300049576	Ga0501040_0085647	Ga0501040_0085647_1518_1988	152
552	3300049576	Ga0501040_0187366	Ga0501040_0187366_759_1223	152
553	3300049576	Ga0501040_0296410	Ga0501040_0296410_33_497	152
554	3300049576	Ga0501040_0647126	Ga0501040_0647126_17_481	152
555	3300049577	Ga0501041_0000886	Ga0501041_0000886_9887_10351	152
556	3300049577	Ga0501041_0020627	Ga0501041_0020627_2426_2917	152
557	3300049577	Ga0501041_0283520	Ga0501041_0283520_10_474	152
558	3300049578	Ga0501042_0002076	Ga0501042_0002076_3098_3562	152
559	3300049578	Ga0501042_0005062	Ga0501042_0005062_4729_5193	152
560	3300049578	Ga0501042_0261915	Ga0501042_0261915_452_916	152
561	3300049579	Ga0501043_0098011	Ga0501043_0098011_1344_1808	152
562	3300049580	Ga0501046_0000473	Ga0501046_0000473_20309_20800	152
563	3300049580	Ga0501046_0007190	Ga0501046_0007190_1343_1807	152
564	3300049580	Ga0501046_0008982	Ga0501046_0008982_319_783	152
565	3300049580	Ga0501046_0141385	Ga0501046_0141385_214_678	152
566	3300049580	Ga0501046_0196598	Ga0501046_0196598_857_1339	152
567	3300049580	Ga0501046_0925727	Ga0501046_0925727_35_499	152
568	3300049581	Ga0501047_0261205	Ga0501047_0261205_150_641	152
569	3300049582	Ga0501048_0000622	Ga0501048_0000622_10819_11283	152
570	3300049582	Ga0501048_0005628	Ga0501048_0005628_7809_8300	152
571	3300049582	Ga0501048_0748012	Ga0501048_0748012_61_531	152
572	3300049582	Ga0501048_1121584	Ga0501048_1121584_29_493	152
573	3300049584	Ga0501068_0008572	Ga0501068_0008572_3461_3925	152
574	3300049584	Ga0501068_0034595	Ga0501068_0034595_2474_2938	152
575	3300049584	Ga0501068_0184498	Ga0501068_0184498_341_805	152
576	3300049584	Ga0501068_0198802	Ga0501068_0198802_714_1205	152
577	3300049586	Ga0501070_0057396	Ga0501070_0057396_288_752	152
578	3300049587	Ga0501071_0032787	Ga0501071_0032787_2998_3462	152
579	3300049587	Ga0501071_0088116	Ga0501071_0088116_1520_1984	152
580	3300049587	Ga0501071_0326873	Ga0501071_0326873_659_1150	152
581	3300049587	Ga0501071_0602041	Ga0501071_0602041_302_772	152
582	3300049587	Ga0501071_1153078	Ga0501071_1153078_62_526	152
583	3300049588	Ga0501072_0000926	Ga0501072_0000926_10850_11314	152
584	3300049588	Ga0501072_0034449	Ga0501072_0034449_501_965	152
585	3300049588	Ga0501072_0063742	Ga0501072_0063742_571_1062	152
586	3300049589	Ga0501073_0049077	Ga0501073_0049077_1536_2000	152
587	3300049590	Ga0501074_0060278	Ga0501074_0060278_2185_2649	152
588	3300049590	Ga0501074_0060510	Ga0501074_0060510_192_656	152
589	3300049591	Ga0501075_0000087	Ga0501075_0000087_930_1394	152
590	3300049591	Ga0501075_0000677	Ga0501075_0000677_15630_16094	152
591	3300049591	Ga0501075_0004122	Ga0501075_0004122_5099_5581	152
592	3300049591	Ga0501075_0020850	Ga0501075_0020850_581_1072	152
593	3300049591	Ga0501075_0373483	Ga0501075_0373483_514_978	152
594	3300049592	Ga0501076_0000193	Ga0501076_0000193_28056_28520	152
595	3300049592	Ga0501076_0009906	Ga0501076_0009906_6352_6816	152
596	3300049592	Ga0501076_0036309	Ga0501076_0036309_1309_1791	152
597	3300049592	Ga0501076_0137459	Ga0501076_0137459_1115_1579	152
598	3300049592	Ga0501076_0200001	Ga0501076_0200001_857_1348	152
599	3300049592	Ga0501076_0540095	Ga0501076_0540095_286_750	152
600	3300049593	Ga0501077_0006722	Ga0501077_0006722_6116_6580	152
601	3300049593	Ga0501077_0303357	Ga0501077_0303357_66_530	152
602	3300049741	Ga0501079_0000497	Ga0501079_0000497_23146_23637	152
603	3300049741	Ga0501079_0001735	Ga0501079_0001735_8560_9024	152
604	3300049741	Ga0501079_0020696	Ga0501079_0020696_3297_3761	152
605	3300049741	Ga0501079_0182255	Ga0501079_0182255_833_1318	152
606	3300049741	Ga0501079_0374457	Ga0501079_0374457_553_1017	152
607	3300049742	Ga0501080_0003015	Ga0501080_0003015_5360_5824	152
608	3300049742	Ga0501080_0023228	Ga0501080_0023228_4443_4907	152
609	3300049742	Ga0501080_0111564	Ga0501080_0111564_443_934	152
610	3300049743	Ga0501081_0001928	Ga0501081_0001928_10050_10514	152
611	3300049743	Ga0501081_0003788	Ga0501081_0003788_1945_2409	152
612	3300049743	Ga0501081_0006164	Ga0501081_0006164_6017_6508	152
613	3300049743	Ga0501081_0066435	Ga0501081_0066435_52_597	152
614	3300049743	Ga0501081_0090660	Ga0501081_0090660_704_1168	152
615	3300049743	Ga0501081_0426792	Ga0501081_0426792_167_631	152
616	3300049743	Ga0501081_0451229	Ga0501081_0451229_199_663	152
617	3300049744	Ga0501083_0016300	Ga0501083_0016300_2838_3329	152
618	3300049744	Ga0501083_0040777	Ga0501083_0040777_1918_2382	152
619	3300049744	Ga0501083_0107053	Ga0501083_0107053_966_1430	152
620	3300049744	Ga0501083_0153121	Ga0501083_0153121_548_1012	152
621	3300049822	Ga0501035_0054196	Ga0501035_0054196_265_729	152
622	3300049822	Ga0501035_0059303	Ga0501035_0059303_1387_1851	152
623	3300049824	Ga0501045_0001532	Ga0501045_0001532_14051_14542	152
624	3300049824	Ga0501045_0002276	Ga0501045_0002276_2783_3247	152
625	3300049824	Ga0501045_0012658	Ga0501045_0012658_751_1215	152
626	3300049824	Ga0501045_0107172	Ga0501045_0107172_529_993	152
627	3300049824	Ga0501045_0208962	Ga0501045_0208962_579_1061	152
628	3300050507	nmdc:mga05p37_102397_c1	nmdc:mga05p37_102397_c1_1003_1482	152
629	3300050507	nmdc:mga05p37_1316_c1	nmdc:mga05p37_1316_c1_1726_2184	152
630	3300050507	nmdc:mga05p37_164514_c1	nmdc:mga05p37_164514_c1_625_1101	152
631	3300050507	nmdc:mga05p37_1819_c1	nmdc:mga05p37_1819_c1_21333_21791	152
632	3300050507	nmdc:mga05p37_23131_c1	nmdc:mga05p37_23131_c1_1870_2334	152
633	3300050507	nmdc:mga05p37_500540_c1	nmdc:mga05p37_500540_c1_864_1322	152
634	3300050507	nmdc:mga05p37_527135_c1	nmdc:mga05p37_527135_c1_693_1184	152
635	3300050507	nmdc:mga05p37_66315_c1	nmdc:mga05p37_66315_c1_2204_2695	152
636	3300050508	nmdc:mga09592_24940_c1	nmdc:mga09592_24940_c1_3809_4279	152
637	3300050508	nmdc:mga09592_29705_c1	nmdc:mga09592_29705_c1_2212_2670	152
638	3300050508	nmdc:mga09592_57406_c1	nmdc:mga09592_57406_c1_2783_3241	152
639	3300050508	nmdc:mga09592_626200_c1	nmdc:mga09592_626200_c1_161_619	152
640	3300050509	nmdc:mga0qj67_122321_c1	nmdc:mga0qj67_122321_c1_127_594	152
641	3300050509	nmdc:mga0qj67_179132_c1	nmdc:mga0qj67_179132_c1_504_971	152
642	3300050509	nmdc:mga0qj67_407085_c1	nmdc:mga0qj67_407085_c1_335_805	152
643	3300050510	nmdc:mga06r32_17589_c1	nmdc:mga06r32_17589_c1_4334_4801	152
644	3300050510	nmdc:mga06r32_187376_c1	nmdc:mga06r32_187376_c1_73_543	152
645	3300050510	nmdc:mga06r32_29520_c1	nmdc:mga06r32_29520_c1_2959_3417	152
646	3300050510	nmdc:mga06r32_319_c1	nmdc:mga06r32_319_c1_9851_10318	152
647	3300050510	nmdc:mga06r32_401856_c1	nmdc:mga06r32_401856_c1_160_651	152
648	3300050510	nmdc:mga06r32_83198_c1	nmdc:mga06r32_83198_c1_1009_1467	152
649	3300050511	nmdc:mga08y16_186406_c1	nmdc:mga08y16_186406_c1_334_804	152
650	3300050511	nmdc:mga08y16_467477_c1	nmdc:mga08y16_467477_c1_782_1246	152
651	3300050511	nmdc:mga08y16_7089_c1	nmdc:mga08y16_7089_c1_1668_2141	152
652	3300050511	nmdc:mga08y16_73523_c1	nmdc:mga08y16_73523_c1_804_1274	152
653	3300050512	nmdc:mga0n895_1185_c1	nmdc:mga0n895_1185_c1_897_1355	152
654	3300050512	nmdc:mga0n895_125500_c1	nmdc:mga0n895_125500_c1_23_493	152
655	3300050512	nmdc:mga0n895_179618_c1	nmdc:mga0n895_179618_c1_931_1401	152
656	3300050512	nmdc:mga0n895_397499_c1	nmdc:mga0n895_397499_c1_119_610	152
657	3300050512	nmdc:mga0n895_44133_c1	nmdc:mga0n895_44133_c1_2374_2865	152
658	3300050512	nmdc:mga0n895_85163_c1	nmdc:mga0n895_85163_c1_2384_2854	152
659	3300050513	nmdc:mga0rr50_233755_c1	nmdc:mga0rr50_233755_c1_199_690	152
660	3300050513	nmdc:mga0rr50_401138_c1	nmdc:mga0rr50_401138_c1_507_977	152
661	3300050513	nmdc:mga0rr50_681454_c1	nmdc:mga0rr50_681454_c1_156_623	152
662	3300050513	nmdc:mga0rr50_7254_c1	nmdc:mga0rr50_7254_c1_897_1355	152
663	3300050514	nmdc:mga08x19_278972_c1	nmdc:mga08x19_278972_c1_274_765	152
664	3300050514	nmdc:mga08x19_3445_c1	nmdc:mga08x19_3445_c1_897_1355	152
665	3300050515	nmdc:mga0a205_10742_c1	nmdc:mga0a205_10742_c1_894_1385	152
666	3300050515	nmdc:mga0a205_170014_c1	nmdc:mga0a205_170014_c1_582_1052	152
667	3300050515	nmdc:mga0a205_17213_c1	nmdc:mga0a205_17213_c1_1244_1702	152
668	3300050515	nmdc:mga0a205_353192_c1	nmdc:mga0a205_353192_c1_807_1277	152
669	3300050515	nmdc:mga0a205_411_c1	nmdc:mga0a205_411_c1_4656_5126	152
670	3300050515	nmdc:mga0a205_4561_c1	nmdc:mga0a205_4561_c1_8127_8597	152
671	3300054114	Ga0501084_0008118	Ga0501084_0008118_5991_6455	152
672	3300054114	Ga0501084_0026529	Ga0501084_0026529_3399_3863	152
673	3300054114	Ga0501084_0119339	Ga0501084_0119339_672_1157	152
674	3300054114	Ga0501084_0460534	Ga0501084_0460534_321_785	152
675	3300054114	Ga0501084_0625286	Ga0501084_0625286_53_517	152
676	3300054114	Ga0501084_0833198	Ga0501084_0833198_225_695	152
677	3300054114	Ga0501084_1125884	Ga0501084_1125884_140_604	152
678	3300060353	Ga0501082_0000407	Ga0501082_0000407_18833_19324	152
679	3300060353	Ga0501082_0005681	Ga0501082_0005681_792_1256	152
680	3300060353	Ga0501082_0099703	Ga0501082_0099703_1876_2358	152
681	3300060353	Ga0501082_0234637	Ga0501082_0234637_966_1430	152
682	3300060353	Ga0501082_0300790	Ga0501082_0300790_547_1011	152
683	3300060353	Ga0501082_0645598	Ga0501082_0645598_356_841	152
684	3300061734	Ga0530510_0000015	Ga0530510_0000015_7732_8196	152
685	3300061734	Ga0530510_0002671	Ga0530510_0002671_8690_9154	152
686	3300061734	Ga0530510_0025974	Ga0530510_0025974_3063_3527	152
687	3300061734	Ga0530510_0159867	Ga0530510_0159867_362_883	152
688	3300061734	Ga0530510_0177768	Ga0530510_0177768_912_1376	152
689	3300061734	Ga0530510_0338535	Ga0530510_0338535_153_617	152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

126

0.9 PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

12

50

0.85 PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

111

0.83 PF18029

Glyoxalase_6

Glyoxalase-like domain

15

127

0.73 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5vb0-assembly6.cif.gz_H	crystal structure of fosfomycin resistance protein fosa3	0.7996	7	128
3e5d-assembly1.cif.gz_A-2	crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution	0.7926	8	126
3kol-assembly1.cif.gz_A-2	crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme	0.7925	8	128
2rk0-assembly1.cif.gz_A	crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec	0.7849	7	128
2rk0-assembly1.cif.gz_B	crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec	0.7744	7	128

ID	Description	Score	Start	End	Superfamily
af_Q2FVA5_9_134_3.10.180.10	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8571	8	130	3.10.180.10
af_Q2FZ81_10_141_3.10.180.10	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.842	13	128	3.10.180.10
2kjzB01	Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;	0.8246	14	61	3.30.720.120
af_Q2FVA5_9_134_3.10.180.10	Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1	0.8196	8	130	3.10.180.10
3vcxB01	Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1;	0.8002	11	59	3.30.720.120

ID	Description	Score	Start	End
AF-A0A3L7XDZ1-F1-model_v4	VOC family protein	0.9029	25	152
AF-A0A2V7BPR2-F1-model_v4	Glyoxalase	0.8996	3	148
AF-A0A536CZM3-F1-model_v4	VOC family protein	0.896	15	149
AF-A0A3N0CHI0-F1-model_v4	VOC family protein	0.8944	12	149
AF-A0A2V6TSN3-F1-model_v4	Glyoxalase	0.8939	2	152

Feature Viewer

pLDDT	pTM	Quality
92.29	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F475386

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

126

0.9

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

12

50

0.85

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

111

0.83

PF18029

Glyoxalase_6

Glyoxalase-like domain

15

127

0.73

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map