F475326

General Info

Members Datasets Scaffolds Average Seq Length
688 384 1376 315

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10023306|Ga0213875_100233062
Length 369
Sequence MAISFLHIGADFPRWRKASYQASYRRGARARILRRIGLNLDRLIGLMVRMMNWLEEMRRGWRGISRPPVLLGVGFALLCLALATLARWSLALIRPDVFFTPYIPAVFFATAVGGAQIGILTALLGGALGVGVNFGASSADFARIALLLIFWGVSGLTIWGIEHYRSIAAQQRQIAKRLIEEEAYRRLVVDELQHRLKNKLSVIHAVLHQVLDKEPQIWSSVDHRLRALAATDDLIARVDGSGCDIRDLLLSELGPYGHVRFNLNGEPLFLPAKLAVSLALIFHELATNAAKYGAFSSARGLLQVSWTLSDDRLNVIWDETEGPAVEQVGAAGFGTKLLKSALAPFDGKTEISFLKSGVHCTMQCRVPKS

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
321 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
322 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
323 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
324 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
325 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
328 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
329 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
330 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
331 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
334 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
338 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
339 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
340 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
341 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
342 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
343 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
344 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
345 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
346 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
347 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
348 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
349 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
350 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
351 2791355199
352 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
353 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
354 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
355 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
356 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
357 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
358 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
359 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
360 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
361 2904699407
362 2906610324
363 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
364 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
365 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
366 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
367 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
368 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
369 2922425934
370 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
371 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
372 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
373 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
374 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
375 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
376 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
377 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
378 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
379 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
380 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
381 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
382 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
383 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
384 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.57
Metatranscriptomes 0
Isolates 6.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 5.96
Rhizoplane 6.4
Rhizosphere 74.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10023306 3300021388 Bacteria 2957
2 JGI24737J22298_10003097 3300001990 Bacteria 5890
3 JGI25406J46586_10000032 3300003203 Bacteria 67745
4 rootH1_10116502 3300003323 Bacteria 3132
5 Ga0070683_100012751 3300005329 Bacteria 7310
6 Ga0070690_100142169 3300005330 Bacteria 1630
7 Ga0068869_100046168 3300005334 Bacteria 3140
8 Ga0068869_100248787 3300005334 Bacteria 1419
9 Ga0070666_10209168 3300005335 Bacteria 1374
10 Ga0070680_100037022 3300005336 Bacteria 3943
11 Ga0068868_100015963 3300005338 Bacteria 5568
12 Ga0068868_100416455 3300005338 Bacteria 1162
13 Ga0070660_100055048 3300005339 Bacteria 3074
14 Ga0070668_100082201 3300005347 Bacteria 2526
15 Ga0070668_100332547 3300005347 Bacteria 1282
16 Ga0070675_100313263 3300005354 Bacteria 1385
17 Ga0070671_100178989 3300005355 Bacteria 1795
18 Ga0070671_100321864 3300005355 Bacteria 1318
19 Ga0070674_100042698 3300005356 Bacteria 3081
20 Ga0070674_100057958 3300005356 Bacteria 2691
21 Ga0070673_100088823 3300005364 Bacteria 2521
22 Ga0070673_100089621 3300005364 Bacteria 2511
23 Ga0070667_100276654 3300005367 Bacteria 1506
24 Ga0070709_10003755 3300005434 Bacteria 8164
25 Ga0070709_10012141 3300005434 Bacteria 4816
26 Ga0070709_10017155 3300005434 Bacteria 4146
27 Ga0070714_100085332 3300005435 Bacteria 2757
28 Ga0070714_100287201 3300005435 Bacteria 1530
29 Ga0070713_100003608 3300005436 Bacteria 10231
30 Ga0070713_100004146 3300005436 Bacteria 9667
31 Ga0070713_100008416 3300005436 Bacteria 7314
32 Ga0070713_100113587 3300005436 Bacteria 2365
33 Ga0070713_100153895 3300005436 Bacteria 2048
34 Ga0070713_100222649 3300005436 Bacteria 1712
35 Ga0070710_10000198 3300005437 Bacteria 28155
36 Ga0070710_10014070 3300005437 Bacteria 4019
37 Ga0070710_10019547 3300005437 Bacteria 3502
38 Ga0070711_100001684 3300005439 Bacteria 12245
39 Ga0070711_100001849 3300005439 Bacteria 11815
40 Ga0070711_100014053 3300005439 Bacteria 5037
41 Ga0070711_100057094 3300005439 Bacteria 2702
42 Ga0070711_100100028 3300005439 Bacteria 2108
43 Ga0070705_100076091 3300005440 Bacteria 2046
44 Ga0070700_100025142 3300005441 Bacteria 3505
45 Ga0070708_100083402 3300005445 Bacteria 2898
46 Ga0070663_100031232 3300005455 Bacteria 3659
47 Ga0070663_100059248 3300005455 Bacteria 2752
48 Ga0070663_100172150 3300005455 Bacteria 1674
49 Ga0070678_100112754 3300005456 Bacteria 2130
50 Ga0070678_100251685 3300005456 Bacteria 1482
51 Ga0070662_100103378 3300005457 Bacteria 2160
52 Ga0070662_100185690 3300005457 Bacteria 1641
53 Ga0070681_10016905 3300005458 Bacteria 7288
54 Ga0070681_10058339 3300005458 Bacteria 3840
55 Ga0070681_10265828 3300005458 Bacteria 1627
56 Ga0070681_10312847 3300005458 Bacteria 1480
57 Ga0070706_100074250 3300005467 Bacteria 3148
58 Ga0070707_100123166 3300005468 Bacteria 2518
59 Ga0070679_100001793 3300005530 Bacteria 19369
60 Ga0070679_100018577 3300005530 Bacteria 6749
61 Ga0070679_100061672 3300005530 Bacteria 3738
62 Ga0070679_100108075 3300005530 Bacteria 2767
63 Ga0070679_100336697 3300005530 Bacteria 1457
64 Ga0070684_100016437 3300005535 Bacteria 6049
65 Ga0070684_100023053 3300005535 Bacteria 5199
66 Ga0070697_100020228 3300005536 Bacteria 5264
67 Ga0070697_100128354 3300005536 Bacteria 2125
68 Ga0068853_100007166 3300005539 Bacteria 8924
69 Ga0068853_100472764 3300005539 Bacteria 1181
70 Ga0070696_100039781 3300005546 Bacteria 3247
71 Ga0070693_100008186 3300005547 Bacteria 5137
72 Ga0070665_100027843 3300005548 Bacteria 5691
73 Ga0070665_100069458 3300005548 Bacteria 3530
74 Ga0070665_100120248 3300005548 Bacteria 2628
75 Ga0070665_100139603 3300005548 Bacteria 2427
76 Ga0070665_100197715 3300005548 Bacteria 2011
77 Ga0070665_100235584 3300005548 Bacteria 1831
78 Ga0070665_100659298 3300005548 Bacteria 1059
79 Ga0068855_100015676 3300005563 Bacteria 9119
80 Ga0068855_100113086 3300005563 Bacteria 3115
81 Ga0068855_100486494 3300005563 Bacteria 1343
82 Ga0068855_100497881 3300005563 Bacteria 1324
83 Ga0070664_100310563 3300005564 Bacteria 1427
84 Ga0068857_100003229 3300005577 Bacteria 13531
85 Ga0068857_100091355 3300005577 Bacteria 2725
86 Ga0068854_100002577 3300005578 Bacteria 11228
87 Ga0068854_100183183 3300005578 Bacteria 1637
88 Ga0068856_100000013 3300005614 Bacteria 165611
89 Ga0068856_100002736 3300005614 Bacteria 18053
90 Ga0068856_100172459 3300005614 Bacteria 2175
91 Ga0068856_100207448 3300005614 Bacteria 1974
92 Ga0068856_100405363 3300005614 Bacteria 1383
93 Ga0070702_100029671 3300005615 Bacteria 2977
94 Ga0068852_100092237 3300005616 Bacteria 2712
95 Ga0068852_100164108 3300005616 Bacteria 2077
96 Ga0068864_100356395 3300005618 Bacteria 1381
97 Ga0068870_10073763 3300005840 Bacteria 1867
98 Ga0068863_100290484 3300005841 Bacteria 1585
99 Ga0068858_100035398 3300005842 Bacteria 4631
100 Ga0068858_100086981 3300005842 Bacteria 2907
101 Ga0068860_100132419 3300005843 Bacteria 2393
102 Ga0068860_100154198 3300005843 Bacteria 2213
103 Ga0068860_100157299 3300005843 Bacteria 2190
104 Ga0068860_100332479 3300005843 Bacteria 1493
105 Ga0068862_100060586 3300005844 Bacteria 3251
106 Ga0068862_100181448 3300005844 Bacteria 1889
107 Ga0081455_10002765 3300005937 Bacteria 20709
108 Ga0081540_1006425 3300005983 Bacteria 8556
109 Ga0081540_1021267 3300005983 Bacteria 3871
110 Ga0081540_1029946 3300005983 Bacteria 3022
111 Ga0081539_10000129 3300005985 Bacteria 178675
112 Ga0070717_10001210 3300006028 Bacteria 17508
113 Ga0070717_10001984 3300006028 Bacteria 14308
114 Ga0070717_10024589 3300006028 Bacteria 4785
115 Ga0070717_10219151 3300006028 Bacteria 1672
116 Ga0070717_10308931 3300006028 Bacteria 1407
117 Ga0075365_10019498 3300006038 Bacteria 4188
118 Ga0075365_10026949 3300006038 Bacteria 3652
119 Ga0075365_10141402 3300006038 Bacteria 1670
120 Ga0075368_10050948 3300006042 Bacteria 1645
121 Ga0070715_10002598 3300006163 Bacteria 5580
122 Ga0070715_10083791 3300006163 Bacteria 1453
123 Ga0070716_100005147 3300006173 Bacteria 6320
124 Ga0070712_100009081 3300006175 Bacteria 6260
125 Ga0070712_100044891 3300006175 Bacteria 3049
126 Ga0070712_100066187 3300006175 Bacteria 2567
127 Ga0070712_100123927 3300006175 Bacteria 1949
128 Ga0070712_100319227 3300006175 Bacteria 1263
129 Ga0075367_10011323 3300006178 Bacteria 4715
130 Ga0075367_10070993 3300006178 Bacteria 2094
131 Ga0075366_10074270 3300006195 Bacteria 2027
132 Ga0075366_10223435 3300006195 Bacteria 1147
133 Ga0097621_100326248 3300006237 Bacteria 1361
134 Ga0075370_10011166 3300006353 Bacteria 4714
135 Ga0075370_10037651 3300006353 Bacteria 2720
136 Ga0075434_100013288 3300006871 Bacteria 7828
137 Ga0075429_100251702 3300006880 Bacteria 1547
138 Ga0068865_100034186 3300006881 Bacteria 3410
139 Ga0068865_100125027 3300006881 Bacteria 1918
140 Ga0099825_1038138 3300006941 Bacteria 1547
141 Ga0099824_1024628 3300006942 Bacteria 3472
142 Ga0099822_1006545 3300006943 Bacteria 15162
143 Ga0075435_100091673 3300007076 Bacteria 2508
144 Ga0099794_10000582 3300007265 Bacteria 12231
145 Ga0099794_10006939 3300007265 Bacteria 4619
146 Ga0099794_10080167 3300007265 Bacteria 1609
147 Ga0099795_10027346 3300007788 Bacteria 1929
148 Ga0099795_10061886 3300007788 Bacteria 1391
149 Ga0099795_10062422 3300007788 Bacteria 1386
150 Ga0105240_10006672 3300009093 Bacteria 16921
151 Ga0105240_10018175 3300009093 Bacteria 9452
152 Ga0105240_10024401 3300009093 Bacteria 7969
153 Ga0105240_10296722 3300009093 Bacteria 1850
154 Ga0111539_10044521 3300009094 Bacteria 5317
155 Ga0111539_10370207 3300009094 Bacteria 1668
156 Ga0105247_10009644 3300009101 Bacteria 5857
157 Ga0105247_10013897 3300009101 Bacteria 4828
158 Ga0105247_10150460 3300009101 Bacteria 1533
159 Ga0114129_10462319 3300009147 Bacteria 1663
160 Ga0105241_10003037 3300009174 Bacteria 12519
161 Ga0105248_10076942 3300009177 Bacteria 3750
162 Ga0105237_10011335 3300009545 Bacteria 9431
163 Ga0105237_10046628 3300009545 Bacteria 4359
164 Ga0105237_10076812 3300009545 Bacteria 3330
165 Ga0105237_10222959 3300009545 Bacteria 1886
166 Ga0105238_10014439 3300009551 Bacteria 7986
167 Ga0105238_10043350 3300009551 Bacteria 4552
168 Ga0105238_10079633 3300009551 Bacteria 3266
169 Ga0105238_10115972 3300009551 Bacteria 2658
170 Ga0105238_10398942 3300009551 Bacteria 1368
171 Ga0105249_10122227 3300009553 Bacteria 2476
172 Ga0099796_10017249 3300010159 Bacteria 2146
173 Ga0099796_10031183 3300010159 Bacteria 1736
174 Ga0105239_10016541 3300010375 Bacteria 8154
175 Ga0105239_10071844 3300010375 Bacteria 3802
176 Ga0105239_10117065 3300010375 Bacteria 2958
177 Ga0105239_10290766 3300010375 Bacteria 1840
178 Ga0105239_10362997 3300010375 Bacteria 1636
179 Ga0105239_10892881 3300010375 Bacteria 1020
180 Ga0105246_10047829 3300011119 Bacteria 2923
181 Ga0157370_10074276 3300013104 Bacteria 3207
182 Ga0157370_10128814 3300013104 Bacteria 2361
183 Ga0157369_10016160 3300013105 Bacteria 8403
184 Ga0157369_10022796 3300013105 Bacteria 6982
185 Ga0157369_10066692 3300013105 Bacteria 3871
186 Ga0157378_10000929 3300013297 Bacteria 27006
187 Ga0157378_10086109 3300013297 Bacteria 2848
188 Ga0163162_10193444 3300013306 Bacteria 2162
189 Ga0163162_10426723 3300013306 Bacteria 1458
190 Ga0157372_10127424 3300013307 Bacteria 2927
191 Ga0157372_10287866 3300013307 Bacteria 1911
192 Ga0157372_10565481 3300013307 Bacteria 1325
193 Ga0163163_10011790 3300014325 Bacteria 7946
194 Ga0163163_10141589 3300014325 Bacteria 2447
195 Ga0157376_10128164 3300014969 Bacteria 2260
196 Ga0157376_10472277 3300014969 Bacteria 1227
197 Ga0213876_10056171 3300021384 Bacteria 2078
198 Ga0213871_10015264 3300021441 Bacteria 1834
199 Ga0209677_100630 3300025253 Bacteria 18881
200 Ga0209233_1004114 3300025261 Bacteria 5014
201 Ga0209233_1005672 3300025261 Bacteria 4118
202 Ga0209455_1006016 3300025272 Bacteria 3648
203 Ga0209455_1007525 3300025272 Bacteria 3065
204 Ga0209758_1004986 3300025297 Bacteria 10607
205 Ga0207697_10097803 3300025315 Bacteria 1249
206 Ga0207656_10026731 3300025321 Bacteria 2355
207 Ga0207692_10003088 3300025898 Bacteria 6467
208 Ga0207692_10048891 3300025898 Bacteria 2131
209 Ga0207642_10047214 3300025899 Bacteria 1924
210 Ga0207642_10088702 3300025899 Bacteria 1522
211 Ga0207688_10006015 3300025901 Bacteria 6605
212 Ga0207688_10050463 3300025901 Bacteria 2329
213 Ga0207647_10001195 3300025904 Bacteria 19996
214 Ga0207699_10002538 3300025906 Bacteria 8611
215 Ga0207699_10012109 3300025906 Bacteria 4379
216 Ga0207643_10034379 3300025908 Bacteria 2840
217 Ga0207705_10311645 3300025909 Bacteria 1208
218 Ga0207684_10089954 3300025910 Bacteria 2615
219 Ga0207654_10004914 3300025911 Bacteria 6767
220 Ga0207707_10008157 3300025912 Bacteria 9086
221 Ga0207707_10090891 3300025912 Bacteria 2668
222 Ga0207707_10126764 3300025912 Bacteria 2232
223 Ga0207707_10136010 3300025912 Bacteria 2149
224 Ga0207707_10191397 3300025912 Bacteria 1785
225 Ga0207695_10016221 3300025913 Bacteria 8731
226 Ga0207695_10090041 3300025913 Bacteria 3084
227 Ga0207695_10159769 3300025913 Bacteria 2186
228 Ga0207671_10127924 3300025914 Bacteria 1948
229 Ga0207671_10128589 3300025914 Bacteria 1943
230 Ga0207671_10144286 3300025914 Bacteria 1836
231 Ga0207671_10282346 3300025914 Bacteria 1310
232 Ga0207693_10009789 3300025915 Bacteria 7803
233 Ga0207663_10002121 3300025916 Bacteria 9458
234 Ga0207663_10002432 3300025916 Bacteria 8946
235 Ga0207663_10019132 3300025916 Bacteria 3851
236 Ga0207663_10275537 3300025916 Bacteria 1248
237 Ga0207660_10020414 3300025917 Bacteria 4445
238 Ga0207660_10028759 3300025917 Bacteria 3805
239 Ga0207660_10185938 3300025917 Bacteria 1616
240 Ga0207662_10059650 3300025918 Bacteria 2287
241 Ga0207657_10217587 3300025919 Bacteria 1531
242 Ga0207649_10276178 3300025920 Bacteria 1220
243 Ga0207652_10028728 3300025921 Bacteria 4642
244 Ga0207652_10079880 3300025921 Bacteria 2858
245 Ga0207652_10095547 3300025921 Bacteria 2618
246 Ga0207646_10097630 3300025922 Bacteria 2632
247 Ga0207646_10099175 3300025922 Bacteria 2611
248 Ga0207694_10086214 3300025924 Bacteria 2472
249 Ga0207694_10247089 3300025924 Bacteria 1459
250 Ga0207694_10278115 3300025924 Bacteria 1374
251 Ga0207650_10179874 3300025925 Bacteria 1685
252 Ga0207687_10004884 3300025927 Bacteria 8909
253 Ga0207687_10138704 3300025927 Bacteria 1842
254 Ga0207700_10006018 3300025928 Bacteria 7299
255 Ga0207700_10050887 3300025928 Bacteria 3089
256 Ga0207700_10064670 3300025928 Bacteria 2787
257 Ga0207700_10082794 3300025928 Bacteria 2510
258 Ga0207700_10104463 3300025928 Bacteria 2267
259 Ga0207664_10011463 3300025929 Bacteria 6305
260 Ga0207664_10248697 3300025929 Bacteria 1551
261 Ga0207644_10134317 3300025931 Bacteria 1898
262 Ga0207706_10018833 3300025933 Bacteria 6209
263 Ga0207706_10084506 3300025933 Bacteria 2790
264 Ga0207706_10189669 3300025933 Bacteria 1805
265 Ga0207686_10230515 3300025934 Bacteria 1342
266 Ga0207709_10007974 3300025935 Bacteria 5866
267 Ga0207669_10034674 3300025937 Bacteria 2862
268 Ga0207669_10044036 3300025937 Bacteria 2618
269 Ga0207704_10300969 3300025938 Bacteria 1228
270 Ga0207665_10002662 3300025939 Bacteria 12001
271 Ga0207665_10123792 3300025939 Bacteria 1829
272 Ga0207691_10118309 3300025940 Bacteria 2350
273 Ga0207691_10196950 3300025940 Bacteria 1755
274 Ga0207711_10029690 3300025941 Bacteria 4613
275 Ga0207711_10091300 3300025941 Bacteria 2678
276 Ga0207689_10081765 3300025942 Bacteria 2655
277 Ga0207661_10000690 3300025944 Bacteria 21904
278 Ga0207661_10088246 3300025944 Bacteria 2577
279 Ga0207679_10115900 3300025945 Bacteria 2123
280 Ga0207667_10020165 3300025949 Bacteria 7422
281 Ga0207667_10043552 3300025949 Bacteria 4763
282 Ga0207667_10147916 3300025949 Bacteria 2418
283 Ga0207667_10298001 3300025949 Bacteria 1647
284 Ga0207667_10428721 3300025949 Bacteria 1345
285 Ga0207651_10069059 3300025960 Bacteria 2494
286 Ga0207668_10039139 3300025972 Bacteria 3188
287 Ga0207640_10205400 3300025981 Bacteria 1496
288 Ga0207703_10098397 3300026035 Bacteria 2474
289 Ga0207639_10014927 3300026041 Bacteria 5472
290 Ga0207639_10181132 3300026041 Bacteria 1792
291 Ga0207678_10039269 3300026067 Bacteria 4108
292 Ga0207678_10083553 3300026067 Bacteria 2731
293 Ga0207678_10108700 3300026067 Bacteria 2366
294 Ga0207678_10180336 3300026067 Bacteria 1803
295 Ga0207708_10327210 3300026075 Bacteria 1252
296 Ga0207702_10000956 3300026078 Bacteria 29726
297 Ga0207641_10097809 3300026088 Bacteria 2580
298 Ga0207648_10050191 3300026089 Bacteria 3649
299 Ga0207648_10137643 3300026089 Bacteria 2151
300 Ga0207674_10025880 3300026116 Bacteria 6246
301 Ga0207675_100315004 3300026118 Bacteria 1526
302 Ga0207683_10015524 3300026121 Bacteria 6485
303 Ga0207683_10042294 3300026121 Bacteria 3980
304 Ga0207698_10040385 3300026142 Bacteria 3466
305 Ga0209589_1000026 3300027357 Bacteria 158154
306 Ga0209489_100046 3300027361 Bacteria 158154
307 Ga0209700_100047 3300027363 Bacteria 158154
308 Ga0209588_1017881 3300027671 Bacteria 2203
309 Ga0209588_1021195 3300027671 Bacteria 2039
310 Ga0207428_10185767 3300027907 Bacteria 1568
311 Ga0268266_10002269 3300028379 Bacteria 20890
312 Ga0268266_10032706 3300028379 Bacteria 4419
313 Ga0268266_10151833 3300028379 Bacteria 2088
314 Ga0268266_10329402 3300028379 Bacteria 1431
315 Ga0268265_10098834 3300028380 Bacteria 2351
316 Ga0268265_10243154 3300028380 Bacteria 1589
317 Ga0268265_10305813 3300028380 Bacteria 1433
318 Ga0268264_10203790 3300028381 Bacteria 1811
319 Ga0265326_10014688 3300028558 Bacteria 2280
320 Ga0265319_1002170 3300028563 Bacteria 10951
321 Ga0265334_10001238 3300028573 Bacteria 12472
322 Ga0265318_10005790 3300028577 Bacteria 5765
323 Ga0265323_10003793 3300028653 Bacteria 6588
324 Ga0265336_10000210 3300028666 Bacteria 41018
325 Ga0307517_10000495 3300028786 Bacteria 67515
326 Ga0307517_10192396 3300028786 Bacteria 1292
327 Ga0307515_10032002 3300028794 Bacteria 8735
328 Ga0265338_10000256 3300028800 Bacteria 97079
329 Ga0265324_10001141 3300029957 Bacteria 15882
330 Ga0265330_10017367 3300031235 Bacteria 3314
331 Ga0265340_10005577 3300031247 Bacteria 6979
332 Ga0265331_10046131 3300031250 Bacteria 2102
333 Ga0307513_10364337 3300031456 Bacteria 1189
334 Ga0307508_10049370 3300031616 Bacteria 3748
335 Ga0265342_10035135 3300031712 Bacteria 3070
336 Ga0307516_10006269 3300031730 Bacteria 13981
337 Ga0307516_10015885 3300031730 Bacteria 7900
338 Ga0307413_10046955 3300031824 Bacteria 2572
339 Ga0307416_100304414 3300032002 Bacteria 1586
340 Ga0307415_100072814 3300032126 Bacteria 2421
341 Ga0307415_100114210 3300032126 Bacteria 2010
342 Ga0307510_10145352 3300033180 Bacteria 2005
343 Ga0315911_1000019 3300033442 Bacteria 146597
344 Ga0373926_0011906 3300035083 Bacteria 2935
345 Ga0373929_0017804 3300035085 Bacteria 1406
346 Ga0373934_0005190 3300035086 Bacteria 4819
347 Ga0373944_0009036 3300035089 Bacteria 2695
348 Ga0373923_0003136 3300035111 Bacteria 5254
349 Ga0373923_0023229 3300035111 Bacteria 2438
350 Ga0373936_0013878 3300035113 Bacteria 3076
351 Ga0373936_0044334 3300035113 Bacteria 1789
352 Ga0373936_0107359 3300035113 Bacteria 1183
353 Ga0373945_0010799 3300035116 Bacteria 3010
354 Ga0373953_0003128 3300035117 Bacteria 5107
355 Ga0373953_0012842 3300035117 Bacteria 2975
356 Ga0373954_0000258 3300035118 Bacteria 19123
357 Ga0373954_0011470 3300035118 Bacteria 3928
358 Ga0373954_0015999 3300035118 Bacteria 3354
359 Ga0373954_0024185 3300035118 Bacteria 2768
360 Ga0373956_0040647 3300035119 Bacteria 2063
361 Ga0373957_0001886 3300035120 Bacteria 5825
362 Ga0373957_0026876 3300035120 Bacteria 2086
363 Ga0373943_0010350 3300035170 Bacteria 4183
364 Ga0373943_0011486 3300035170 Bacteria 3985
365 Ga0373946_0028092 3300035171 Bacteria 2229
366 Ga0373955_0007855 3300035172 Bacteria 4921
367 Ga0373955_0030377 3300035172 Bacteria 2820
368 Ga0373924_0015461 3300035410 Bacteria 2902
369 Ga0373931_0001558 3300035691 Bacteria 9898
370 Ga0373931_0071627 3300035691 Bacteria 1894
371 Ga0373935_0000529 3300035692 Bacteria 19900
372 Ga0373935_0030440 3300035692 Bacteria 3346
373 Ga0373927_0002202 3300035695 Bacteria 14324
374 Ga0373927_0004897 3300035695 Bacteria 9306
375 Ga0373927_0024658 3300035695 Bacteria 3931
376 Ga0373927_0064011 3300035695 Bacteria 2379
377 Ga0373933_0017670 3300035724 Bacteria 4000
378 Ga0373933_0032044 3300035724 Bacteria 3053
379 Ga0373947_0000648 3300035725 Bacteria 20618
380 Ga0373947_0009913 3300035725 Bacteria 5472
381 Ga0373947_0022469 3300035725 Bacteria 3659
382 Ga0373947_0032129 3300035725 Bacteria 3092
383 Ga0373937_0042460 3300036401 Bacteria 4149
384 Ga0373937_0122476 3300036401 Bacteria 2424
385 Ga0373937_0260697 3300036401 Bacteria 1635
386 Ga0373925_0001217 3300037068 Bacteria 22723
387 Ga0373925_0023023 3300037068 Bacteria 4546
388 Ga0373925_0378230 3300037068 Bacteria 1153
389 Ga0395900_0009632 3300037418 Bacteria 9909
390 Ga0395900_0080040 3300037418 Bacteria 3358
391 Ga0395898_0008781 3300037466 Bacteria 10649
392 Ga0395898_0017426 3300037466 Bacteria 7336
393 Ga0395898_0099845 3300037466 Bacteria 2788
394 Ga0395898_0113074 3300037466 Bacteria 2602
395 Ga0395905_0195333 3300037471 Bacteria 1897
396 Ga0436364_0476705 3300037853 Bacteria 2902
397 Ga0436364_1013981 3300037853 Bacteria 4267
398 Ga0436364_1139280 3300037853 Bacteria 2115
399 Ga0395901_0117861 3300038443 Bacteria 2790
400 Ga0395901_0140933 3300038443 Bacteria 2534
401 Ga0436365_0265507 3300039437 Bacteria 1329
402 Ga0436365_0571458 3300039437 Bacteria 6945
403 Ga0436365_1575266 3300039437 Bacteria 2238
404 Ga0436360_0226792 3300039438 Bacteria 2622
405 Ga0436360_1217406 3300039438 Bacteria 1557
406 Ga0436361_0625924 3300039447 Bacteria 1355
407 Ga0436361_0867016 3300039447 Bacteria 5365
408 Ga0436363_0002993 3300039450 Bacteria 3528
409 Ga0436363_0193931 3300039450 Bacteria 3091
410 Ga0436362_0574087 3300039453 Bacteria 4264
411 Ga0439465_0036899 3300041413 Bacteria 1571
412 Ga0466969_0071075 3300044656 Bacteria 1674
413 Ga0466969_0071465 3300044656 Bacteria 1668
414 Ga0466963_0101876 3300044694 Bacteria 1966
415 Ga0466959_0019326 3300045049 Bacteria 5010
416 Ga0466967_0074681 3300045976 Bacteria 3045
417 Ga0466967_0188415 3300045976 Bacteria 1949
418 Ga0466967_0352073 3300045976 Bacteria 1426
419 Ga0495592_0009928 3300046454 Bacteria 7167
420 Ga0495592_0015555 3300046454 Bacteria 5772
421 Ga0495592_0136009 3300046454 Bacteria 1714
422 Ga0495603_0000072 3300046455 Bacteria 44178
423 Ga0495603_0007998 3300046455 Bacteria 6383
424 Ga0495603_0071176 3300046455 Bacteria 2044
425 Ga0495629_0000255 3300046459 Bacteria 46524
426 Ga0495629_0000932 3300046459 Bacteria 23548
427 Ga0495629_0216143 3300046459 Bacteria 1323
428 Ga0495651_0043966 3300046462 Bacteria 3463
429 Ga0495651_0069159 3300046462 Bacteria 2689
430 Ga0495653_0001885 3300046463 Bacteria 16548
431 Ga0495580_0021004 3300046472 Bacteria 4821
432 Ga0495580_0088557 3300046472 Bacteria 2156
433 Ga0495582_0000057 3300046473 Bacteria 57066
434 Ga0495639_0000025 3300046475 Bacteria 68702
435 Ga0495639_0025185 3300046475 Bacteria 2623
436 Ga0495662_0000301 3300046476 Bacteria 21448
437 Ga0495662_0041944 3300046476 Bacteria 2209
438 Ga0495664_0003919 3300046477 Bacteria 8120
439 Ga0495664_0043051 3300046477 Bacteria 2675
440 Ga0495664_0051272 3300046477 Bacteria 2450
441 Ga0495664_0059110 3300046477 Bacteria 2281
442 Ga0495584_0163794 3300046491 Bacteria 1130
443 Ga0495594_0000156 3300046499 Bacteria 32566
444 Ga0495594_0009868 3300046499 Bacteria 4948
445 Ga0495606_0002695 3300046507 Bacteria 20064
446 Ga0495606_0100380 3300046507 Bacteria 1763
447 Ga0495608_0040794 3300046511 Bacteria 3108
448 Ga0495608_0059220 3300046511 Bacteria 2524
449 Ga0495618_0030077 3300046514 Bacteria 3390
450 Ga0495628_0031187 3300046516 Bacteria 4312
451 Ga0495628_0079988 3300046516 Bacteria 2541
452 Ga0495628_0334508 3300046516 Bacteria 1116
453 Ga0495630_0001012 3300046517 Bacteria 19479
454 Ga0495631_0036950 3300046518 Bacteria 2178
455 Ga0495648_0010156 3300046524 Bacteria 7204
456 Ga0495652_0011739 3300046529 Bacteria 7913
457 Ga0495652_0079282 3300046529 Bacteria 2716
458 Ga0495652_0081142 3300046529 Bacteria 2676
459 Ga0495665_0000194 3300046531 Bacteria 31352
460 Ga0495640_0007096 3300046533 Bacteria 8816
461 Ga0495640_0046011 3300046533 Bacteria 3026
462 Ga0495598_0004166 3300046537 Bacteria 3115
463 Ga0495645_0007301 3300046543 Bacteria 7687
464 Ga0495645_0032506 3300046543 Bacteria 3806
465 Ga0495622_0000715 3300046557 Bacteria 18751
466 Ga0495622_0025255 3300046557 Bacteria 2775
467 Ga0495633_0011335 3300046558 Bacteria 4811
468 Ga0495633_0082695 3300046558 Bacteria 1494
469 Ga0495667_0007419 3300046559 Bacteria 7434
470 Ga0495667_0120814 3300046559 Bacteria 1691
471 Ga0495668_0208478 3300046616 Bacteria 1070
472 Ga0495634_0002644 3300046642 Bacteria 14727
473 Ga0495634_0032291 3300046642 Bacteria 3601
474 Ga0495634_0039016 3300046642 Bacteria 3236
475 Ga0495634_0122657 3300046642 Bacteria 1663
476 Ga0495625_0172140 3300046660 Bacteria 1445
477 Ga0495625_0269280 3300046660 Bacteria 1100
478 Ga0495635_0000143 3300046663 Bacteria 43594
479 Ga0495635_0002237 3300046663 Bacteria 13152
480 Ga0495635_0087155 3300046663 Bacteria 2136
481 Ga0495635_0100436 3300046663 Bacteria 1977
482 Ga0495659_0019933 3300046664 Bacteria 2248
483 Ga0495661_0195825 3300046665 Bacteria 1061
484 Ga0495588_0010719 3300046674 Bacteria 4276
485 Ga0495588_0068621 3300046674 Bacteria 1842
486 Ga0495588_0098733 3300046674 Bacteria 1533
487 Ga0495657_0077495 3300046675 Bacteria 2156
488 Ga0495599_0007001 3300046678 Bacteria 6822
489 Ga0495599_0016188 3300046678 Bacteria 4628
490 Ga0495599_0044711 3300046678 Bacteria 2777
491 Ga0495599_0058849 3300046678 Bacteria 2404
492 Ga0495623_0087637 3300046679 Bacteria 1917
493 Ga0495646_0010250 3300046680 Bacteria 5961
494 Ga0495646_0062359 3300046680 Bacteria 2217
495 Ga0495646_0083520 3300046680 Bacteria 1856
496 Ga0495647_0001838 3300046681 Bacteria 6577
497 Ga0495658_0004694 3300046683 Bacteria 6719
498 Ga0495658_0040297 3300046683 Bacteria 2596
499 Ga0495669_0032053 3300046684 Bacteria 2308
500 Ga0495669_0136509 3300046684 Bacteria 1156
501 Ga0495613_0001529 3300046689 Bacteria 17612
502 Ga0495613_0007988 3300046689 Bacteria 7869
503 Ga0495613_0077520 3300046689 Bacteria 2418
504 Ga0495624_0000331 3300046690 Bacteria 37420
505 Ga0495624_0020134 3300046690 Bacteria 4444
506 Ga0495670_0053662 3300046691 Bacteria 2019
507 Ga0495600_0024995 3300046809 Bacteria 3847
508 Ga0495581_0000056 3300047315 Bacteria 42968
509 Ga0495581_0189833 3300047315 Bacteria 1202
510 Ga0495604_0005325 3300047317 Bacteria 10206
511 Ga0495674_0000491 3300047319 Bacteria 36074
512 Ga0495674_0044145 3300047319 Bacteria 3964
513 Ga0495674_0369640 3300047319 Bacteria 1161
514 Ga0495672_0054407 3300047320 Bacteria 2340
515 Ga0495676_0031776 3300047321 Bacteria 4461
516 Ga0495676_0041662 3300047321 Bacteria 3777
517 Ga0495676_0059769 3300047321 Bacteria 2991
518 Ga0495680_0035139 3300047322 Bacteria 4039
519 Ga0495675_0014860 3300047444 Bacteria 4923
520 Ga0495675_0071501 3300047444 Bacteria 2189
521 Ga0495677_0024903 3300047445 Bacteria 2171
522 Ga0495684_0002066 3300047471 Bacteria 16139
523 Ga0495684_0026846 3300047471 Bacteria 4425
524 Ga0495684_0027932 3300047471 Bacteria 4333
525 Ga0495593_0000514 3300047673 Bacteria 21883
526 Ga0495593_0009372 3300047673 Bacteria 5681
527 Ga0495602_0014531 3300048088 Bacteria 7988
528 Ga0495602_0101181 3300048088 Bacteria 2364
529 Ga0495614_0012654 3300048089 Bacteria 3701
530 Ga0495614_0172536 3300048089 Bacteria 971
531 Ga0496100_0045892 3300048903 Bacteria 2806
532 Ga0496101_0091279 3300048904 Bacteria 2267
533 Ga0496101_0102491 3300048904 Bacteria 2144
534 Ga0496101_0106774 3300048904 Bacteria 2103
535 Ga0496102_0088093 3300048905 Bacteria 2869
536 Ga0496102_0139698 3300048905 Bacteria 2271
537 Ga0496102_0322858 3300048905 Bacteria 1454
538 Ga0496103_0039889 3300048906 Bacteria 2886
539 Ga0496103_0102108 3300048906 Bacteria 1816
540 Ga0496104_0013566 3300048907 Bacteria 7344
541 Ga0496104_0030372 3300048907 Bacteria 5021
542 Ga0496104_0092286 3300048907 Bacteria 2895
543 Ga0496104_0164574 3300048907 Bacteria 2127
544 Ga0496105_0018872 3300048908 Bacteria 5554
545 Ga0496105_0022602 3300048908 Bacteria 5094
546 Ga0496105_0284941 3300048908 Bacteria 1331
547 Ga0496106_0053709 3300048909 Bacteria 3044
548 Ga0496106_0230078 3300048909 Bacteria 1480
549 Ga0496107_0024059 3300048910 Bacteria 4306
550 Ga0496107_0029250 3300048910 Bacteria 3919
551 Ga0496108_0000462 3300048911 Bacteria 32575
552 Ga0496108_0025055 3300048911 Bacteria 4915
553 Ga0496108_0082379 3300048911 Bacteria 2728
554 Ga0496109_0004036 3300048912 Bacteria 12261
555 Ga0496109_0008292 3300048912 Bacteria 8822
556 Ga0496109_0064649 3300048912 Bacteria 3348
557 Ga0496109_0100592 3300048912 Bacteria 2682
558 Ga0496110_0022878 3300048913 Bacteria 5311
559 Ga0496111_0022482 3300048914 Bacteria 4415
560 Ga0496111_0022988 3300048914 Bacteria 4372
561 Ga0496111_0030734 3300048914 Bacteria 3821
562 Ga0496111_0073011 3300048914 Bacteria 2498
563 Ga0496112_0000015 3300048915 Bacteria 206423
564 Ga0496112_0001393 3300048915 Bacteria 18457
565 Ga0496112_0013364 3300048915 Bacteria 7579
566 Ga0496112_0057130 3300048915 Bacteria 3841
567 Ga0496113_0001153 3300048916 Bacteria 14398
568 Ga0496113_0084824 3300048916 Bacteria 2432
569 Ga0496113_0276676 3300048916 Bacteria 1342
570 Ga0496114_0019280 3300048917 Bacteria 5525
571 Ga0496114_0167964 3300048917 Bacteria 1911
572 Ga0496115_0033293 3300048918 Bacteria 4068
573 Ga0496115_0069601 3300048918 Bacteria 2851
574 Ga0496119_0094757 3300048922 Bacteria 1688
575 Ga0496121_0024310 3300048924 Bacteria 5800
576 Ga0496121_0030279 3300048924 Bacteria 4973
577 Ga0496121_0043809 3300048924 Bacteria 3869
578 Ga0496121_0070724 3300048924 Bacteria 2809
579 Ga0496121_0074072 3300048924 Bacteria 2725
580 Ga0496121_0103257 3300048924 Bacteria 2193
581 Ga0496121_0164775 3300048924 Bacteria 1617
582 Ga0496123_0086495 3300048926 Bacteria 1880
583 Ga0496124_0054746 3300048927 Bacteria 3375
584 Ga0496125_0169744 3300048928 Bacteria 1468
585 Ga0496126_0017735 3300048929 Bacteria 7088
586 Ga0496126_0039018 3300048929 Bacteria 4412
587 Ga0496126_0051005 3300048929 Bacteria 3769
588 Ga0496126_0070782 3300048929 Bacteria 3107
589 Ga0496126_0106126 3300048929 Bacteria 2452
590 Ga0496126_0108775 3300048929 Bacteria 2417
591 Ga0501042_0181513 3300049578 Bacteria 1518
592 Ga0501047_0010089 3300049581 Bacteria 8927
593 Ga0501070_0034331 3300049586 Bacteria 4241
594 Ga0501074_0268567 3300049590 Bacteria 1212
595 Ga0501079_0259320 3300049741 Bacteria 1359
596 Ga0501080_0025322 3300049742 Bacteria 5505
597 Ga0501044_0008755 3300049823 Bacteria 11072
598 Ga0501045_0363654 3300049824 Bacteria 1077
599 nmdc:mga03n38_36423_c1 3300050490 Bacteria 2115
600 nmdc:mga03n38_86428_c1 3300050490 Bacteria 1484
601 nmdc:mga00v17_17285_c1 3300050491 Bacteria 4080
602 nmdc:mga04h51_21418_c1 3300050495 Bacteria 1945
603 nmdc:mga07m45_79086_c1 3300050496 Bacteria 1877
604 nmdc:mga05p37_96134_c1 3300050507 Bacteria 3649
605 nmdc:mga08y16_261054_c1 3300050511 Bacteria 1789
606 nmdc:mga08y16_87755_c1 3300050511 Bacteria 3241
607 nmdc:mga0n895_10503_c1 3300050512 Bacteria 8189
608 nmdc:mga0sz30_3020_c1 3300050516 Bacteria 6030
609 Ga0495601_0011133 3300053077 Bacteria 5373
610 Ga0495601_0028358 3300053077 Bacteria 3468
611 Ga0495612_0008205 3300053078 Bacteria 4243
612 Ga0495612_0044274 3300053078 Bacteria 1821
613 Ga0495595_0006080 3300053084 Bacteria 4906
614 Ga0495595_0063298 3300053084 Bacteria 1736
615 Ga0495619_0001152 3300053085 Bacteria 17364
616 Ga0495619_0005951 3300053085 Bacteria 7726
617 Ga0500566_0002681 3300053094 Bacteria 10600
618 Ga0500641_0006723 3300053096 Bacteria 4088
619 Ga0500641_0014203 3300053096 Bacteria 2936
620 Ga0500641_0016774 3300053096 Bacteria 2730
621 Ga0500554_002830 3300053102 Bacteria 3464
622 Ga0500572_001157 3300053111 Bacteria 7622
623 Ga0500572_007341 3300053111 Bacteria 2551
624 Ga0500595_001168 3300053119 Bacteria 14542
625 Ga0500614_005245 3300053123 Bacteria 2719
626 Ga0500621_077951 3300053126 Bacteria 1331
627 Ga0500559_0004525 3300053136 Bacteria 6575
628 Ga0500589_046663 3300053147 Bacteria 2017
629 Ga0500603_000363 3300053150 Bacteria 11878
630 Ga0500630_073215 3300053159 Bacteria 1616
631 Ga0500634_0098093 3300053161 Bacteria 1472
632 Ga0500639_009187 3300053163 Bacteria 5164
633 Ga0500639_071036 3300053163 Bacteria 1773
634 Ga0500637_0000154 3300053178 Bacteria 25097
635 Ga0500637_0006864 3300053178 Bacteria 5651
636 Ga0500637_0014405 3300053178 Bacteria 4171
637 Ga0500645_014866 3300053730 Bacteria 2475
638 Ga0500596_001265 3300053735 Bacteria 5111
639 Ga0501082_0158598 3300060353 Bacteria 1966
640 Ga0466962_0125804 3300061719 Bacteria 1238
641 2509150063 2508501128 Bacteria 8613869
642 2513658564 2513237096 Bacteria 8722461
643 2513671885 2513237098 Bacteria 9902361
644 2513694134 2513237101 Bacteria 7952346
645 2513860150 2513237137 Bacteria 9558895
646 2513890318 2513237141 Bacteria 8496279
647 2513920680 2513237145 Bacteria 8979722
648 2517888550 2517572143 Bacteria 9484767
649 2524469712 2524023210 Bacteria 9029266
650 2524535138 2524023228 Bacteria 10118060
651 2671119724 2667528175 Bacteria 7532676
652 2723849424 2721755755 Bacteria 8322773
653 2728750340 2728368998 Bacteria 8720350
654 2793067376 2791355197 Bacteria 8420563
655 2793077003
656 2874608328 2874604998 Bacteria 7834745
657 2876810022 2876808645 Bacteria 8824342
658 2879112906 2879110137 Bacteria 8907982
659 2885377879 2885374607 Bacteria 8927485
660 2885388151 2885383462 Bacteria 9473874
661 2889035766 2889033259 Bacteria 9099371
662 2903751837 2903748898 Bacteria 9972761
663 2903775151 2903768456 Bacteria 9749579
664 2904699345 2904690495 Bacteria 9412302
665 2904708083
666 2906614087
667 2906637764 2906635258 Bacteria 8601019
668 2906668332 2906660503 Bacteria 8595048
669 2908747092 2908739725 Bacteria 8628932
670 2908764792 2908756301 Bacteria 8864324
671 2922364254 2922361189 Bacteria 7436256
672 2922388957 2922386360 Bacteria 7017218
673 2922434575
674 2935637572 2935630451 Bacteria 8169952
675 2941514191 2941507105 Bacteria 8166816
676 2941522152 2941515067 Bacteria 8166720
677 2941529890 2941523033 Bacteria 8169134
678 3005483651 3005474847 Bacteria 9259049
679 8006936605 8006933436 Bacteria 10410654
680 8006970512 8006964411 Bacteria 8966052
681 8006976570 8006973647 Bacteria 10679141
682 8006989106 8006984368 Bacteria 9651211
683 8007000053 8006994254 Bacteria 8309700
684 8019562106 8019555841 Bacteria 9642137
685 8019572173 8019565922 Bacteria 9639779
686 8056677857 8056673599 Bacteria 7871253
687 8056687996 8056681323 Bacteria 8472857
688 8056691633 8056689827 Bacteria 6712655
689 Ga0213875_10023306
690 JGI24737J22298_10003097
691 JGI25406J46586_10000032
692 rootH1_10116502
693 Ga0070683_100012751
694 Ga0070690_100142169
695 Ga0068869_100046168
696 Ga0068869_100248787
697 Ga0070666_10209168
698 Ga0070680_100037022
699 Ga0068868_100015963
700 Ga0068868_100416455
701 Ga0070660_100055048
702 Ga0070668_100082201
703 Ga0070668_100332547
704 Ga0070675_100313263
705 Ga0070671_100178989
706 Ga0070671_100321864
707 Ga0070674_100042698
708 Ga0070674_100057958
709 Ga0070673_100088823
710 Ga0070673_100089621
711 Ga0070667_100276654
712 Ga0070709_10003755
713 Ga0070709_10012141
714 Ga0070709_10017155
715 Ga0070714_100085332
716 Ga0070714_100287201
717 Ga0070713_100003608
718 Ga0070713_100004146
719 Ga0070713_100008416
720 Ga0070713_100113587
721 Ga0070713_100153895
722 Ga0070713_100222649
723 Ga0070710_10000198
724 Ga0070710_10014070
725 Ga0070710_10019547
726 Ga0070711_100001684
727 Ga0070711_100001849
728 Ga0070711_100014053
729 Ga0070711_100057094
730 Ga0070711_100100028
731 Ga0070705_100076091
732 Ga0070700_100025142
733 Ga0070708_100083402
734 Ga0070663_100031232
735 Ga0070663_100059248
736 Ga0070663_100172150
737 Ga0070678_100112754
738 Ga0070678_100251685
739 Ga0070662_100103378
740 Ga0070662_100185690
741 Ga0070681_10016905
742 Ga0070681_10058339
743 Ga0070681_10265828
744 Ga0070681_10312847
745 Ga0070706_100074250
746 Ga0070707_100123166
747 Ga0070679_100001793
748 Ga0070679_100018577
749 Ga0070679_100061672
750 Ga0070679_100108075
751 Ga0070679_100336697
752 Ga0070684_100016437
753 Ga0070684_100023053
754 Ga0070697_100020228
755 Ga0070697_100128354
756 Ga0068853_100007166
757 Ga0068853_100472764
758 Ga0070696_100039781
759 Ga0070693_100008186
760 Ga0070665_100027843
761 Ga0070665_100069458
762 Ga0070665_100120248
763 Ga0070665_100139603
764 Ga0070665_100197715
765 Ga0070665_100235584
766 Ga0070665_100659298
767 Ga0068855_100015676
768 Ga0068855_100113086
769 Ga0068855_100486494
770 Ga0068855_100497881
771 Ga0070664_100310563
772 Ga0068857_100003229
773 Ga0068857_100091355
774 Ga0068854_100002577
775 Ga0068854_100183183
776 Ga0068856_100000013
777 Ga0068856_100002736
778 Ga0068856_100172459
779 Ga0068856_100207448
780 Ga0068856_100405363
781 Ga0070702_100029671
782 Ga0068852_100092237
783 Ga0068852_100164108
784 Ga0068864_100356395
785 Ga0068870_10073763
786 Ga0068863_100290484
787 Ga0068858_100035398
788 Ga0068858_100086981
789 Ga0068860_100132419
790 Ga0068860_100154198
791 Ga0068860_100157299
792 Ga0068860_100332479
793 Ga0068862_100060586
794 Ga0068862_100181448
795 Ga0081455_10002765
796 Ga0081540_1006425
797 Ga0081540_1021267
798 Ga0081540_1029946
799 Ga0081539_10000129
800 Ga0070717_10001210
801 Ga0070717_10001984
802 Ga0070717_10024589
803 Ga0070717_10219151
804 Ga0070717_10308931
805 Ga0075365_10019498
806 Ga0075365_10026949
807 Ga0075365_10141402
808 Ga0075368_10050948
809 Ga0070715_10002598
810 Ga0070715_10083791
811 Ga0070716_100005147
812 Ga0070712_100009081
813 Ga0070712_100044891
814 Ga0070712_100066187
815 Ga0070712_100123927
816 Ga0070712_100319227
817 Ga0075367_10011323
818 Ga0075367_10070993
819 Ga0075366_10074270
820 Ga0075366_10223435
821 Ga0097621_100326248
822 Ga0075370_10011166
823 Ga0075370_10037651
824 Ga0075434_100013288
825 Ga0075429_100251702
826 Ga0068865_100034186
827 Ga0068865_100125027
828 Ga0099825_1038138
829 Ga0099824_1024628
830 Ga0099822_1006545
831 Ga0075435_100091673
832 Ga0099794_10000582
833 Ga0099794_10006939
834 Ga0099794_10080167
835 Ga0099795_10027346
836 Ga0099795_10061886
837 Ga0099795_10062422
838 Ga0105240_10006672
839 Ga0105240_10018175
840 Ga0105240_10024401
841 Ga0105240_10296722
842 Ga0111539_10044521
843 Ga0111539_10370207
844 Ga0105247_10009644
845 Ga0105247_10013897
846 Ga0105247_10150460
847 Ga0114129_10462319
848 Ga0105241_10003037
849 Ga0105248_10076942
850 Ga0105237_10011335
851 Ga0105237_10046628
852 Ga0105237_10076812
853 Ga0105237_10222959
854 Ga0105238_10014439
855 Ga0105238_10043350
856 Ga0105238_10079633
857 Ga0105238_10115972
858 Ga0105238_10398942
859 Ga0105249_10122227
860 Ga0099796_10017249
861 Ga0099796_10031183
862 Ga0105239_10016541
863 Ga0105239_10071844
864 Ga0105239_10117065
865 Ga0105239_10290766
866 Ga0105239_10362997
867 Ga0105239_10892881
868 Ga0105246_10047829
869 Ga0157370_10074276
870 Ga0157370_10128814
871 Ga0157369_10016160
872 Ga0157369_10022796
873 Ga0157369_10066692
874 Ga0157378_10000929
875 Ga0157378_10086109
876 Ga0163162_10193444
877 Ga0163162_10426723
878 Ga0157372_10127424
879 Ga0157372_10287866
880 Ga0157372_10565481
881 Ga0163163_10011790
882 Ga0163163_10141589
883 Ga0157376_10128164
884 Ga0157376_10472277
885 Ga0213876_10056171
886 Ga0213871_10015264
887 Ga0209677_100630
888 Ga0209233_1004114
889 Ga0209233_1005672
890 Ga0209455_1006016
891 Ga0209455_1007525
892 Ga0209758_1004986
893 Ga0207697_10097803
894 Ga0207656_10026731
895 Ga0207692_10003088
896 Ga0207692_10048891
897 Ga0207642_10047214
898 Ga0207642_10088702
899 Ga0207688_10006015
900 Ga0207688_10050463
901 Ga0207647_10001195
902 Ga0207699_10002538
903 Ga0207699_10012109
904 Ga0207643_10034379
905 Ga0207705_10311645
906 Ga0207684_10089954
907 Ga0207654_10004914
908 Ga0207707_10008157
909 Ga0207707_10090891
910 Ga0207707_10126764
911 Ga0207707_10136010
912 Ga0207707_10191397
913 Ga0207695_10016221
914 Ga0207695_10090041
915 Ga0207695_10159769
916 Ga0207671_10127924
917 Ga0207671_10128589
918 Ga0207671_10144286
919 Ga0207671_10282346
920 Ga0207693_10009789
921 Ga0207663_10002121
922 Ga0207663_10002432
923 Ga0207663_10019132
924 Ga0207663_10275537
925 Ga0207660_10020414
926 Ga0207660_10028759
927 Ga0207660_10185938
928 Ga0207662_10059650
929 Ga0207657_10217587
930 Ga0207649_10276178
931 Ga0207652_10028728
932 Ga0207652_10079880
933 Ga0207652_10095547
934 Ga0207646_10097630
935 Ga0207646_10099175
936 Ga0207694_10086214
937 Ga0207694_10247089
938 Ga0207694_10278115
939 Ga0207650_10179874
940 Ga0207687_10004884
941 Ga0207687_10138704
942 Ga0207700_10006018
943 Ga0207700_10050887
944 Ga0207700_10064670
945 Ga0207700_10082794
946 Ga0207700_10104463
947 Ga0207664_10011463
948 Ga0207664_10248697
949 Ga0207644_10134317
950 Ga0207706_10018833
951 Ga0207706_10084506
952 Ga0207706_10189669
953 Ga0207686_10230515
954 Ga0207709_10007974
955 Ga0207669_10034674
956 Ga0207669_10044036
957 Ga0207704_10300969
958 Ga0207665_10002662
959 Ga0207665_10123792
960 Ga0207691_10118309
961 Ga0207691_10196950
962 Ga0207711_10029690
963 Ga0207711_10091300
964 Ga0207689_10081765
965 Ga0207661_10000690
966 Ga0207661_10088246
967 Ga0207679_10115900
968 Ga0207667_10020165
969 Ga0207667_10043552
970 Ga0207667_10147916
971 Ga0207667_10298001
972 Ga0207667_10428721
973 Ga0207651_10069059
974 Ga0207668_10039139
975 Ga0207640_10205400
976 Ga0207703_10098397
977 Ga0207639_10014927
978 Ga0207639_10181132
979 Ga0207678_10039269
980 Ga0207678_10083553
981 Ga0207678_10108700
982 Ga0207678_10180336
983 Ga0207708_10327210
984 Ga0207702_10000956
985 Ga0207641_10097809
986 Ga0207648_10050191
987 Ga0207648_10137643
988 Ga0207674_10025880
989 Ga0207675_100315004
990 Ga0207683_10015524
991 Ga0207683_10042294
992 Ga0207698_10040385
993 Ga0209589_1000026
994 Ga0209489_100046
995 Ga0209700_100047
996 Ga0209588_1017881
997 Ga0209588_1021195
998 Ga0207428_10185767
999 Ga0268266_10002269
1000 Ga0268266_10032706
1001 Ga0268266_10151833
1002 Ga0268266_10329402
1003 Ga0268265_10098834
1004 Ga0268265_10243154
1005 Ga0268265_10305813
1006 Ga0268264_10203790
1007 Ga0265326_10014688
1008 Ga0265319_1002170
1009 Ga0265334_10001238
1010 Ga0265318_10005790
1011 Ga0265323_10003793
1012 Ga0265336_10000210
1013 Ga0307517_10000495
1014 Ga0307517_10192396
1015 Ga0307515_10032002
1016 Ga0265338_10000256
1017 Ga0265324_10001141
1018 Ga0265330_10017367
1019 Ga0265340_10005577
1020 Ga0265331_10046131
1021 Ga0307513_10364337
1022 Ga0307508_10049370
1023 Ga0265342_10035135
1024 Ga0307516_10006269
1025 Ga0307516_10015885
1026 Ga0307413_10046955
1027 Ga0307416_100304414
1028 Ga0307415_100072814
1029 Ga0307415_100114210
1030 Ga0307510_10145352
1031 Ga0315911_1000019
1032 Ga0373926_0011906
1033 Ga0373929_0017804
1034 Ga0373934_0005190
1035 Ga0373944_0009036
1036 Ga0373923_0003136
1037 Ga0373923_0023229
1038 Ga0373936_0013878
1039 Ga0373936_0044334
1040 Ga0373936_0107359
1041 Ga0373945_0010799
1042 Ga0373953_0003128
1043 Ga0373953_0012842
1044 Ga0373954_0000258
1045 Ga0373954_0011470
1046 Ga0373954_0015999
1047 Ga0373954_0024185
1048 Ga0373956_0040647
1049 Ga0373957_0001886
1050 Ga0373957_0026876
1051 Ga0373943_0010350
1052 Ga0373943_0011486
1053 Ga0373946_0028092
1054 Ga0373955_0007855
1055 Ga0373955_0030377
1056 Ga0373924_0015461
1057 Ga0373931_0001558
1058 Ga0373931_0071627
1059 Ga0373935_0000529
1060 Ga0373935_0030440
1061 Ga0373927_0002202
1062 Ga0373927_0004897
1063 Ga0373927_0024658
1064 Ga0373927_0064011
1065 Ga0373933_0017670
1066 Ga0373933_0032044
1067 Ga0373947_0000648
1068 Ga0373947_0009913
1069 Ga0373947_0022469
1070 Ga0373947_0032129
1071 Ga0373937_0042460
1072 Ga0373937_0122476
1073 Ga0373937_0260697
1074 Ga0373925_0001217
1075 Ga0373925_0023023
1076 Ga0373925_0378230
1077 Ga0395900_0009632
1078 Ga0395900_0080040
1079 Ga0395898_0008781
1080 Ga0395898_0017426
1081 Ga0395898_0099845
1082 Ga0395898_0113074
1083 Ga0395905_0195333
1084 Ga0436364_0476705
1085 Ga0436364_1013981
1086 Ga0436364_1139280
1087 Ga0395901_0117861
1088 Ga0395901_0140933
1089 Ga0436365_0265507
1090 Ga0436365_0571458
1091 Ga0436365_1575266
1092 Ga0436360_0226792
1093 Ga0436360_1217406
1094 Ga0436361_0625924
1095 Ga0436361_0867016
1096 Ga0436363_0002993
1097 Ga0436363_0193931
1098 Ga0436362_0574087
1099 Ga0439465_0036899
1100 Ga0466969_0071075
1101 Ga0466969_0071465
1102 Ga0466963_0101876
1103 Ga0466959_0019326
1104 Ga0466967_0074681
1105 Ga0466967_0188415
1106 Ga0466967_0352073
1107 Ga0495592_0009928
1108 Ga0495592_0015555
1109 Ga0495592_0136009
1110 Ga0495603_0000072
1111 Ga0495603_0007998
1112 Ga0495603_0071176
1113 Ga0495629_0000255
1114 Ga0495629_0000932
1115 Ga0495629_0216143
1116 Ga0495651_0043966
1117 Ga0495651_0069159
1118 Ga0495653_0001885
1119 Ga0495580_0021004
1120 Ga0495580_0088557
1121 Ga0495582_0000057
1122 Ga0495639_0000025
1123 Ga0495639_0025185
1124 Ga0495662_0000301
1125 Ga0495662_0041944
1126 Ga0495664_0003919
1127 Ga0495664_0043051
1128 Ga0495664_0051272
1129 Ga0495664_0059110
1130 Ga0495584_0163794
1131 Ga0495594_0000156
1132 Ga0495594_0009868
1133 Ga0495606_0002695
1134 Ga0495606_0100380
1135 Ga0495608_0040794
1136 Ga0495608_0059220
1137 Ga0495618_0030077
1138 Ga0495628_0031187
1139 Ga0495628_0079988
1140 Ga0495628_0334508
1141 Ga0495630_0001012
1142 Ga0495631_0036950
1143 Ga0495648_0010156
1144 Ga0495652_0011739
1145 Ga0495652_0079282
1146 Ga0495652_0081142
1147 Ga0495665_0000194
1148 Ga0495640_0007096
1149 Ga0495640_0046011
1150 Ga0495598_0004166
1151 Ga0495645_0007301
1152 Ga0495645_0032506
1153 Ga0495622_0000715
1154 Ga0495622_0025255
1155 Ga0495633_0011335
1156 Ga0495633_0082695
1157 Ga0495667_0007419
1158 Ga0495667_0120814
1159 Ga0495668_0208478
1160 Ga0495634_0002644
1161 Ga0495634_0032291
1162 Ga0495634_0039016
1163 Ga0495634_0122657
1164 Ga0495625_0172140
1165 Ga0495625_0269280
1166 Ga0495635_0000143
1167 Ga0495635_0002237
1168 Ga0495635_0087155
1169 Ga0495635_0100436
1170 Ga0495659_0019933
1171 Ga0495661_0195825
1172 Ga0495588_0010719
1173 Ga0495588_0068621
1174 Ga0495588_0098733
1175 Ga0495657_0077495
1176 Ga0495599_0007001
1177 Ga0495599_0016188
1178 Ga0495599_0044711
1179 Ga0495599_0058849
1180 Ga0495623_0087637
1181 Ga0495646_0010250
1182 Ga0495646_0062359
1183 Ga0495646_0083520
1184 Ga0495647_0001838
1185 Ga0495658_0004694
1186 Ga0495658_0040297
1187 Ga0495669_0032053
1188 Ga0495669_0136509
1189 Ga0495613_0001529
1190 Ga0495613_0007988
1191 Ga0495613_0077520
1192 Ga0495624_0000331
1193 Ga0495624_0020134
1194 Ga0495670_0053662
1195 Ga0495600_0024995
1196 Ga0495581_0000056
1197 Ga0495581_0189833
1198 Ga0495604_0005325
1199 Ga0495674_0000491
1200 Ga0495674_0044145
1201 Ga0495674_0369640
1202 Ga0495672_0054407
1203 Ga0495676_0031776
1204 Ga0495676_0041662
1205 Ga0495676_0059769
1206 Ga0495680_0035139
1207 Ga0495675_0014860
1208 Ga0495675_0071501
1209 Ga0495677_0024903
1210 Ga0495684_0002066
1211 Ga0495684_0026846
1212 Ga0495684_0027932
1213 Ga0495593_0000514
1214 Ga0495593_0009372
1215 Ga0495602_0014531
1216 Ga0495602_0101181
1217 Ga0495614_0012654
1218 Ga0495614_0172536
1219 Ga0496100_0045892
1220 Ga0496101_0091279
1221 Ga0496101_0102491
1222 Ga0496101_0106774
1223 Ga0496102_0088093
1224 Ga0496102_0139698
1225 Ga0496102_0322858
1226 Ga0496103_0039889
1227 Ga0496103_0102108
1228 Ga0496104_0013566
1229 Ga0496104_0030372
1230 Ga0496104_0092286
1231 Ga0496104_0164574
1232 Ga0496105_0018872
1233 Ga0496105_0022602
1234 Ga0496105_0284941
1235 Ga0496106_0053709
1236 Ga0496106_0230078
1237 Ga0496107_0024059
1238 Ga0496107_0029250
1239 Ga0496108_0000462
1240 Ga0496108_0025055
1241 Ga0496108_0082379
1242 Ga0496109_0004036
1243 Ga0496109_0008292
1244 Ga0496109_0064649
1245 Ga0496109_0100592
1246 Ga0496110_0022878
1247 Ga0496111_0022482
1248 Ga0496111_0022988
1249 Ga0496111_0030734
1250 Ga0496111_0073011
1251 Ga0496112_0000015
1252 Ga0496112_0001393
1253 Ga0496112_0013364
1254 Ga0496112_0057130
1255 Ga0496113_0001153
1256 Ga0496113_0084824
1257 Ga0496113_0276676
1258 Ga0496114_0019280
1259 Ga0496114_0167964
1260 Ga0496115_0033293
1261 Ga0496115_0069601
1262 Ga0496119_0094757
1263 Ga0496121_0024310
1264 Ga0496121_0030279
1265 Ga0496121_0043809
1266 Ga0496121_0070724
1267 Ga0496121_0074072
1268 Ga0496121_0103257
1269 Ga0496121_0164775
1270 Ga0496123_0086495
1271 Ga0496124_0054746
1272 Ga0496125_0169744
1273 Ga0496126_0017735
1274 Ga0496126_0039018
1275 Ga0496126_0051005
1276 Ga0496126_0070782
1277 Ga0496126_0106126
1278 Ga0496126_0108775
1279 Ga0501042_0181513
1280 Ga0501047_0010089
1281 Ga0501070_0034331
1282 Ga0501074_0268567
1283 Ga0501079_0259320
1284 Ga0501080_0025322
1285 Ga0501044_0008755
1286 Ga0501045_0363654
1287 nmdc:mga03n38_36423_c1
1288 nmdc:mga03n38_86428_c1
1289 nmdc:mga00v17_17285_c1
1290 nmdc:mga04h51_21418_c1
1291 nmdc:mga07m45_79086_c1
1292 nmdc:mga05p37_96134_c1
1293 nmdc:mga08y16_261054_c1
1294 nmdc:mga08y16_87755_c1
1295 nmdc:mga0n895_10503_c1
1296 nmdc:mga0sz30_3020_c1
1297 Ga0495601_0011133
1298 Ga0495601_0028358
1299 Ga0495612_0008205
1300 Ga0495612_0044274
1301 Ga0495595_0006080
1302 Ga0495595_0063298
1303 Ga0495619_0001152
1304 Ga0495619_0005951
1305 Ga0500566_0002681
1306 Ga0500641_0006723
1307 Ga0500641_0014203
1308 Ga0500641_0016774
1309 Ga0500554_002830
1310 Ga0500572_001157
1311 Ga0500572_007341
1312 Ga0500595_001168
1313 Ga0500614_005245
1314 Ga0500621_077951
1315 Ga0500559_0004525
1316 Ga0500589_046663
1317 Ga0500603_000363
1318 Ga0500630_073215
1319 Ga0500634_0098093
1320 Ga0500639_009187
1321 Ga0500639_071036
1322 Ga0500637_0000154
1323 Ga0500637_0006864
1324 Ga0500637_0014405
1325 Ga0500645_014866
1326 Ga0500596_001265
1327 Ga0501082_0158598
1328 Ga0466962_0125804
1329 2509150063
1330 2513658564
1331 2513671885
1332 2513694134
1333 2513860150
1334 2513890318
1335 2513920680
1336 2517888550
1337 2524469712
1338 2524535138
1339 2671119724
1340 2723849424
1341 2728750340
1342 2793067376
1343 2793077003
1344 2874608328
1345 2876810022
1346 2879112906
1347 2885377879
1348 2885388151
1349 2889035766
1350 2903751837
1351 2903775151
1352 2904699345
1353 2904708083
1354 2906614087
1355 2906637764
1356 2906668332
1357 2908747092
1358 2908764792
1359 2922364254
1360 2922388957
1361 2922434575
1362 2935637572
1363 2941514191
1364 2941522152
1365 2941529890
1366 3005483651
1367 8006936605
1368 8006970512
1369 8006976570
1370 8006989106
1371 8007000053
1372 8019562106
1373 8019572173
1374 8056677857
1375 8056687996
1376 8056691633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07536

HWE_HK

HWE histidine kinase

191

267

0.95

Map