F475322

General Info

Members Datasets Scaffolds Average Seq Length
688 355 647 438

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10007611|Ga0157374_100076111
Length 512
Sequence VKFGDCFGIRPPKRKTSSPPFYLVVQKDELTQIHRILPMFDQLSERLQGAFANLRGGRQLTEENMEDALREVRRALLEADVSLRVIKAFISRVKDRAVGEDVLKSVEPGQQLVKIVHDELVLLLGGESKGLNLDGKPSIIVLFGLQGSGKTTSCGKLALKLRKEGRKPLMVAADVYRPAAIQQLITLGKQIDIPVHTIEGSTDVLAIARSGLERAKSEDFDTLLVDTAGRLQIDTDMMAELLLVERVLEPQEKLLVIDAMTGQEAVAVAETFNSQLDVTGIIVSKLDGDARGGAALSVVEVTGKPIKLIGTSEKLTGLENFHPERMATRILGMGDVISLVEKAQQAFDLDEAQRMEEKMRKSEFSLEDFMKVQKSFKMLGSMEQILGMLPIPGLTKEMREMLSSSGEEQMKKIEVIIQSMTLAERRKPEIIKESRKKRIAKGCGLPEEEISRFLMQFDQMRMMMKQLTKMTDGFKKEHSPAAAGGLKMPRSMKKKXXDGFGDLMKLPDFFGK

Samples

Sample ID Description Type Environment
1 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
4 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
9 2738543023 Pedobacter sp. OK628 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
14 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
15 2818991437 Pedobacter terrae 518 Isolate Unclassified
16 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
17 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
18 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
19 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
20 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
21 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
22 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
23 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
24 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
25 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
26 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
27 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
28 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
29 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
30 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
31 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
32 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
33 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
34 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
35 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
36 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
37 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
38 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
39 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
40 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
41 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
42 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
43 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
141 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
202 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
203 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
204 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
205 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
206 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
207 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
208 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
209 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
215 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
224 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
225 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
226 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
227 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
228 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
229 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
230 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
240 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
244 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
245 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
253 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
262 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
263 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
351 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.31
Metatranscriptomes 0.73
Isolates 5.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0.15
Rhizoplane 0.29
Rhizosphere 92.59
Stem 0
Stem Tuber 0.15
Unclassified 4.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007018 3300001979 Bacteria 4618
2 JGI25152J39213_1000028 3300002773 Bacteria 100367
3 JGI25150J39212_1000006 3300002774 Bacteria 257228
4 JGI25151J46595_10000024 3300003187 Bacteria 217596
5 JGI25153J46596_10000026 3300003215 Bacteria 217245
6 rootH2_10000579 3300003320 Bacteria 178428
7 rootH2_10061209 3300003320 Bacteria 2278
8 Ga0055536_1000002 3300003781 Bacteria 605605
9 Ga0055530_10003410 3300003791 Bacteria 9068
10 Ga0058862_10098900 3300004803 Unclassified 2654
11 Ga0065714_10064473 3300005288 Bacteria 60352
12 Ga0065714_10090708 3300005288 Bacteria 1935
13 Ga0065707_10172506 3300005295 Bacteria 1455
14 Ga0070658_10000032 3300005327 Bacteria 147726
15 Ga0070658_10013890 3300005327 Bacteria 6464
16 Ga0070658_10047350 3300005327 Bacteria 3480
17 Ga0070676_10005347 3300005328 Bacteria 6838
18 Ga0070676_10005364 3300005328 Bacteria 6826
19 Ga0070676_10026068 3300005328 Bacteria 3309
20 Ga0070676_10037693 3300005328 Bacteria 2789
21 Ga0070683_100000678 3300005329 Bacteria 24650
22 Ga0070683_100008171 3300005329 Bacteria 8891
23 Ga0070683_100056033 3300005329 Bacteria 3660
24 Ga0070683_100094279 3300005329 Bacteria 2813
25 Ga0070690_100103228 3300005330 Bacteria 1893
26 Ga0070670_100013603 3300005331 Bacteria 6972
27 Ga0070670_100056181 3300005331 Bacteria 3378
28 Ga0070670_100170075 3300005331 Bacteria 1890
29 Ga0070677_10025567 3300005333 Bacteria 2205
30 Ga0068869_100028810 3300005334 Bacteria 3885
31 Ga0070666_10053135 3300005335 Bacteria 2732
32 Ga0070660_100008762 3300005339 Bacteria 7086
33 Ga0070687_100027438 3300005343 Bacteria 2751
34 Ga0070668_100231260 3300005347 Bacteria 1528
35 Ga0070669_100002402 3300005353 Bacteria 13552
36 Ga0070675_100038100 3300005354 Bacteria 3917
37 Ga0070674_100025138 3300005356 Bacteria 3873
38 Ga0070673_100079694 3300005364 Bacteria 2652
39 Ga0070659_100051470 3300005366 Bacteria 3238
40 Ga0070659_100100132 3300005366 Bacteria 2332
41 Ga0070667_100037119 3300005367 Bacteria 4085
42 Ga0070714_100000352 3300005435 Bacteria 34452
43 Ga0070713_100046337 3300005436 Bacteria 3567
44 Ga0070713_100088940 3300005436 Bacteria 2652
45 Ga0070701_10045340 3300005438 Bacteria 2255
46 Ga0070700_100109521 3300005441 Bacteria 1834
47 Ga0070708_100000006 3300005445 Bacteria 150596
48 Ga0070708_100000177 3300005445 Bacteria 45553
49 Ga0070678_100157271 3300005456 Bacteria 1837
50 Ga0070662_100007268 3300005457 Bacteria 7178
51 Ga0070681_10007157 3300005458 Bacteria 10868
52 Ga0070681_10264003 3300005458 Bacteria 1633
53 Ga0070685_10001251 3300005466 Bacteria 13485
54 Ga0070707_100000323 3300005468 Bacteria 47041
55 Ga0070698_100000023 3300005471 Bacteria 102971
56 Ga0070699_100000898 3300005518 Bacteria 27761
57 Ga0070699_100046296 3300005518 Bacteria 3764
58 Ga0070679_100030130 3300005530 Bacteria 5356
59 Ga0070684_100019725 3300005535 Bacteria 5581
60 Ga0070684_100073699 3300005535 Bacteria 3009
61 Ga0068853_100009198 3300005539 Bacteria 7958
62 Ga0068853_100026595 3300005539 Bacteria 4860
63 Ga0068853_100111079 3300005539 Bacteria 2435
64 Ga0070672_100016467 3300005543 Bacteria 5293
65 Ga0070686_100000094 3300005544 Bacteria 61903
66 Ga0070686_100050638 3300005544 Bacteria 2640
67 Ga0070696_100000338 3300005546 Bacteria 28429
68 Ga0070665_100000017 3300005548 Bacteria 448013
69 Ga0070665_100000085 3300005548 Bacteria 180238
70 Ga0070665_100022999 3300005548 Bacteria 6276
71 Ga0070665_100052652 3300005548 Bacteria 4082
72 Ga0068855_100000160 3300005563 Bacteria 86118
73 Ga0068855_100007970 3300005563 Bacteria 12797
74 Ga0068855_100008413 3300005563 Bacteria 12479
75 Ga0068855_100018649 3300005563 Bacteria 8343
76 Ga0070664_100038060 3300005564 Bacteria 4047
77 Ga0070664_100127507 3300005564 Bacteria 2233
78 Ga0068857_100013351 3300005577 Bacteria 7154
79 Ga0068857_100028953 3300005577 Bacteria 4888
80 Ga0068856_100000040 3300005614 Bacteria 114443
81 Ga0068856_100008477 3300005614 Bacteria 10002
82 Ga0068856_100023288 3300005614 Bacteria 6023
83 Ga0068856_100031691 3300005614 Bacteria 5173
84 Ga0068856_100109161 3300005614 Bacteria 2763
85 Ga0068856_100282143 3300005614 Bacteria 1678
86 Ga0068852_100020039 3300005616 Bacteria 5311
87 Ga0068861_100003233 3300005719 Bacteria 10780
88 Ga0068861_100036848 3300005719 Bacteria 3633
89 Ga0068870_10007862 3300005840 Bacteria 4768
90 Ga0068863_100047224 3300005841 Bacteria 4085
91 Ga0068860_100013399 3300005843 Bacteria 8040
92 Ga0068862_100000816 3300005844 Bacteria 30859
93 Ga0068862_100024532 3300005844 Bacteria 5061
94 Ga0068862_100327363 3300005844 Bacteria 1416
95 Ga0081539_10019249 3300005985 Bacteria 4683
96 Ga0070717_10000084 3300006028 Bacteria 74786
97 Ga0070712_100017385 3300006175 Bacteria 4657
98 Ga0068871_100000382 3300006358 Bacteria 31056
99 Ga0075430_100008907 3300006846 Bacteria 8471
100 Ga0075430_100015329 3300006846 Bacteria 6528
101 Ga0075430_100018374 3300006846 Bacteria 5949
102 Ga0075430_100135677 3300006846 Bacteria 2050
103 Ga0075431_100013349 3300006847 Bacteria 8301
104 Ga0075431_100017458 3300006847 Bacteria 7294
105 Ga0075431_100048818 3300006847 Bacteria 4365
106 Ga0075431_100087293 3300006847 Bacteria 3219
107 Ga0075431_100150486 3300006847 Bacteria 2397
108 Ga0075433_10000533 3300006852 Bacteria 24984
109 Ga0075433_10060459 3300006852 Bacteria 3317
110 Ga0075434_100001317 3300006871 Bacteria 20733
111 Ga0075434_100005508 3300006871 Bacteria 11528
112 Ga0075429_100048238 3300006880 Bacteria 3704
113 Ga0068865_100004489 3300006881 Bacteria 8423
114 Ga0075436_100017159 3300006914 Bacteria 4955
115 Ga0105244_10010375 3300009036 Bacteria 5652
116 Ga0105240_10016685 3300009093 Bacteria 9932
117 Ga0111539_10012706 3300009094 Bacteria 10545
118 Ga0111539_10013153 3300009094 Bacteria 10350
119 Ga0111539_10021338 3300009094 Bacteria 7973
120 Ga0111539_10030738 3300009094 Bacteria 6528
121 Ga0111539_10109609 3300009094 Bacteria 3240
122 Ga0111539_10184298 3300009094 Bacteria 2438
123 Ga0111539_10428618 3300009094 Bacteria 1540
124 Ga0114129_10007312 3300009147 Bacteria 15724
125 Ga0114129_10073643 3300009147 Bacteria 4758
126 Ga0105241_10000284 3300009174 Bacteria 37721
127 Ga0105248_10006266 3300009177 Bacteria 13044
128 Ga0105248_10006299 3300009177 Bacteria 13021
129 Ga0105248_10216547 3300009177 Bacteria 2157
130 Ga0105237_10000497 3300009545 Bacteria 55632
131 Ga0105237_10044274 3300009545 Bacteria 4481
132 Ga0105237_10090052 3300009545 Bacteria 3058
133 Ga0105238_10000452 3300009551 Bacteria 43023
134 Ga0105238_10020458 3300009551 Bacteria 6737
135 Ga0105249_10000166 3300009553 Bacteria 77555
136 Ga0105249_10002969 3300009553 Bacteria 14632
137 Ga0105239_10013533 3300010375 Bacteria 9056
138 Ga0105239_10017629 3300010375 Bacteria 7899
139 Ga0105239_10059127 3300010375 Bacteria 4207
140 Ga0105239_10083011 3300010375 Bacteria 3528
141 Ga0105239_10281424 3300010375 Bacteria 1872
142 Ga0157373_10005516 3300013100 Bacteria 9487
143 Ga0157371_10000224 3300013102 Bacteria 82657
144 Ga0157371_10027966 3300013102 Bacteria 4086
145 Ga0157371_10086807 3300013102 Bacteria 2216
146 Ga0157370_10001274 3300013104 Bacteria 31529
147 Ga0157370_10002047 3300013104 Bacteria 24775
148 Ga0157370_10002077 3300013104 Bacteria 24517
149 Ga0157370_10006655 3300013104 Bacteria 12695
150 Ga0157370_10014902 3300013104 Bacteria 7930
151 Ga0157369_10000158 3300013105 Bacteria 96395
152 Ga0157369_10011744 3300013105 Bacteria 9943
153 Ga0157369_10114883 3300013105 Bacteria 2858
154 Ga0157374_10000122 3300013296 Bacteria 70398
155 Ga0157374_10007611 3300013296 Bacteria 9245
156 Ga0157374_10253070 3300013296 Bacteria 1734
157 Ga0157378_10010983 3300013297 Bacteria 7925
158 Ga0157378_10028316 3300013297 Bacteria 4943
159 Ga0163162_10000011 3300013306 Bacteria 299877
160 Ga0163162_10000071 3300013306 Bacteria 94831
161 Ga0163162_10013519 3300013306 Bacteria 7970
162 Ga0157372_10073863 3300013307 Bacteria 3844
163 Ga0157375_10022874 3300013308 Bacteria 5759
164 Ga0157375_10026864 3300013308 Bacteria 5373
165 Ga0157375_10130502 3300013308 Bacteria 2632
166 Ga0157375_10196582 3300013308 Bacteria 2172
167 Ga0163163_10002326 3300014325 Bacteria 16061
168 Ga0157380_10000103 3300014326 Bacteria 47312
169 Ga0157380_10010252 3300014326 Bacteria 6734
170 Ga0157380_10024213 3300014326 Bacteria 4592
171 Ga0182008_10000046 3300014497 Bacteria 111777
172 Ga0182008_10000099 3300014497 Bacteria 66933
173 Ga0157379_10045293 3300014968 Bacteria 3927
174 Ga0182006_1000241 3300015261 Bacteria 51244
175 Ga0182006_1000397 3300015261 Bacteria 35456
176 Ga0182006_1000513 3300015261 Bacteria 29503
177 Ga0182007_10000008 3300015262 Bacteria 332953
178 Ga0183373_1002 3300015682 Bacteria 990153
179 Ga0163161_10000570 3300017792 Bacteria 29671
180 Ga0163161_10000650 3300017792 Bacteria 27726
181 Ga0163161_10003225 3300017792 Bacteria 11476
182 Ga0206349_1723532 3300020075 Bacteria 3582
183 Ga0206352_10291344 3300020078 Bacteria 3842
184 Ga0206350_10549468 3300020080 Bacteria 3373
185 Ga0213872_10015603 3300021361 Bacteria 3531
186 Ga0213875_10010425 3300021388 Bacteria 4651
187 Ga0207425_1000003 3300025245 Bacteria 1145342
188 Ga0209129_1000022 3300025258 Bacteria 440876
189 Ga0209676_1000022 3300025292 Bacteria 605659
190 Ga0209025_1000007 3300025294 Bacteria 1145109
191 Ga0209758_1000012 3300025297 Bacteria 949866
192 Ga0209050_1000020 3300025298 Bacteria 605671
193 Ga0207697_10002866 3300025315 Bacteria 8733
194 Ga0207682_10043921 3300025893 Bacteria 1831
195 Ga0207642_10058278 3300025899 Bacteria 1781
196 Ga0207688_10010308 3300025901 Bacteria 5087
197 Ga0207680_10104428 3300025903 Bacteria 1826
198 Ga0207647_10000146 3300025904 Bacteria 56177
199 Ga0207645_10000304 3300025907 Bacteria 41252
200 Ga0207645_10000502 3300025907 Bacteria 32417
201 Ga0207645_10036411 3300025907 Bacteria 3159
202 Ga0207645_10043536 3300025907 Bacteria 2874
203 Ga0207643_10003500 3300025908 Bacteria 8444
204 Ga0207705_10000032 3300025909 Bacteria 224376
205 Ga0207654_10000684 3300025911 Bacteria 18967
206 Ga0207707_10004096 3300025912 Bacteria 12914
207 Ga0207707_10006769 3300025912 Bacteria 10006
208 Ga0207671_10001098 3300025914 Bacteria 32717
209 Ga0207671_10001288 3300025914 Bacteria 29500
210 Ga0207671_10155922 3300025914 Bacteria 1766
211 Ga0207693_10043786 3300025915 Bacteria 3519
212 Ga0207663_10090519 3300025916 Bacteria 2028
213 Ga0207660_10000714 3300025917 Bacteria 22147
214 Ga0207660_10033058 3300025917 Bacteria 3575
215 Ga0207660_10075106 3300025917 Bacteria 2468
216 Ga0207662_10035778 3300025918 Bacteria 2901
217 Ga0207662_10039955 3300025918 Bacteria 2755
218 Ga0207657_10032892 3300025919 Bacteria 4679
219 Ga0207649_10014982 3300025920 Bacteria 4352
220 Ga0207652_10037605 3300025921 Bacteria 4097
221 Ga0207646_10001934 3300025922 Bacteria 24862
222 Ga0207681_10005448 3300025923 Bacteria 7814
223 Ga0207681_10028802 3300025923 Bacteria 3600
224 Ga0207694_10000117 3300025924 Bacteria 84322
225 Ga0207650_10016028 3300025925 Bacteria 5229
226 Ga0207650_10043828 3300025925 Bacteria 3286
227 Ga0207650_10153962 3300025925 Bacteria 1817
228 Ga0207659_10040943 3300025926 Bacteria 3243
229 Ga0207659_10173737 3300025926 Bacteria 1701
230 Ga0207700_10075577 3300025928 Bacteria 2611
231 Ga0207664_10000005 3300025929 Bacteria 485048
232 Ga0207690_10006656 3300025932 Bacteria 6846
233 Ga0207706_10000007 3300025933 Bacteria 211081
234 Ga0207706_10000174 3300025933 Bacteria 71663
235 Ga0207706_10000821 3300025933 Bacteria 32232
236 Ga0207706_10045859 3300025933 Bacteria 3871
237 Ga0207704_10000033 3300025938 Bacteria 101319
238 Ga0207704_10080904 3300025938 Bacteria 2099
239 Ga0207691_10006208 3300025940 Bacteria 11543
240 Ga0207691_10023738 3300025940 Bacteria 5773
241 Ga0207691_10025991 3300025940 Bacteria 5495
242 Ga0207689_10003328 3300025942 Bacteria 14718
243 Ga0207661_10016044 3300025944 Bacteria 5522
244 Ga0207661_10027436 3300025944 Bacteria 4350
245 Ga0207679_10001218 3300025945 Bacteria 16351
246 Ga0207679_10009529 3300025945 Bacteria 6224
247 Ga0207679_10020967 3300025945 Bacteria 4422
248 Ga0207679_10094924 3300025945 Bacteria 2317
249 Ga0207667_10000033 3300025949 Bacteria 314353
250 Ga0207667_10025332 3300025949 Bacteria 6495
251 Ga0207667_10045540 3300025949 Bacteria 4645
252 Ga0207667_10056302 3300025949 Bacteria 4131
253 Ga0207667_10110825 3300025949 Bacteria 2831
254 Ga0207651_10038232 3300025960 Bacteria 3152
255 Ga0207712_10000257 3300025961 Bacteria 51458
256 Ga0207712_10006684 3300025961 Bacteria 7272
257 Ga0207677_10003937 3300026023 Bacteria 7904
258 Ga0207639_10086583 3300026041 Bacteria 2495
259 Ga0207708_10091826 3300026075 Bacteria 2342
260 Ga0207702_10000042 3300026078 Bacteria 150673
261 Ga0207702_10010102 3300026078 Bacteria 7909
262 Ga0207702_10084036 3300026078 Bacteria 2771
263 Ga0207702_10149566 3300026078 Bacteria 2123
264 Ga0207641_10071132 3300026088 Bacteria 2991
265 Ga0207641_10194265 3300026088 Bacteria 1867
266 Ga0207648_10000495 3300026089 Bacteria 43912
267 Ga0207648_10044580 3300026089 Bacteria 3891
268 Ga0207648_10123276 3300026089 Bacteria 2279
269 Ga0207676_10028692 3300026095 Bacteria 4159
270 Ga0207674_10001814 3300026116 Bacteria 27247
271 Ga0207674_10008367 3300026116 Bacteria 11968
272 Ga0207674_10011989 3300026116 Bacteria 9714
273 Ga0207675_100000030 3300026118 Bacteria 109178
274 Ga0207675_100004281 3300026118 Bacteria 13797
275 Ga0207683_10001591 3300026121 Bacteria 20448
276 Ga0207683_10064442 3300026121 Bacteria 3229
277 Ga0207698_10051132 3300026142 Bacteria 3157
278 Ga0209968_1002393 3300027526 Bacteria 2830
279 Ga0209999_1004753 3300027543 Bacteria 2442
280 Ga0209966_1001538 3300027695 Bacteria 4009
281 Ga0207428_10003182 3300027907 Bacteria 16071
282 Ga0207428_10049835 3300027907 Bacteria 3353
283 Ga0207428_10197151 3300027907 Bacteria 1516
284 Ga0268266_10000145 3300028379 Bacteria 135284
285 Ga0268266_10000195 3300028379 Bacteria 105788
286 Ga0268266_10016684 3300028379 Bacteria 6276
287 Ga0268265_10000382 3300028380 Bacteria 47511
288 Ga0268265_10081232 3300028380 Bacteria 2559
289 Ga0268264_10042033 3300028381 Bacteria 3782
290 Ga0265337_1006271 3300028556 Bacteria 4611
291 Ga0265319_1000031 3300028563 Bacteria 124456
292 Ga0265319_1002158 3300028563 Bacteria 10991
293 Ga0265319_1007126 3300028563 Bacteria 5070
294 Ga0265319_1013305 3300028563 Bacteria 3279
295 Ga0265319_1013667 3300028563 Bacteria 3215
296 Ga0265319_1015906 3300028563 Bacteria 2897
297 Ga0265334_10028650 3300028573 Bacteria 2236
298 Ga0265318_10000047 3300028577 Bacteria 123944
299 Ga0265323_10021619 3300028653 Bacteria 2465
300 Ga0265322_10005620 3300028654 Bacteria 3708
301 Ga0265336_10000203 3300028666 Bacteria 41432
302 Ga0265336_10011799 3300028666 Bacteria 2958
303 Ga0307517_10000335 3300028786 Bacteria 81908
304 Ga0307515_10133555 3300028794 Bacteria 2715
305 Ga0265338_10002735 3300028800 Bacteria 25878
306 Ga0265338_10036441 3300028800 Bacteria 4707
307 Ga0265324_10001061 3300029957 Bacteria 16598
308 Ga0265330_10000001 3300031235 Bacteria 499696
309 Ga0265332_10000007 3300031238 Bacteria 319429
310 Ga0265332_10063026 3300031238 Bacteria 1584
311 Ga0265328_10008901 3300031239 Bacteria 4113
312 Ga0265320_10000304 3300031240 Bacteria 40158
313 Ga0265320_10000511 3300031240 Bacteria 30140
314 Ga0265320_10000682 3300031240 Bacteria 25880
315 Ga0265320_10001147 3300031240 Bacteria 19490
316 Ga0265320_10002071 3300031240 Bacteria 14122
317 Ga0265320_10002105 3300031240 Bacteria 14006
318 Ga0265320_10003936 3300031240 Bacteria 9806
319 Ga0265320_10008287 3300031240 Bacteria 6366
320 Ga0265320_10008727 3300031240 Bacteria 6174
321 Ga0265320_10033755 3300031240 Bacteria 2610
322 Ga0265320_10036942 3300031240 Bacteria 2465
323 Ga0265320_10049699 3300031240 Bacteria 2041
324 Ga0265329_10004657 3300031242 Bacteria 5654
325 Ga0265329_10016286 3300031242 Bacteria 2579
326 Ga0265329_10024339 3300031242 Bacteria 2011
327 Ga0265331_10025085 3300031250 Bacteria 3011
328 Ga0265331_10036277 3300031250 Bacteria 2421
329 Ga0265327_10000114 3300031251 Bacteria 174833
330 Ga0265327_10001137 3300031251 Bacteria 36464
331 Ga0265327_10025786 3300031251 Bacteria 3418
332 Ga0265316_10000291 3300031344 Bacteria 56572
333 Ga0265316_10000593 3300031344 Bacteria 40526
334 Ga0265316_10001810 3300031344 Bacteria 22497
335 Ga0265316_10003908 3300031344 Bacteria 14933
336 Ga0265316_10015070 3300031344 Bacteria 6775
337 Ga0265316_10033247 3300031344 Bacteria 4202
338 Ga0265316_10087113 3300031344 Bacteria 2386
339 Ga0307408_100002995 3300031548 Bacteria 11686
340 Ga0265313_10006399 3300031595 Bacteria 8348
341 Ga0265313_10011901 3300031595 Bacteria 5369
342 Ga0265313_10026378 3300031595 Bacteria 3061
343 Ga0265313_10028223 3300031595 Bacteria 2921
344 Ga0307508_10000160 3300031616 Bacteria 80743
345 Ga0316575_10005725 3300031665 Unclassified 4439
346 Ga0265314_10000004 3300031711 Bacteria 939480
347 Ga0265314_10000902 3300031711 Bacteria 35158
348 Ga0265314_10001000 3300031711 Bacteria 33137
349 Ga0265314_10003110 3300031711 Bacteria 16330
350 Ga0265314_10005470 3300031711 Bacteria 11453
351 Ga0265314_10030165 3300031711 Bacteria 4017
352 Ga0265342_10000020 3300031712 Bacteria 175977
353 Ga0265342_10000042 3300031712 Bacteria 137664
354 Ga0265342_10059793 3300031712 Bacteria 2250
355 Ga0316576_10008515 3300031727 Bacteria 6550
356 Ga0316576_10037778 3300031727 Bacteria 3459
357 Ga0316576_10106006 3300031727 Bacteria 2104
358 Ga0316578_10029417 3300031728 Bacteria 3118
359 Ga0316578_10029436 3300031728 Bacteria 3117
360 Ga0307405_10000014 3300031731 Bacteria 226733
361 Ga0307405_10006917 3300031731 Bacteria 5628
362 Ga0316577_10036979 3300031733 Bacteria 2731
363 Ga0307413_10006943 3300031824 Bacteria 5214
364 Ga0307413_10032434 3300031824 Bacteria 2961
365 Ga0307410_10002168 3300031852 Bacteria 9328
366 Ga0307406_10002693 3300031901 Bacteria 9682
367 Ga0307406_10005012 3300031901 Bacteria 7218
368 Ga0307407_10000002 3300031903 Bacteria 323084
369 Ga0307412_10003708 3300031911 Bacteria 8482
370 Ga0307409_100000873 3300031995 Bacteria 13949
371 Ga0307409_100036744 3300031995 Bacteria 3604
372 Ga0307416_100000005 3300032002 Bacteria 477728
373 Ga0307416_100000883 3300032002 Bacteria 15809
374 Ga0307414_10000441 3300032004 Bacteria 21996
375 Ga0307414_10000599 3300032004 Bacteria 18579
376 Ga0307414_10030533 3300032004 Bacteria 3522
377 Ga0307414_10055678 3300032004 Bacteria 2770
378 Ga0307414_10164362 3300032004 Bacteria 1767
379 Ga0307414_10217265 3300032004 Bacteria 1567
380 Ga0307411_10017694 3300032005 Bacteria 4070
381 Ga0307411_10045463 3300032005 Bacteria 2824
382 Ga0307415_100002422 3300032126 Bacteria 9302
383 Ga0316583_10000117 3300032133 Bacteria 18503
384 Ga0316583_10005110 3300032133 Bacteria 4700
385 Ga0307510_10002118 3300033180 Bacteria 22455
386 Ga0316588_1001852 3300033528 Bacteria 3583
387 Ga0373959_0000121 3300034820 Bacteria 17060
388 Ga0373926_0036902 3300035083 Bacteria 1738
389 Ga0373939_0008876 3300035114 Bacteria 2477
390 Ga0373954_0073054 3300035118 Bacteria 1632
391 Ga0373957_0021278 3300035120 Bacteria 2301
392 Ga0373943_0009008 3300035170 Bacteria 4474
393 Ga0316574_0149023 3300035398 Bacteria 1508
394 Ga0373931_0009139 3300035691 Bacteria 4730
395 Ga0373927_0001839 3300035695 Bacteria 15763
396 Ga0316582_0055447 3300036647 Bacteria 2526
397 Ga0316582_0064276 3300036647 Bacteria 2360
398 Ga0316584_0037073 3300036712 Unclassified 3621
399 Ga0373925_0003109 3300037068 Bacteria 13025
400 Ga0395899_0009991 3300037312 Bacteria 7279
401 Ga0395899_0013861 3300037312 Bacteria 6158
402 Ga0395900_0000288 3300037418 Bacteria 75715
403 Ga0395900_0004910 3300037418 Bacteria 14077
404 Ga0395900_0011864 3300037418 Bacteria 8913
405 Ga0395900_0033960 3300037418 Bacteria 5250
406 Ga0395900_0074201 3300037418 Bacteria 3498
407 Ga0395898_0012362 3300037466 Bacteria 8829
408 Ga0395905_0000015 3300037471 Bacteria 393880
409 Ga0395905_0001824 3300037471 Bacteria 24610
410 Ga0395905_0007495 3300037471 Bacteria 10856
411 Ga0395905_0019020 3300037471 Bacteria 6513
412 Ga0395905_0054874 3300037471 Bacteria 3729
413 Ga0395905_0180647 3300037471 Bacteria 1981
414 Ga0436364_0839671 3300037853 Bacteria 17835
415 Ga0395901_0009188 3300038443 Bacteria 10015
416 Ga0395901_0017502 3300038443 Bacteria 7314
417 Ga0395901_0196798 3300038443 Bacteria 2113
418 Ga0400489_96379 3300039093 Bacteria 5990
419 Ga0436361_1222875 3300039447 Bacteria 13496
420 Ga0451577_0000012 3300042876 Bacteria 575467
421 Ga0451577_0000050 3300042876 Bacteria 301123
422 Ga0451577_0000159 3300042876 Bacteria 148522
423 Ga0451577_0000535 3300042876 Bacteria 62424
424 Ga0451577_0101827 3300042876 Bacteria 2566
425 Ga0451577_0199008 3300042876 Bacteria 1808
426 Ga0466972_0002085 3300044658 Bacteria 9796
427 Ga0453683_0000537 3300044673 Bacteria 42325
428 Ga0453683_0001530 3300044673 Bacteria 19722
429 Ga0453683_0006064 3300044673 Bacteria 8330
430 Ga0453683_0018020 3300044673 Bacteria 4536
431 Ga0466961_0002746 3300044693 Bacteria 10947
432 Ga0466961_0006964 3300044693 Bacteria 7191
433 Ga0466963_0160845 3300044694 Bacteria 1563
434 Ga0453684_0000045 3300044712 Bacteria 582917
435 Ga0453684_0000404 3300044712 Bacteria 177839
436 Ga0453684_0004549 3300044712 Bacteria 29034
437 Ga0453684_0009194 3300044712 Bacteria 17363
438 Ga0453684_0011011 3300044712 Bacteria 15279
439 Ga0453684_0020747 3300044712 Bacteria 9884
440 Ga0453684_0025247 3300044712 Bacteria 8636
441 Ga0453684_0038838 3300044712 Bacteria 6496
442 Ga0453684_0042461 3300044712 Bacteria 6129
443 Ga0453684_0045086 3300044712 Bacteria 5886
444 Ga0453684_0074377 3300044712 Unclassified 4278
445 Ga0453684_0083225 3300044712 Bacteria 3983
446 Ga0453684_0089717 3300044712 Bacteria 3800
447 Ga0453684_0095591 3300044712 Bacteria 3651
448 Ga0453684_0130641 3300044712 Bacteria 3014
449 Ga0453684_0253289 3300044712 Unclassified 2021
450 Ga0466959_0003937 3300045049 Bacteria 9863
451 Ga0451576_0000244 3300045051 Bacteria 133298
452 Ga0451576_0000939 3300045051 Bacteria 54953
453 Ga0451576_0001111 3300045051 Bacteria 49021
454 Ga0451576_0002731 3300045051 Bacteria 25627
455 Ga0451576_0003015 3300045051 Bacteria 23796
456 Ga0451576_0011060 3300045051 Bacteria 10302
457 Ga0451576_0042352 3300045051 Bacteria 4807
458 Ga0451576_0054033 3300045051 Bacteria 4206
459 Ga0451576_0085442 3300045051 Bacteria 3282
460 Ga0451576_0097568 3300045051 Bacteria 3056
461 Ga0495627_009190 3300046453 Bacteria 3647
462 Ga0495592_0127573 3300046454 Bacteria 1783
463 Ga0495603_0051928 3300046455 Bacteria 2435
464 Ga0495582_0010050 3300046473 Bacteria 5209
465 Ga0495639_0020073 3300046475 Bacteria 2919
466 Ga0495610_0000204 3300046512 Bacteria 65887
467 Ga0495610_0000279 3300046512 Bacteria 53150
468 Ga0495618_0079719 3300046514 Bacteria 2089
469 Ga0495628_0032791 3300046516 Bacteria 4190
470 Ga0495630_0020425 3300046517 Bacteria 4884
471 Ga0495631_0012861 3300046518 Bacteria 4076
472 Ga0495637_0008596 3300046520 Bacteria 5011
473 Ga0495643_0000008 3300046522 Bacteria 367010
474 Ga0495640_0037262 3300046533 Bacteria 3431
475 Ga0495587_0001600 3300046536 Bacteria 15066
476 Ga0495609_0010103 3300046538 Bacteria 4541
477 Ga0495645_0000867 3300046543 Bacteria 20621
478 Ga0495645_0079323 3300046543 Bacteria 2358
479 Ga0495657_0042941 3300046675 Bacteria 3084
480 Ga0495599_0007492 3300046678 Bacteria 6617
481 Ga0495623_0066645 3300046679 Bacteria 2249
482 Ga0495623_0070843 3300046679 Bacteria 2171
483 Ga0495658_0000860 3300046683 Bacteria 16338
484 Ga0495658_0072222 3300046683 Bacteria 2007
485 Ga0495613_0011460 3300046689 Bacteria 6592
486 Ga0495649_0038454 3300046694 Bacteria 2625
487 Ga0495600_0149492 3300046809 Bacteria 1513
488 Ga0495604_0138469 3300047317 Bacteria 1742
489 Ga0495604_0150433 3300047317 Bacteria 1655
490 Ga0495674_0094823 3300047319 Bacteria 2545
491 Ga0495680_0026573 3300047322 Bacteria 4769
492 Ga0495683_0011040 3300047323 Bacteria 4764
493 Ga0495687_000846 3300047443 Bacteria 32608
494 Ga0495675_0004167 3300047444 Bacteria 8747
495 Ga0495675_0040387 3300047444 Bacteria 2973
496 Ga0495681_0059871 3300047470 Bacteria 1759
497 Ga0495684_0036329 3300047471 Bacteria 3778
498 Ga0495684_0078398 3300047471 Bacteria 2507
499 Ga0495602_0050021 3300048088 Bacteria 3738
500 Ga0496114_0129403 3300048917 Bacteria 2179
501 Ga0496115_0063732 3300048918 Bacteria 2974
502 Ga0496122_0001886 3300048925 Bacteria 31745
503 Ga0496123_0001009 3300048926 Bacteria 43009
504 Ga0496125_0039297 3300048928 Bacteria 4077
505 Ga0501300_001025 3300049523 Bacteria 4280
506 Ga0501031_0004307 3300049568 Bacteria 9209
507 Ga0501031_0023432 3300049568 Bacteria 4024
508 Ga0501031_0038101 3300049568 Bacteria 3138
509 Ga0501031_0044989 3300049568 Bacteria 2880
510 Ga0501032_0001732 3300049569 Bacteria 17254
511 Ga0501032_0004297 3300049569 Bacteria 10756
512 Ga0501032_0043891 3300049569 Bacteria 3027
513 Ga0501032_0050388 3300049569 Bacteria 2808
514 Ga0501033_0002253 3300049570 Bacteria 16524
515 Ga0501033_0008553 3300049570 Bacteria 7918
516 Ga0501033_0012666 3300049570 Bacteria 6433
517 Ga0501033_0211596 3300049570 Bacteria 1382
518 Ga0501034_0000125 3300049571 Bacteria 142404
519 Ga0501034_0037200 3300049571 Bacteria 4928
520 Ga0501034_0040028 3300049571 Bacteria 4746
521 Ga0501036_0000962 3300049572 Bacteria 21725
522 Ga0501036_0003927 3300049572 Bacteria 11943
523 Ga0501036_0056961 3300049572 Bacteria 3311
524 Ga0501037_0003185 3300049573 Bacteria 11910
525 Ga0501037_0057278 3300049573 Bacteria 2845
526 Ga0501038_0014653 3300049574 Bacteria 7145
527 Ga0501038_0030360 3300049574 Bacteria 4784
528 Ga0501038_0034137 3300049574 Bacteria 4475
529 Ga0501039_0005683 3300049575 Bacteria 9446
530 Ga0501039_0016007 3300049575 Bacteria 5743
531 Ga0501039_0068102 3300049575 Bacteria 2764
532 Ga0501040_0001497 3300049576 Bacteria 14819
533 Ga0501040_0001628 3300049576 Bacteria 14311
534 Ga0501040_0007040 3300049576 Bacteria 7289
535 Ga0501040_0050329 3300049576 Bacteria 2850
536 Ga0501040_0062930 3300049576 Bacteria 2552
537 Ga0501041_0007461 3300049577 Bacteria 6420
538 Ga0501041_0049065 3300049577 Bacteria 2571
539 Ga0501042_0001740 3300049578 Bacteria 13019
540 Ga0501042_0004659 3300049578 Bacteria 8754
541 Ga0501043_0010753 3300049579 Bacteria 7167
542 Ga0501046_0005050 3300049580 Bacteria 11831
543 Ga0501046_0016304 3300049580 Bacteria 6226
544 Ga0501046_0087211 3300049580 Bacteria 2405
545 Ga0501046_0199467 3300049580 Bacteria 1489
546 Ga0501047_0002621 3300049581 Bacteria 17112
547 Ga0501047_0007049 3300049581 Bacteria 10552
548 Ga0501047_0007086 3300049581 Bacteria 10525
549 Ga0501047_0019296 3300049581 Bacteria 6541
550 Ga0501048_0001530 3300049582 Bacteria 17531
551 Ga0501048_0004838 3300049582 Bacteria 10263
552 Ga0501048_0049015 3300049582 Bacteria 3011
553 Ga0501048_0111361 3300049582 Bacteria 1933
554 Ga0501067_0056436 3300049583 Bacteria 2175
555 Ga0501068_0011386 3300049584 Bacteria 5022
556 Ga0501068_0015491 3300049584 Bacteria 4380
557 Ga0501070_0062007 3300049586 Bacteria 3097
558 Ga0501070_0230605 3300049586 Bacteria 1517
559 Ga0501071_0000248 3300049587 Bacteria 25026
560 Ga0501071_0003304 3300049587 Bacteria 10077
561 Ga0501071_0017385 3300049587 Bacteria 4959
562 Ga0501071_0048720 3300049587 Bacteria 3048
563 Ga0501072_0000230 3300049588 Bacteria 41301
564 Ga0501072_0000583 3300049588 Bacteria 26327
565 Ga0501072_0025684 3300049588 Bacteria 4589
566 Ga0501072_0036554 3300049588 Bacteria 3850
567 Ga0501072_0037771 3300049588 Bacteria 3788
568 Ga0501073_0053398 3300049589 Bacteria 2829
569 Ga0501074_0003576 3300049590 Bacteria 11024
570 Ga0501074_0011788 3300049590 Bacteria 6355
571 Ga0501074_0021501 3300049590 Bacteria 4684
572 Ga0501074_0115455 3300049590 Bacteria 1921
573 Ga0501075_0000921 3300049591 Bacteria 18662
574 Ga0501075_0003162 3300049591 Bacteria 11022
575 Ga0501075_0047279 3300049591 Bacteria 3234
576 Ga0501075_0212763 3300049591 Bacteria 1474
577 Ga0501076_0002914 3300049592 Bacteria 11857
578 Ga0501076_0012610 3300049592 Bacteria 6323
579 Ga0501076_0037552 3300049592 Bacteria 3799
580 Ga0501076_0056271 3300049592 Bacteria 3121
581 Ga0501077_0000967 3300049593 Bacteria 17317
582 Ga0501077_0008584 3300049593 Bacteria 6334
583 Ga0501077_0032762 3300049593 Bacteria 3309
584 Ga0501079_0001980 3300049741 Bacteria 14676
585 Ga0501079_0008321 3300049741 Bacteria 7861
586 Ga0501079_0009574 3300049741 Bacteria 7346
587 Ga0501079_0024226 3300049741 Bacteria 4658
588 Ga0501079_0028692 3300049741 Bacteria 4271
589 Ga0501079_0178677 3300049741 Bacteria 1656
590 Ga0501079_0204989 3300049741 Bacteria 1540
591 Ga0501080_0012626 3300049742 Bacteria 7745
592 Ga0501080_0027017 3300049742 Bacteria 5336
593 Ga0501080_0046318 3300049742 Bacteria 4049
594 Ga0501080_0168914 3300049742 Bacteria 2018
595 Ga0501081_0004544 3300049743 Bacteria 8908
596 Ga0501081_0017611 3300049743 Bacteria 4733
597 Ga0501081_0027229 3300049743 Bacteria 3857
598 Ga0501083_0004940 3300049744 Bacteria 9441
599 Ga0501083_0009550 3300049744 Bacteria 6853
600 Ga0501035_0000808 3300049822 Bacteria 33357
601 Ga0501035_0003769 3300049822 Bacteria 14445
602 Ga0501035_0027792 3300049822 Bacteria 5170
603 Ga0501044_0000948 3300049823 Bacteria 34820
604 Ga0501044_0003677 3300049823 Bacteria 17243
605 Ga0501044_0005909 3300049823 Bacteria 13556
606 Ga0501044_0044898 3300049823 Bacteria 4582
607 Ga0501044_0045662 3300049823 Bacteria 4538
608 Ga0501044_0181226 3300049823 Bacteria 2073
609 Ga0501045_0058154 3300049824 Bacteria 2830
610 Ga0501045_0130871 3300049824 Bacteria 1865
611 Ga0501045_0168445 3300049824 Bacteria 1632
612 nmdc:mga05p37_67250_c1 3300050507 Bacteria 4408
613 nmdc:mga05p37_80195_c1 3300050507 Bacteria 4020
614 nmdc:mga09592_40450_c1 3300050508 Bacteria 3916
615 nmdc:mga0qj67_19765_c1 3300050509 Bacteria 5151
616 nmdc:mga0qj67_228842_c1 3300050509 Bacteria 1509
617 nmdc:mga0qj67_77631_c1 3300050509 Bacteria 2657
618 nmdc:mga0qj67_9943_c1 3300050509 Bacteria 7094
619 nmdc:mga06r32_214693_c1 3300050510 Bacteria 1912
620 nmdc:mga06r32_3015_c1 3300050510 Bacteria 15088
621 nmdc:mga08y16_100926_c1 3300050511 Bacteria 3004
622 nmdc:mga08y16_178166_c1 3300050511 Bacteria 2208
623 nmdc:mga08y16_189096_c1 3300050511 Bacteria 2136
624 nmdc:mga08y16_54753_c1 3300050511 Bacteria 4169
625 nmdc:mga08y16_56061_c1 3300050511 Bacteria 4119
626 nmdc:mga08y16_9329_c1 3300050511 Bacteria 10290
627 nmdc:mga0n895_5273_c1 3300050512 Bacteria 10764
628 nmdc:mga0n895_7562_c1 3300050512 Bacteria 9338
629 nmdc:mga0rr50_128421_c1 3300050513 Bacteria 2026
630 nmdc:mga0a205_205925_c1 3300050515 Bacteria 1856
631 nmdc:mga0a205_35_c2 3300050515 Bacteria 29549
632 nmdc:mga0a205_43268_c1 3300050515 Bacteria 4343
633 nmdc:mga0a205_89145_c1 3300050515 Bacteria 2982
634 Ga0495619_0028219 3300053085 Bacteria 3620
635 Ga0500608_000658 3300053122 Bacteria 12674
636 Ga0500608_001920 3300053122 Bacteria 7424
637 Ga0500628_000545 3300053129 Bacteria 6913
638 Ga0501084_0001875 3300054114 Bacteria 16748
639 Ga0501084_0020561 3300054114 Bacteria 5504
640 Ga0501084_0156114 3300054114 Bacteria 1924
641 Ga0501082_0005720 3300060353 Bacteria 10783
642 Ga0501082_0012335 3300060353 Bacteria 7347
643 Ga0530510_0004515 3300061734 Bacteria 9636
644 Ga0530510_0017071 3300061734 Bacteria 5140
645 Ga0530510_0023788 3300061734 Bacteria 4367
646 Ga0530510_0025855 3300061734 Bacteria 4198
647 Ga0530510_0060517 3300061734 Bacteria 2741

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050515 nmdc:mga0a205_89145_c1 nmdc:mga0a205_89145_c1_1908_2918 329
2 3300050511 nmdc:mga08y16_100926_c1 nmdc:mga08y16_100926_c1_16_1071 348
3 3300003320 rootH2_10061209 rootH2_100612093 352
4 3300050513 nmdc:mga0rr50_128421_c1 nmdc:mga0rr50_128421_c1_918_2015 356
5 3300049741 Ga0501079_0178677 Ga0501079_0178677_235_1581 378
6 3300005329 Ga0070683_100056033 Ga0070683_1000560333 386
7 3300025944 Ga0207661_10027436 Ga0207661_100274363 386
8 3300049569 Ga0501032_0001732 Ga0501032_0001732_4388_5743 386
9 3300049580 Ga0501046_0005050 Ga0501046_0005050_10235_11590 386
10 3300049581 Ga0501047_0007086 Ga0501047_0007086_1052_2407 386
11 3300049823 Ga0501044_0003677 Ga0501044_0003677_4438_5793 386
12 3300028794 Ga0307515_10133555 Ga0307515_101335553 387
13 3300044712 Ga0453684_0083225 Ga0453684_0083225_1805_3148 387
14 3300028563 Ga0265319_1000031 Ga0265319_100003127 392
15 3300031240 Ga0265320_10000682 Ga0265320_1000068220 392
16 3300031595 Ga0265313_10026378 Ga0265313_100263782 392
17 3300031711 Ga0265314_10000902 Ga0265314_1000090226 392
18 3300049571 Ga0501034_0000125 Ga0501034_0000125_105641_107191 393
19 3300031240 Ga0265320_10003936 Ga0265320_100039369 394
20 3300031240 Ga0265320_10036942 Ga0265320_100369422 395
21 3300049571 Ga0501034_0037200 Ga0501034_0037200_2553_3872 397
22 3300006846 Ga0075430_100015329 Ga0075430_1000153294 399
23 3300037471 Ga0395905_0000015 Ga0395905_0000015_140678_142021 401
24 3300031251 Ga0265327_10000114 Ga0265327_1000011489 402
25 3300031595 Ga0265313_10028223 Ga0265313_100282231 402
26 3300005471 Ga0070698_100000023 Ga0070698_10000002328 403
27 3300006880 Ga0075429_100048238 Ga0075429_1000482381 403
28 3300050508 nmdc:mga09592_40450_c1 nmdc:mga09592_40450_c1_2400_3716 403
29 3300044712 Ga0453684_0045086 Ga0453684_0045086_2916_4238 405
30 3300049575 Ga0501039_0068102 Ga0501039_0068102_454_1797 405
31 3300005530 Ga0070679_100030130 Ga0070679_1000301301 406
32 3300025921 Ga0207652_10037605 Ga0207652_100376054 406
33 3300028563 Ga0265319_1007126 Ga0265319_10071263 406
34 3300028563 Ga0265319_1015906 Ga0265319_10159063 406
35 3300031240 Ga0265320_10001147 Ga0265320_100011477 406
36 3300005518 Ga0070699_100000898 Ga0070699_1000008988 407
37 3300005546 Ga0070696_100000338 Ga0070696_10000033828 407
38 3300026078 Ga0207702_10149566 Ga0207702_101495662 407
39 3300031727 Ga0316576_10008515 Ga0316576_100085158 407
40 3300005327 Ga0070658_10047350 Ga0070658_100473501 408
41 3300028577 Ga0265318_10000047 Ga0265318_10000047123 408
42 3300028653 Ga0265323_10021619 Ga0265323_100216192 408
43 3300031240 Ga0265320_10002105 Ga0265320_100021052 408
44 3300031240 Ga0265320_10008287 Ga0265320_100082875 408
45 3300031250 Ga0265331_10025085 Ga0265331_100250853 408
46 3300031595 Ga0265313_10011901 Ga0265313_100119017 408
47 3300031711 Ga0265314_10030165 Ga0265314_100301651 408
48 3300005331 Ga0070670_100170075 Ga0070670_1001700752 409
49 3300005548 Ga0070665_100022999 Ga0070665_1000229995 409
50 3300028379 Ga0268266_10016684 Ga0268266_100166845 409
51 3300032133 Ga0316583_10000117 Ga0316583_1000011718 409
52 3300044712 Ga0453684_0000045 Ga0453684_0000045_148439_149782 409
53 3300049568 Ga0501031_0044989 Ga0501031_0044989_518_1861 409
54 3300049569 Ga0501032_0004297 Ga0501032_0004297_3779_5122 409
55 3300049570 Ga0501033_0002253 Ga0501033_0002253_7171_8514 409
56 3300049572 Ga0501036_0003927 Ga0501036_0003927_6774_8117 409
57 3300049573 Ga0501037_0003185 Ga0501037_0003185_3797_5140 409
58 3300049574 Ga0501038_0014653 Ga0501038_0014653_1123_2466 409
59 3300049581 Ga0501047_0007049 Ga0501047_0007049_6767_8110 409
60 3300049582 Ga0501048_0001530 Ga0501048_0001530_10771_12114 409
61 3300049742 Ga0501080_0046318 Ga0501080_0046318_1176_2519 409
62 3300049822 Ga0501035_0003769 Ga0501035_0003769_7468_8811 409
63 3300049823 Ga0501044_0045662 Ga0501044_0045662_2352_3695 409
64 3300006028 Ga0070717_10000084 Ga0070717_1000008424 410
65 3300028563 Ga0265319_1002158 Ga0265319_100215813 410
66 3300031240 Ga0265320_10000511 Ga0265320_100005112 410
67 3300031711 Ga0265314_10003110 Ga0265314_100031106 410
68 3300049823 Ga0501044_0181226 Ga0501044_0181226_713_2032 410
69 3300003320 rootH2_10000579 rootH2_10000579132 411
70 3300025925 Ga0207650_10153962 Ga0207650_101539622 411
71 3300031251 Ga0265327_10001137 Ga0265327_100011377 411
72 3300032005 Ga0307411_10045463 Ga0307411_100454631 411
73 3300044712 Ga0453684_0253289 Ga0453684_0253289_160_1494 411
74 3300046455 Ga0495603_0051928 Ga0495603_0051928_823_2160 411
75 3300047319 Ga0495674_0094823 Ga0495674_0094823_447_1784 411
76 3300047471 Ga0495684_0078398 Ga0495684_0078398_569_1906 411
77 3300031616 Ga0307508_10000160 Ga0307508_1000016052 412
78 3300032004 Ga0307414_10030533 Ga0307414_100305332 412
79 3300049581 Ga0501047_0002621 Ga0501047_0002621_12638_14002 412
80 3300049822 Ga0501035_0000808 Ga0501035_0000808_31934_33298 412
81 3300049823 Ga0501044_0000948 Ga0501044_0000948_9810_11174 412
82 3300010375 Ga0105239_10083011 Ga0105239_100830113 413
83 3300031251 Ga0265327_10025786 Ga0265327_100257862 413
84 3300009094 Ga0111539_10012706 Ga0111539_100127067 415
85 3300027907 Ga0207428_10197151 Ga0207428_101971511 415
86 3300031727 Ga0316576_10106006 Ga0316576_101060062 415
87 3300031728 Ga0316578_10029436 Ga0316578_100294362 415
88 3300031733 Ga0316577_10036979 Ga0316577_100369792 415
89 3300050511 nmdc:mga08y16_9329_c1 nmdc:mga08y16_9329_c1_1123_2454 415
90 3300005329 Ga0070683_100000678 Ga0070683_10000067822 416
91 3300005435 Ga0070714_100000352 Ga0070714_1000003527 416
92 3300005614 Ga0068856_100031691 Ga0068856_1000316915 416
93 3300025929 Ga0207664_10000005 Ga0207664_10000005360 416
94 3300028666 Ga0265336_10000203 Ga0265336_1000020323 416
95 3300029957 Ga0265324_10001061 Ga0265324_100010612 416
96 3300031711 Ga0265314_10001000 Ga0265314_100010009 416
97 3300042876 Ga0451577_0000012 Ga0451577_0000012_1126_2469 416
98 3300009545 Ga0105237_10000497 Ga0105237_1000049732 417
99 3300013104 Ga0157370_10002077 Ga0157370_100020778 417
100 3300014326 Ga0157380_10000103 Ga0157380_1000010327 417
101 3300014497 Ga0182008_10000099 Ga0182008_1000009926 417
102 3300015261 Ga0182006_1000513 Ga0182006_100051312 417
103 3300025914 Ga0207671_10001098 Ga0207671_1000109824 417
104 3300032004 Ga0307414_10000441 Ga0307414_100004412 417
105 3300032004 Ga0307414_10055678 Ga0307414_100556782 417
106 3300037418 Ga0395900_0074201 Ga0395900_0074201_1367_2938 417
107 3300037471 Ga0395905_0180647 Ga0395905_0180647_219_1790 417
108 3300048917 Ga0496114_0129403 Ga0496114_0129403_294_1628 417
109 3300048918 Ga0496115_0063732 Ga0496115_0063732_564_1898 417
110 3300048925 Ga0496122_0001886 Ga0496122_0001886_23651_24991 417
111 3300048926 Ga0496123_0001009 Ga0496123_0001009_17192_18532 417
112 3300048928 Ga0496125_0039297 Ga0496125_0039297_1199_2539 417
113 3300049570 Ga0501033_0211596 Ga0501033_0211596_21_1364 417
114 3300032004 Ga0307414_10164362 Ga0307414_101643622 418
115 3300032004 Ga0307414_10217265 Ga0307414_102172651 418
116 3300049588 Ga0501072_0037771 Ga0501072_0037771_193_1515 418
117 3300013104 Ga0157370_10001274 Ga0157370_1000127414 419
118 3300028800 Ga0265338_10002735 Ga0265338_100027359 419
119 3300044694 Ga0466963_0160845 Ga0466963_0160845_38_1396 419
120 3300045051 Ga0451576_0000939 Ga0451576_0000939_17922_19310 419
121 3300045051 Ga0451576_0001111 Ga0451576_0001111_29509_31029 419
122 3300049823 Ga0501044_0005909 Ga0501044_0005909_10113_11456 419
123 3300005436 Ga0070713_100088940 Ga0070713_1000889402 420
124 3300025928 Ga0207700_10075577 Ga0207700_100755773 420
125 3300028563 Ga0265319_1013667 Ga0265319_10136672 420
126 3300031240 Ga0265320_10049699 Ga0265320_100496991 420
127 3300049569 Ga0501032_0043891 Ga0501032_0043891_1542_2885 420
128 3300049570 Ga0501033_0008553 Ga0501033_0008553_6156_7499 420
129 3300049573 Ga0501037_0057278 Ga0501037_0057278_244_1587 420
130 3300049742 Ga0501080_0168914 Ga0501080_0168914_633_1976 420
131 3300049744 Ga0501083_0004940 Ga0501083_0004940_8060_9403 420
132 3300005288 Ga0065714_10090708 Ga0065714_100907081 421
133 3300025916 Ga0207663_10090519 Ga0207663_100905191 421
134 3300025933 Ga0207706_10000821 Ga0207706_1000082128 421
135 3300031344 Ga0265316_10001810 Ga0265316_100018102 421
136 3300037312 Ga0395899_0009991 Ga0395899_0009991_2667_4022 421
137 3300037418 Ga0395900_0011864 Ga0395900_0011864_3121_4476 421
138 3300037471 Ga0395905_0007495 Ga0395905_0007495_2889_4244 421
139 3300037471 Ga0395905_0054874 Ga0395905_0054874_283_1635 421
140 3300038443 Ga0395901_0017502 Ga0395901_0017502_3093_4448 421
141 3300044693 Ga0466961_0002746 Ga0466961_0002746_6937_8292 421
142 3300049572 Ga0501036_0056961 Ga0501036_0056961_192_1496 421
143 3300049576 Ga0501040_0062930 Ga0501040_0062930_609_1913 421
144 3300049587 Ga0501071_0017385 Ga0501071_0017385_288_1592 421
145 3300049593 Ga0501077_0032762 Ga0501077_0032762_662_1966 421
146 3300049743 Ga0501081_0017611 Ga0501081_0017611_1131_2435 421
147 3300032133 Ga0316583_10005110 Ga0316583_100051103 422
148 3300047317 Ga0495604_0138469 Ga0495604_0138469_14_1351 422
149 3300049568 Ga0501031_0038101 Ga0501031_0038101_1194_2498 422
150 3300049570 Ga0501033_0012666 Ga0501033_0012666_3828_5174 422
151 3300049571 Ga0501034_0040028 Ga0501034_0040028_2141_3487 422
152 3300049574 Ga0501038_0034137 Ga0501038_0034137_981_2327 422
153 3300049579 Ga0501043_0010753 Ga0501043_0010753_3681_5027 422
154 3300049580 Ga0501046_0087211 Ga0501046_0087211_774_2120 422
155 3300049581 Ga0501047_0019296 Ga0501047_0019296_3690_5036 422
156 3300049741 Ga0501079_0009574 Ga0501079_0009574_5545_6849 422
157 3300049823 Ga0501044_0044898 Ga0501044_0044898_2209_3555 422
158 3300053129 Ga0500628_000545 Ga0500628_000545_2614_3984 422
159 3300054114 Ga0501084_0156114 Ga0501084_0156114_311_1615 422
160 3300005436 Ga0070713_100046337 Ga0070713_1000463372 423
161 3300005445 Ga0070708_100000006 Ga0070708_100000006113 423
162 3300005445 Ga0070708_100000177 Ga0070708_1000001773 423
163 3300005468 Ga0070707_100000323 Ga0070707_10000032345 423
164 3300005544 Ga0070686_100000094 Ga0070686_10000009463 423
165 3300005548 Ga0070665_100000085 Ga0070665_10000008595 423
166 3300013102 Ga0157371_10027966 Ga0157371_100279662 423
167 3300025922 Ga0207646_10001934 Ga0207646_1000193415 423
168 3300028379 Ga0268266_10000145 Ga0268266_100001458 423
169 3300035083 Ga0373926_0036902 Ga0373926_0036902_225_1562 423
170 3300035118 Ga0373954_0073054 Ga0373954_0073054_71_1408 423
171 3300035120 Ga0373957_0021278 Ga0373957_0021278_518_1855 423
172 3300042876 Ga0451577_0000159 Ga0451577_0000159_126395_127738 423
173 3300046475 Ga0495639_0020073 Ga0495639_0020073_523_1860 423
174 3300046516 Ga0495628_0032791 Ga0495628_0032791_209_1546 423
175 3300046517 Ga0495630_0020425 Ga0495630_0020425_3370_4707 423
176 3300046536 Ga0495587_0001600 Ga0495587_0001600_7437_8774 423
177 3300046543 Ga0495645_0000867 Ga0495645_0000867_18839_20176 423
178 3300046678 Ga0495599_0007492 Ga0495599_0007492_559_1896 423
179 3300046679 Ga0495623_0066645 Ga0495623_0066645_179_1516 423
180 3300046683 Ga0495658_0072222 Ga0495658_0072222_643_1980 423
181 3300046809 Ga0495600_0149492 Ga0495600_0149492_67_1404 423
182 3300047317 Ga0495604_0150433 Ga0495604_0150433_281_1618 423
183 3300047444 Ga0495675_0004167 Ga0495675_0004167_5563_6900 423
184 3300047471 Ga0495684_0036329 Ga0495684_0036329_43_1380 423
185 3300049744 Ga0501083_0009550 Ga0501083_0009550_1158_2501 423
186 3300009551 Ga0105238_10000452 Ga0105238_100004527 424
187 3300025924 Ga0207694_10000117 Ga0207694_1000011732 424
188 3300028666 Ga0265336_10011799 Ga0265336_100117992 424
189 3300013308 Ga0157375_10196582 Ga0157375_101965822 425
190 3300028556 Ga0265337_1006271 Ga0265337_10062712 425
191 3300028563 Ga0265319_1013305 Ga0265319_10133053 425
192 3300028573 Ga0265334_10028650 Ga0265334_100286501 425
193 3300031240 Ga0265320_10002071 Ga0265320_100020712 425
194 3300031240 Ga0265320_10033755 Ga0265320_100337551 425
195 3300031250 Ga0265331_10036277 Ga0265331_100362772 425
196 3300031595 Ga0265313_10006399 Ga0265313_100063992 425
197 3300031712 Ga0265342_10059793 Ga0265342_100597931 425
198 3300038443 Ga0395901_0196798 Ga0395901_0196798_630_1985 425
199 3300044673 Ga0453683_0001530 Ga0453683_0001530_16263_17606 425
200 3300044712 Ga0453684_0020747 Ga0453684_0020747_7111_8460 425
201 3300045051 Ga0451576_0002731 Ga0451576_0002731_21459_22841 425
202 3300045051 Ga0451576_0085442 Ga0451576_0085442_1167_2510 425
203 3300046538 Ga0495609_0010103 Ga0495609_0010103_2036_3376 425
204 3300046543 Ga0495645_0079323 Ga0495645_0079323_1021_2346 425
205 3300005328 Ga0070676_10026068 Ga0070676_100260682 426
206 3300005614 Ga0068856_100109161 Ga0068856_1001091612 426
207 3300013100 Ga0157373_10005516 Ga0157373_100055165 426
208 3300025907 Ga0207645_10036411 Ga0207645_100364112 426
209 3300025945 Ga0207679_10094924 Ga0207679_100949242 426
210 3300036647 Ga0316582_0055447 Ga0316582_0055447_139_1464 426
211 3300021388 Ga0213875_10010425 Ga0213875_100104254 427
212 3300031727 Ga0316576_10037778 Ga0316576_100377783 427
213 3300037853 Ga0436364_0839671 Ga0436364_0839671_4689_6047 427
214 3300045051 Ga0451576_0000244 Ga0451576_0000244_39655_40989 427
215 3300049576 Ga0501040_0007040 Ga0501040_0007040_370_1701 427
216 3300049580 Ga0501046_0199467 Ga0501046_0199467_87_1418 427
217 3300049741 Ga0501079_0204989 Ga0501079_0204989_67_1398 427
218 3300002773 JGI25152J39213_1000028 JGI25152J39213_100002827 428
219 3300002774 JGI25150J39212_1000006 JGI25150J39212_1000006164 428
220 3300003187 JGI25151J46595_10000024 JGI25151J46595_1000002427 428
221 3300003215 JGI25153J46596_10000026 JGI25153J46596_10000026165 428
222 3300003781 Ga0055536_1000002 Ga0055536_1000002262 428
223 3300003791 Ga0055530_10003410 Ga0055530_100034107 428
224 3300005288 Ga0065714_10064473 Ga0065714_1006447333 428
225 3300005328 Ga0070676_10037693 Ga0070676_100376932 428
226 3300005331 Ga0070670_100013603 Ga0070670_1000136036 428
227 3300005354 Ga0070675_100038100 Ga0070675_1000381001 428
228 3300005356 Ga0070674_100025138 Ga0070674_1000251382 428
229 3300005364 Ga0070673_100079694 Ga0070673_1000796941 428
230 3300005366 Ga0070659_100100132 Ga0070659_1001001321 428
231 3300005458 Ga0070681_10264003 Ga0070681_102640031 428
232 3300005543 Ga0070672_100016467 Ga0070672_1000164674 428
233 3300005544 Ga0070686_100050638 Ga0070686_1000506382 428
234 3300006852 Ga0075433_10060459 Ga0075433_100604592 428
235 3300009036 Ga0105244_10010375 Ga0105244_100103752 428
236 3300009177 Ga0105248_10006299 Ga0105248_100062999 428
237 3300013102 Ga0157371_10000224 Ga0157371_1000022447 428
238 3300013104 Ga0157370_10002047 Ga0157370_1000204720 428
239 3300013104 Ga0157370_10014902 Ga0157370_1001490212 428
240 3300013105 Ga0157369_10000158 Ga0157369_1000015877 428
241 3300013306 Ga0163162_10000011 Ga0163162_1000001137 428
242 3300013308 Ga0157375_10026864 Ga0157375_100268642 428
243 3300014497 Ga0182008_10000046 Ga0182008_1000004679 428
244 3300015261 Ga0182006_1000241 Ga0182006_100024112 428
245 3300015261 Ga0182006_1000397 Ga0182006_100039712 428
246 3300015262 Ga0182007_10000008 Ga0182007_1000000812 428
247 3300015682 Ga0183373_1002 Ga0183373_1002291 428
248 3300017792 Ga0163161_10000570 Ga0163161_1000057018 428
249 3300017792 Ga0163161_10000650 Ga0163161_1000065019 428
250 3300017792 Ga0163161_10003225 Ga0163161_1000322516 428
251 3300025245 Ga0207425_1000003 Ga0207425_1000003163 428
252 3300025258 Ga0209129_1000022 Ga0209129_1000022162 428
253 3300025292 Ga0209676_1000022 Ga0209676_1000022277 428
254 3300025294 Ga0209025_1000007 Ga0209025_1000007162 428
255 3300025297 Ga0209758_1000012 Ga0209758_1000012163 428
256 3300025298 Ga0209050_1000020 Ga0209050_1000020262 428
257 3300025907 Ga0207645_10043536 Ga0207645_100435362 428
258 3300025912 Ga0207707_10004096 Ga0207707_1000409611 428
259 3300025917 Ga0207660_10033058 Ga0207660_100330582 428
260 3300025917 Ga0207660_10075106 Ga0207660_100751062 428
261 3300025925 Ga0207650_10016028 Ga0207650_100160283 428
262 3300025926 Ga0207659_10173737 Ga0207659_101737372 428
263 3300025933 Ga0207706_10045859 Ga0207706_100458595 428
264 3300025940 Ga0207691_10006208 Ga0207691_100062089 428
265 3300025945 Ga0207679_10020967 Ga0207679_100209675 428
266 3300025960 Ga0207651_10038232 Ga0207651_100382324 428
267 3300031903 Ga0307407_10000002 Ga0307407_10000002246 428
268 3300031995 Ga0307409_100036744 Ga0307409_1000367442 428
269 3300032002 Ga0307416_100000005 Ga0307416_100000005244 428
270 3300032004 Ga0307414_10000599 Ga0307414_1000059919 428
271 3300044673 Ga0453683_0018020 Ga0453683_0018020_1585_2907 428
272 3300044712 Ga0453684_0011011 Ga0453684_0011011_12553_13884 428
273 3300045051 Ga0451576_0054033 Ga0451576_0054033_2768_4102 428
274 3300046453 Ga0495627_009190 Ga0495627_009190_762_2099 428
275 3300046512 Ga0495610_0000204 Ga0495610_0000204_14542_15879 428
276 3300046512 Ga0495610_0000279 Ga0495610_0000279_17784_19121 428
277 3300046520 Ga0495637_0008596 Ga0495637_0008596_1119_2456 428
278 3300047470 Ga0495681_0059871 Ga0495681_0059871_70_1407 428
279 3300031731 Ga0307405_10000014 Ga0307405_10000014151 429
280 3300034820 Ga0373959_0000121 Ga0373959_0000121_6029_7378 429
281 3300046473 Ga0495582_0010050 Ga0495582_0010050_3280_4596 429
282 3300046683 Ga0495658_0000860 Ga0495658_0000860_10449_11765 429
283 3300006871 Ga0075434_100001317 Ga0075434_10000131715 430
284 3300006914 Ga0075436_100017159 Ga0075436_1000171592 430
285 3300028654 Ga0265322_10005620 Ga0265322_100056203 430
286 3300028800 Ga0265338_10036441 Ga0265338_100364417 430
287 3300031238 Ga0265332_10063026 Ga0265332_100630262 430
288 3300031240 Ga0265320_10000304 Ga0265320_1000030415 430
289 3300031240 Ga0265320_10008727 Ga0265320_100087271 430
290 3300031242 Ga0265329_10004657 Ga0265329_100046573 430
291 3300031242 Ga0265329_10024339 Ga0265329_100243392 430
292 3300031344 Ga0265316_10000291 Ga0265316_1000029138 430
293 3300031344 Ga0265316_10015070 Ga0265316_100150702 430
294 3300031344 Ga0265316_10033247 Ga0265316_100332475 430
295 3300031711 Ga0265314_10005470 Ga0265314_100054702 430
296 3300031712 Ga0265342_10000042 Ga0265342_10000042114 430
297 3300042876 Ga0451577_0199008 Ga0451577_0199008_210_1625 430
298 3300050512 nmdc:mga0n895_7562_c1 nmdc:mga0n895_7562_c1_7000_8319 430
299 3300005985 Ga0081539_10019249 Ga0081539_100192492 431
300 3300009094 Ga0111539_10013153 Ga0111539_100131537 431
301 3300009094 Ga0111539_10184298 Ga0111539_101842982 431
302 3300013296 Ga0157374_10007611 Ga0157374_100076111 431
303 3300027526 Ga0209968_1002393 Ga0209968_10023934 431
304 3300027543 Ga0209999_1004753 Ga0209999_10047531 431
305 3300027695 Ga0209966_1001538 Ga0209966_10015382 431
306 3300027907 Ga0207428_10003182 Ga0207428_1000318214 431
307 3300035114 Ga0373939_0008876 Ga0373939_0008876_390_1811 431
308 3300035691 Ga0373931_0009139 Ga0373931_0009139_379_1800 431
309 3300035695 Ga0373927_0001839 Ga0373927_0001839_7258_8679 431
310 3300037068 Ga0373925_0003109 Ga0373925_0003109_5964_7385 431
311 3300046522 Ga0495643_0000008 Ga0495643_0000008_138565_139932 431
312 3300049568 Ga0501031_0023432 Ga0501031_0023432_46_1380 431
313 3300049575 Ga0501039_0005683 Ga0501039_0005683_7514_8848 431
314 3300049576 Ga0501040_0001628 Ga0501040_0001628_11545_12879 431
315 3300049577 Ga0501041_0049065 Ga0501041_0049065_1140_2474 431
316 3300049578 Ga0501042_0001740 Ga0501042_0001740_11645_12979 431
317 3300049582 Ga0501048_0004838 Ga0501048_0004838_2153_3487 431
318 3300049583 Ga0501067_0056436 Ga0501067_0056436_739_2073 431
319 3300049584 Ga0501068_0015491 Ga0501068_0015491_613_1947 431
320 3300049586 Ga0501070_0230605 Ga0501070_0230605_128_1462 431
321 3300049587 Ga0501071_0000248 Ga0501071_0000248_14786_16120 431
322 3300049588 Ga0501072_0000230 Ga0501072_0000230_21906_23240 431
323 3300049590 Ga0501074_0011788 Ga0501074_0011788_1387_2721 431
324 3300049591 Ga0501075_0003162 Ga0501075_0003162_1332_2666 431
325 3300049592 Ga0501076_0012610 Ga0501076_0012610_1949_3283 431
326 3300049593 Ga0501077_0008584 Ga0501077_0008584_1609_2943 431
327 3300049741 Ga0501079_0001980 Ga0501079_0001980_1480_2814 431
328 3300050511 nmdc:mga08y16_54753_c1 nmdc:mga08y16_54753_c1_1308_2789 431
329 3300054114 Ga0501084_0001875 Ga0501084_0001875_8777_10111 431
330 3300060353 Ga0501082_0005720 Ga0501082_0005720_1936_3270 431
331 3300061734 Ga0530510_0004515 Ga0530510_0004515_6694_8028 431
332 3300061734 Ga0530510_0017071 Ga0530510_0017071_2163_3497 431
333 3300031344 Ga0265316_10003908 Ga0265316_100039086 432
334 3300031824 Ga0307413_10032434 Ga0307413_100324342 432
335 3300035398 Ga0316574_0149023 Ga0316574_0149023_139_1473 432
336 3300049576 Ga0501040_0050329 Ga0501040_0050329_1211_2566 432
337 3300049582 Ga0501048_0111361 Ga0501048_0111361_457_1812 432
338 3300049586 Ga0501070_0062007 Ga0501070_0062007_61_1416 432
339 3300049590 Ga0501074_0021501 Ga0501074_0021501_190_1545 432
340 3300049591 Ga0501075_0047279 Ga0501075_0047279_970_2325 432
341 3300049742 Ga0501080_0012626 Ga0501080_0012626_5973_7328 432
342 3300005343 Ga0070687_100027438 Ga0070687_1000274383 433
343 3300005563 Ga0068855_100008413 Ga0068855_1000084138 433
344 3300006846 Ga0075430_100135677 Ga0075430_1001356771 433
345 3300006852 Ga0075433_10000533 Ga0075433_100005334 433
346 3300009094 Ga0111539_10428618 Ga0111539_104286181 433
347 3300013104 Ga0157370_10006655 Ga0157370_100066559 433
348 3300025918 Ga0207662_10039955 Ga0207662_100399553 433
349 3300025949 Ga0207667_10025332 Ga0207667_100253323 433
350 3300031235 Ga0265330_10000001 Ga0265330_10000001141 433
351 3300031238 Ga0265332_10000007 Ga0265332_1000000716 433
352 3300031239 Ga0265328_10008901 Ga0265328_100089012 433
353 3300031242 Ga0265329_10016286 Ga0265329_100162863 433
354 3300031344 Ga0265316_10000593 Ga0265316_1000059312 433
355 3300031711 Ga0265314_10000004 Ga0265314_10000004267 433
356 3300031712 Ga0265342_10000020 Ga0265342_1000002012 433
357 3300050509 nmdc:mga0qj67_77631_c1 nmdc:mga0qj67_77631_c1_445_1755 433
358 3300050510 nmdc:mga06r32_214693_c1 nmdc:mga06r32_214693_c1_566_1876 433
359 3300050515 nmdc:mga0a205_205925_c1 nmdc:mga0a205_205925_c1_276_1586 433
360 3300050515 nmdc:mga0a205_35_c2 nmdc:mga0a205_35_c2_5679_6989 433
361 3300005295 Ga0065707_10172506 Ga0065707_101725061 434
362 3300005438 Ga0070701_10045340 Ga0070701_100453402 434
363 3300005844 Ga0068862_100327363 Ga0068862_1003273631 434
364 3300006847 Ga0075431_100017458 Ga0075431_1000174583 434
365 3300009094 Ga0111539_10021338 Ga0111539_100213387 434
366 3300009094 Ga0111539_10109609 Ga0111539_101096093 434
367 3300028380 Ga0268265_10081232 Ga0268265_100812321 434
368 3300036712 Ga0316584_0037073 Ga0316584_0037073_1473_2798 434
369 3300049568 Ga0501031_0004307 Ga0501031_0004307_5340_6686 434
370 3300049569 Ga0501032_0050388 Ga0501032_0050388_108_1454 434
371 3300049572 Ga0501036_0000962 Ga0501036_0000962_4037_5383 434
372 3300049574 Ga0501038_0030360 Ga0501038_0030360_1804_3150 434
373 3300049575 Ga0501039_0016007 Ga0501039_0016007_1747_3093 434
374 3300049576 Ga0501040_0001497 Ga0501040_0001497_2818_4164 434
375 3300049577 Ga0501041_0007461 Ga0501041_0007461_4890_6236 434
376 3300049578 Ga0501042_0004659 Ga0501042_0004659_3423_4769 434
377 3300049580 Ga0501046_0016304 Ga0501046_0016304_3612_4958 434
378 3300049582 Ga0501048_0049015 Ga0501048_0049015_1264_2610 434
379 3300049584 Ga0501068_0011386 Ga0501068_0011386_1547_2893 434
380 3300049587 Ga0501071_0003304 Ga0501071_0003304_4644_5990 434
381 3300049588 Ga0501072_0000583 Ga0501072_0000583_414_1760 434
382 3300049588 Ga0501072_0036554 Ga0501072_0036554_504_1850 434
383 3300049589 Ga0501073_0053398 Ga0501073_0053398_1217_2563 434
384 3300049590 Ga0501074_0003576 Ga0501074_0003576_1532_2878 434
385 3300049591 Ga0501075_0000921 Ga0501075_0000921_14679_16025 434
386 3300049592 Ga0501076_0002914 Ga0501076_0002914_2912_4258 434
387 3300049593 Ga0501077_0000967 Ga0501077_0000967_15739_17085 434
388 3300049741 Ga0501079_0008321 Ga0501079_0008321_3711_5057 434
389 3300049742 Ga0501080_0027017 Ga0501080_0027017_1637_2983 434
390 3300049743 Ga0501081_0004544 Ga0501081_0004544_6158_7504 434
391 3300049822 Ga0501035_0027792 Ga0501035_0027792_1730_3076 434
392 3300049824 Ga0501045_0058154 Ga0501045_0058154_330_1676 434
393 3300049824 Ga0501045_0168445 Ga0501045_0168445_200_1546 434
394 3300050510 nmdc:mga06r32_3015_c1 nmdc:mga06r32_3015_c1_12515_14014 434
395 3300050511 nmdc:mga08y16_178166_c1 nmdc:mga08y16_178166_c1_61_1386 434
396 3300050511 nmdc:mga08y16_189096_c1 nmdc:mga08y16_189096_c1_172_1665 434
397 3300054114 Ga0501084_0020561 Ga0501084_0020561_2637_3983 434
398 3300060353 Ga0501082_0012335 Ga0501082_0012335_3140_4486 434
399 3300061734 Ga0530510_0025855 Ga0530510_0025855_2645_3991 434
400 iso_pu_bacteria 2910245624 2910248264 434
401 3300005466 Ga0070685_10001251 Ga0070685_100012511 435
402 3300006847 Ga0075431_100087293 Ga0075431_1000872932 435
403 3300009177 Ga0105248_10216547 Ga0105248_102165472 435
404 3300014325 Ga0163163_10002326 Ga0163163_100023262 435
405 3300026088 Ga0207641_10194265 Ga0207641_101942652 435
406 3300046679 Ga0495623_0070843 Ga0495623_0070843_809_2134 435
407 iso_pu_bacteria 2840878972 2840882349 435
408 iso_pu_bacteria 2919679072 2919679456 435
409 iso_pu_bacteria 3000405567 3000406685 435
410 3300004803 Ga0058862_10098900 Ga0058862_100989002 436
411 3300005328 Ga0070676_10005364 Ga0070676_100053643 436
412 3300005329 Ga0070683_100008171 Ga0070683_1000081714 436
413 3300005329 Ga0070683_100094279 Ga0070683_1000942792 436
414 3300005330 Ga0070690_100103228 Ga0070690_1001032282 436
415 3300005331 Ga0070670_100056181 Ga0070670_1000561812 436
416 3300005333 Ga0070677_10025567 Ga0070677_100255672 436
417 3300005334 Ga0068869_100028810 Ga0068869_1000288104 436
418 3300005335 Ga0070666_10053135 Ga0070666_100531352 436
419 3300005339 Ga0070660_100008762 Ga0070660_1000087624 436
420 3300005347 Ga0070668_100231260 Ga0070668_1002312601 436
421 3300005353 Ga0070669_100002402 Ga0070669_1000024025 436
422 3300005366 Ga0070659_100051470 Ga0070659_1000514701 436
423 3300005367 Ga0070667_100037119 Ga0070667_1000371195 436
424 3300005441 Ga0070700_100109521 Ga0070700_1001095211 436
425 3300005457 Ga0070662_100007268 Ga0070662_1000072682 436
426 3300005458 Ga0070681_10007157 Ga0070681_1000715713 436
427 3300005535 Ga0070684_100019725 Ga0070684_1000197256 436
428 3300005539 Ga0068853_100026595 Ga0068853_1000265952 436
429 3300005548 Ga0070665_100052652 Ga0070665_1000526525 436
430 3300005563 Ga0068855_100007970 Ga0068855_1000079707 436
431 3300005564 Ga0070664_100038060 Ga0070664_1000380602 436
432 3300005564 Ga0070664_100127507 Ga0070664_1001275071 436
433 3300005577 Ga0068857_100013351 Ga0068857_1000133512 436
434 3300005577 Ga0068857_100028953 Ga0068857_1000289532 436
435 3300005614 Ga0068856_100282143 Ga0068856_1002821432 436
436 3300005719 Ga0068861_100003233 Ga0068861_1000032336 436
437 3300005719 Ga0068861_100036848 Ga0068861_1000368485 436
438 3300005840 Ga0068870_10007862 Ga0068870_100078622 436
439 3300005841 Ga0068863_100047224 Ga0068863_1000472242 436
440 3300005843 Ga0068860_100013399 Ga0068860_1000133991 436
441 3300005844 Ga0068862_100000816 Ga0068862_10000081617 436
442 3300005844 Ga0068862_100024532 Ga0068862_1000245326 436
443 3300006175 Ga0070712_100017385 Ga0070712_1000173852 436
444 3300006846 Ga0075430_100008907 Ga0075430_1000089077 436
445 3300006846 Ga0075430_100018374 Ga0075430_1000183742 436
446 3300006847 Ga0075431_100013349 Ga0075431_1000133493 436
447 3300006847 Ga0075431_100048818 Ga0075431_1000488186 436
448 3300006847 Ga0075431_100150486 Ga0075431_1001504862 436
449 3300006871 Ga0075434_100005508 Ga0075434_1000055084 436
450 3300009094 Ga0111539_10030738 Ga0111539_100307382 436
451 3300009147 Ga0114129_10007312 Ga0114129_100073124 436
452 3300009147 Ga0114129_10073643 Ga0114129_100736436 436
453 3300009177 Ga0105248_10006266 Ga0105248_100062666 436
454 3300009553 Ga0105249_10000166 Ga0105249_1000016639 436
455 3300009553 Ga0105249_10002969 Ga0105249_100029694 436
456 3300010375 Ga0105239_10013533 Ga0105239_100135339 436
457 3300010375 Ga0105239_10017629 Ga0105239_1001762910 436
458 3300013102 Ga0157371_10086807 Ga0157371_100868072 436
459 3300013105 Ga0157369_10114883 Ga0157369_101148834 436
460 3300013296 Ga0157374_10253070 Ga0157374_102530702 436
461 3300013297 Ga0157378_10010983 Ga0157378_100109839 436
462 3300013306 Ga0163162_10013519 Ga0163162_100135192 436
463 3300013307 Ga0157372_10073863 Ga0157372_100738632 436
464 3300013308 Ga0157375_10130502 Ga0157375_101305021 436
465 3300014326 Ga0157380_10010252 Ga0157380_100102524 436
466 3300014326 Ga0157380_10024213 Ga0157380_100242136 436
467 3300014968 Ga0157379_10045293 Ga0157379_100452935 436
468 3300025315 Ga0207697_10002866 Ga0207697_1000286611 436
469 3300025893 Ga0207682_10043921 Ga0207682_100439212 436
470 3300025901 Ga0207688_10010308 Ga0207688_100103086 436
471 3300025903 Ga0207680_10104428 Ga0207680_101044282 436
472 3300025907 Ga0207645_10000304 Ga0207645_100003042 436
473 3300025908 Ga0207643_10003500 Ga0207643_1000350011 436
474 3300025912 Ga0207707_10006769 Ga0207707_1000676912 436
475 3300025915 Ga0207693_10043786 Ga0207693_100437862 436
476 3300025918 Ga0207662_10035778 Ga0207662_100357782 436
477 3300025919 Ga0207657_10032892 Ga0207657_100328925 436
478 3300025920 Ga0207649_10014982 Ga0207649_100149821 436
479 3300025923 Ga0207681_10005448 Ga0207681_100054482 436
480 3300025923 Ga0207681_10028802 Ga0207681_100288024 436
481 3300025925 Ga0207650_10043828 Ga0207650_100438282 436
482 3300025926 Ga0207659_10040943 Ga0207659_100409433 436
483 3300025933 Ga0207706_10000174 Ga0207706_1000017441 436
484 3300025938 Ga0207704_10080904 Ga0207704_100809041 436
485 3300025940 Ga0207691_10023738 Ga0207691_100237387 436
486 3300025940 Ga0207691_10025991 Ga0207691_100259912 436
487 3300025942 Ga0207689_10003328 Ga0207689_100033282 436
488 3300025944 Ga0207661_10016044 Ga0207661_100160441 436
489 3300025945 Ga0207679_10001218 Ga0207679_100012186 436
490 3300025945 Ga0207679_10009529 Ga0207679_100095299 436
491 3300025949 Ga0207667_10110825 Ga0207667_101108252 436
492 3300025961 Ga0207712_10000257 Ga0207712_1000025711 436
493 3300025961 Ga0207712_10006684 Ga0207712_100066843 436
494 3300026023 Ga0207677_10003937 Ga0207677_100039374 436
495 3300026075 Ga0207708_10091826 Ga0207708_100918263 436
496 3300026088 Ga0207641_10071132 Ga0207641_100711324 436
497 3300026089 Ga0207648_10044580 Ga0207648_100445803 436
498 3300026089 Ga0207648_10123276 Ga0207648_101232761 436
499 3300026095 Ga0207676_10028692 Ga0207676_100286926 436
500 3300026116 Ga0207674_10001814 Ga0207674_100018145 436
501 3300026116 Ga0207674_10008367 Ga0207674_100083675 436
502 3300026116 Ga0207674_10011989 Ga0207674_100119895 436
503 3300026118 Ga0207675_100000030 Ga0207675_1000000306 436
504 3300026118 Ga0207675_100004281 Ga0207675_10000428111 436
505 3300026121 Ga0207683_10064442 Ga0207683_100644422 436
506 3300027907 Ga0207428_10049835 Ga0207428_100498355 436
507 3300028380 Ga0268265_10000382 Ga0268265_1000038212 436
508 3300028381 Ga0268264_10042033 Ga0268264_100420334 436
509 3300031548 Ga0307408_100002995 Ga0307408_10000299510 436
510 3300031731 Ga0307405_10006917 Ga0307405_100069172 436
511 3300031824 Ga0307413_10006943 Ga0307413_100069433 436
512 3300031852 Ga0307410_10002168 Ga0307410_100021688 436
513 3300031901 Ga0307406_10002693 Ga0307406_1000269312 436
514 3300031901 Ga0307406_10005012 Ga0307406_100050122 436
515 3300031911 Ga0307412_10003708 Ga0307412_100037084 436
516 3300031995 Ga0307409_100000873 Ga0307409_1000008738 436
517 3300032002 Ga0307416_100000883 Ga0307416_1000008832 436
518 3300032005 Ga0307411_10017694 Ga0307411_100176941 436
519 3300032126 Ga0307415_100002422 Ga0307415_1000024228 436
520 3300035170 Ga0373943_0009008 Ga0373943_0009008_1592_2923 436
521 3300044693 Ga0466961_0006964 Ga0466961_0006964_238_1710 436
522 3300045051 Ga0451576_0042352 Ga0451576_0042352_492_1823 436
523 3300046454 Ga0495592_0127573 Ga0495592_0127573_294_1622 436
524 3300046514 Ga0495618_0079719 Ga0495618_0079719_317_1645 436
525 3300046533 Ga0495640_0037262 Ga0495640_0037262_849_2177 436
526 3300046675 Ga0495657_0042941 Ga0495657_0042941_1491_2819 436
527 3300046689 Ga0495613_0011460 Ga0495613_0011460_864_2192 436
528 3300047322 Ga0495680_0026573 Ga0495680_0026573_687_2015 436
529 3300047444 Ga0495675_0040387 Ga0495675_0040387_340_1668 436
530 3300048088 Ga0495602_0050021 Ga0495602_0050021_631_1959 436
531 3300049587 Ga0501071_0048720 Ga0501071_0048720_1082_2422 436
532 3300049588 Ga0501072_0025684 Ga0501072_0025684_1144_2484 436
533 3300049590 Ga0501074_0115455 Ga0501074_0115455_103_1443 436
534 3300049592 Ga0501076_0037552 Ga0501076_0037552_1024_2364 436
535 3300049741 Ga0501079_0024226 Ga0501079_0024226_1274_2614 436
536 3300050507 nmdc:mga05p37_67250_c1 nmdc:mga05p37_67250_c1_1082_2413 436
537 3300050507 nmdc:mga05p37_80195_c1 nmdc:mga05p37_80195_c1_950_2281 436
538 3300050509 nmdc:mga0qj67_19765_c1 nmdc:mga0qj67_19765_c1_2006_3337 436
539 3300050509 nmdc:mga0qj67_228842_c1 nmdc:mga0qj67_228842_c1_95_1423 436
540 3300050509 nmdc:mga0qj67_9943_c1 nmdc:mga0qj67_9943_c1_3484_4812 436
541 3300050511 nmdc:mga08y16_56061_c1 nmdc:mga08y16_56061_c1_2772_4103 436
542 3300050512 nmdc:mga0n895_5273_c1 nmdc:mga0n895_5273_c1_7368_8699 436
543 3300050515 nmdc:mga0a205_43268_c1 nmdc:mga0a205_43268_c1_1454_2785 436
544 3300061734 Ga0530510_0023788 Ga0530510_0023788_1060_2400 436
545 3300061734 Ga0530510_0060517 Ga0530510_0060517_338_1675 436
546 iso_pu_bacteria 2713897090 2715500935 436
547 iso_pu_bacteria 2834578030 2834579088 436
548 iso_pu_bacteria 2839989709 2839991137 436
549 iso_pu_bacteria 2855020534 2855022687 436
550 iso_pu_bacteria 2899259804 2899259981 436
551 iso_pu_bacteria 2899275550 2899276189 436
552 iso_pu_bacteria 3000017691 3000019812 436
553 iso_pu_bacteria 8057132660 8057134980 436
554 3300005327 Ga0070658_10013890 Ga0070658_100138904 437
555 3300031665 Ga0316575_10005725 Ga0316575_100057253 437
556 3300031728 Ga0316578_10029417 Ga0316578_100294173 437
557 3300033528 Ga0316588_1001852 Ga0316588_10018525 437
558 3300036647 Ga0316582_0064276 Ga0316582_0064276_278_1603 437
559 3300042876 Ga0451577_0000050 Ga0451577_0000050_96891_98225 437
560 3300044673 Ga0453683_0006064 Ga0453683_0006064_1691_3025 437
561 3300044712 Ga0453684_0000404 Ga0453684_0000404_96870_98204 437
562 3300044712 Ga0453684_0025247 Ga0453684_0025247_7108_8442 437
563 3300044712 Ga0453684_0038838 Ga0453684_0038838_156_1490 437
564 3300044712 Ga0453684_0074377 Ga0453684_0074377_1914_3248 437
565 3300045051 Ga0451576_0003015 Ga0451576_0003015_12512_13846 437
566 3300049824 Ga0501045_0130871 Ga0501045_0130871_181_1521 437
567 3300053085 Ga0495619_0028219 Ga0495619_0028219_1452_3065 437
568 3300053122 Ga0500608_001920 Ga0500608_001920_2493_4106 437
569 iso_pu_bacteria 2585427687 2586207043 437
570 iso_pu_bacteria 2738541283 2738755728 437
571 iso_pu_bacteria 2738541284 2738761611 437
572 iso_pu_bacteria 2738541302 2738852680 437
573 iso_pu_bacteria 2738543023 2739305349 437
574 iso_pu_bacteria 2739367651 2739586610 437
575 iso_pu_bacteria 2739367656 2739614937 437
576 iso_pu_bacteria 2739367663 2739645965 437
577 iso_pu_bacteria 2739367866 2740033220 437
578 iso_pu_bacteria 2775506987 2776615752 437
579 iso_pu_bacteria 2818991437 2819549782 437
580 iso_pu_bacteria 2842722452 2842727208 437
581 iso_pu_bacteria 2842909656 2842910788 437
582 iso_pu_bacteria 2849281842 2849286682 437
583 iso_pu_bacteria 2852627209 2852627963 437
584 iso_pu_bacteria 2854681122 2854685153 437
585 iso_pu_bacteria 2857627736 2857628109 437
586 iso_pu_bacteria 2890804823 2890807524 437
587 iso_pu_bacteria 2898795034 2898796920 437
588 iso_pu_bacteria 2902048731 2902050483 437
589 iso_pu_bacteria 2904445276 2904447090 437
590 iso_pu_bacteria 2919186247 2919190938 437
591 iso_pu_bacteria 2939664404 2939668852 437
592 iso_pu_bacteria 2945997725 2945998119 437
593 iso_pu_bacteria 2954016120 2954020564 437
594 3300005518 Ga0070699_100046296 Ga0070699_1000462965 438
595 3300005535 Ga0070684_100073699 Ga0070684_1000736992 438
596 3300025917 Ga0207660_10000714 Ga0207660_1000071421 438
597 3300026078 Ga0207702_10084036 Ga0207702_100840363 438
598 iso_pu_bacteria 2523533629 2524004523 438
599 3300031344 Ga0265316_10087113 Ga0265316_100871132 439
600 3300042876 Ga0451577_0000535 Ga0451577_0000535_54702_56027 439
601 3300042876 Ga0451577_0101827 Ga0451577_0101827_808_2136 439
602 3300044673 Ga0453683_0000537 Ga0453683_0000537_19827_21155 439
603 3300044712 Ga0453684_0004549 Ga0453684_0004549_25860_27185 439
604 3300044712 Ga0453684_0095591 Ga0453684_0095591_1419_2744 439
605 3300044712 Ga0453684_0130641 Ga0453684_0130641_948_2276 439
606 3300045051 Ga0451576_0097568 Ga0451576_0097568_1280_2605 439
607 3300049523 Ga0501300_001025 Ga0501300_001025_2937_4268 439
608 iso_pu_bacteria 2738541273 2738701873 439
609 iso_pu_bacteria 2738543014 2739256171 439
610 3300039093 Ga0400489_96379 Ga0400489_96379_3276_4619 440
611 3300044712 Ga0453684_0009194 Ga0453684_0009194_7321_8646 440
612 3300044712 Ga0453684_0042461 Ga0453684_0042461_3932_5257 440
613 3300049591 Ga0501075_0212763 Ga0501075_0212763_82_1434 440
614 3300049592 Ga0501076_0056271 Ga0501076_0056271_45_1397 440
615 3300049741 Ga0501079_0028692 Ga0501079_0028692_1562_2914 440
616 3300049743 Ga0501081_0027229 Ga0501081_0027229_1775_3127 440
617 3300005327 Ga0070658_10000032 Ga0070658_10000032134 441
618 3300005328 Ga0070676_10005347 Ga0070676_100053472 441
619 3300005456 Ga0070678_100157271 Ga0070678_1001572711 441
620 3300005539 Ga0068853_100009198 Ga0068853_1000091983 441
621 3300005539 Ga0068853_100111079 Ga0068853_1001110792 441
622 3300005548 Ga0070665_100000017 Ga0070665_100000017362 441
623 3300005563 Ga0068855_100000160 Ga0068855_10000016018 441
624 3300005563 Ga0068855_100018649 Ga0068855_1000186496 441
625 3300005614 Ga0068856_100000040 Ga0068856_10000004052 441
626 3300005614 Ga0068856_100008477 Ga0068856_1000084774 441
627 3300005614 Ga0068856_100023288 Ga0068856_1000232881 441
628 3300005616 Ga0068852_100020039 Ga0068852_1000200391 441
629 3300006358 Ga0068871_100000382 Ga0068871_10000038230 441
630 3300006881 Ga0068865_100004489 Ga0068865_1000044893 441
631 3300009093 Ga0105240_10016685 Ga0105240_100166858 441
632 3300009174 Ga0105241_10000284 Ga0105241_1000028433 441
633 3300009545 Ga0105237_10044274 Ga0105237_100442743 441
634 3300009545 Ga0105237_10090052 Ga0105237_100900522 441
635 3300009551 Ga0105238_10020458 Ga0105238_100204581 441
636 3300010375 Ga0105239_10059127 Ga0105239_100591274 441
637 3300010375 Ga0105239_10281424 Ga0105239_102814241 441
638 3300013105 Ga0157369_10011744 Ga0157369_100117443 441
639 3300013296 Ga0157374_10000122 Ga0157374_1000012234 441
640 3300013297 Ga0157378_10028316 Ga0157378_100283163 441
641 3300013306 Ga0163162_10000071 Ga0163162_1000007144 441
642 3300013308 Ga0157375_10022874 Ga0157375_100228745 441
643 3300020075 Ga0206349_1723532 Ga0206349_17235322 441
644 3300020078 Ga0206352_10291344 Ga0206352_102913441 441
645 3300020080 Ga0206350_10549468 Ga0206350_105494683 441
646 3300021361 Ga0213872_10015603 Ga0213872_100156032 441
647 3300025899 Ga0207642_10058278 Ga0207642_100582782 441
648 3300025904 Ga0207647_10000146 Ga0207647_1000014635 441
649 3300025907 Ga0207645_10000502 Ga0207645_1000050220 441
650 3300025909 Ga0207705_10000032 Ga0207705_1000003287 441
651 3300025911 Ga0207654_10000684 Ga0207654_100006847 441
652 3300025914 Ga0207671_10001288 Ga0207671_100012881 441
653 3300025914 Ga0207671_10155922 Ga0207671_101559222 441
654 3300025933 Ga0207706_10000007 Ga0207706_1000000752 441
655 3300025938 Ga0207704_10000033 Ga0207704_1000003380 441
656 3300025949 Ga0207667_10000033 Ga0207667_10000033108 441
657 3300025949 Ga0207667_10045540 Ga0207667_100455402 441
658 3300025949 Ga0207667_10056302 Ga0207667_100563021 441
659 3300026041 Ga0207639_10086583 Ga0207639_100865832 441
660 3300026078 Ga0207702_10000042 Ga0207702_1000004225 441
661 3300026078 Ga0207702_10010102 Ga0207702_100101029 441
662 3300026089 Ga0207648_10000495 Ga0207648_1000049535 441
663 3300026121 Ga0207683_10001591 Ga0207683_100015913 441
664 3300026142 Ga0207698_10051132 Ga0207698_100511321 441
665 3300028379 Ga0268266_10000195 Ga0268266_1000019555 441
666 3300028786 Ga0307517_10000335 Ga0307517_1000033524 441
667 3300033180 Ga0307510_10002118 Ga0307510_100021182 441
668 3300037312 Ga0395899_0013861 Ga0395899_0013861_1362_2687 441
669 3300037418 Ga0395900_0000288 Ga0395900_0000288_40819_42144 441
670 3300037418 Ga0395900_0004910 Ga0395900_0004910_9947_11272 441
671 3300037418 Ga0395900_0033960 Ga0395900_0033960_1908_3233 441
672 3300037466 Ga0395898_0012362 Ga0395898_0012362_3659_4984 441
673 3300037471 Ga0395905_0001824 Ga0395905_0001824_16953_18278 441
674 3300037471 Ga0395905_0019020 Ga0395905_0019020_309_1634 441
675 3300038443 Ga0395901_0009188 Ga0395901_0009188_2642_3967 441
676 3300039447 Ga0436361_1222875 Ga0436361_1222875_3697_5022 441
677 3300044658 Ga0466972_0002085 Ga0466972_0002085_3352_4824 441
678 3300044712 Ga0453684_0089717 Ga0453684_0089717_179_1519 441
679 3300045049 Ga0466959_0003937 Ga0466959_0003937_460_1932 441
680 3300046518 Ga0495631_0012861 Ga0495631_0012861_55_1380 441
681 3300046694 Ga0495649_0038454 Ga0495649_0038454_139_1464 441
682 3300047323 Ga0495683_0011040 Ga0495683_0011040_754_2079 441
683 3300047443 Ga0495687_000846 Ga0495687_000846_6668_7993 441
684 3300053122 Ga0500608_000658 Ga0500608_000658_6462_7787 441
685 iso_pu_bacteria 2884634485 2884636872 441
686 3300001979 JGI24740J21852_10007018 JGI24740J21852_100070182 442
687 3300025932 Ga0207690_10006656 Ga0207690_100066566 442
688 3300045051 Ga0451576_0011060 Ga0451576_0011060_4336_5682 442

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00448

SRP54

SRP54-type protein, GTPase domain

137

332

0.99

PF02881

SRP54_N

SRP54-type protein, helical bundle domain

43

120

0.96

PF02978

SRP_SPB

Signal peptide binding domain

363

464

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pxt-assembly1.cif.gz_A variant 15 of ribonucleoprotein core of the e. coli signal recognition particle 0.9697 327 424
7o9f-assembly1.cif.gz_A bacillus subtilis ffh in complex with ppgpp 0.9631 2 298
7o9f-assembly3.cif.gz_C bacillus subtilis ffh in complex with ppgpp 0.9599 2 298
1hq1-assembly1.cif.gz_A structural and energetic analysis of rna recognition by a universally conserved protein from the signal recognition particle 0.9579 327 426
7o9f-assembly1.cif.gz_A bacillus subtilis ffh in complex with ppgpp 0.9506 2 298
ID Description Score Start End Superfamily
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.962 91 282 3.40.50.300
1hq1A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);Signal recognition particle, SRP54 subunit, M-domain 0.9579 327 426 1.10.260.30
5l3rC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9523 91 282 3.40.50.300
af_A0A0R0L4Y4_128_288_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9428 98 238 3.40.50.300
af_Q4DKX0_351_574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 98 294 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3M1IBY6-F1-model_v4 Signal recognition particle protein 0.9819 1 270 GO:0003924
GO:0005525
GO:0006614
GO:0016887
GO:0048500
AF-A0A519XJ53-F1-model_v4 Signal recognition particle protein 0.9806 1 302 GO:0003924
GO:0005525
GO:0006614
GO:0016887
GO:0048500
AF-A0A3M1IBY6-F1-model_v4 Signal recognition particle protein 0.9748 1 270 GO:0003924
GO:0005525
GO:0006614
GO:0016887
GO:0048500
AF-A0A519XJ53-F1-model_v4 Signal recognition particle protein 0.9742 1 302 GO:0003924
GO:0005525
GO:0006614
GO:0016887
GO:0048500
AF-A0A7J7AU57-F1-model_v4 deleted 0.9712 1 216

Feature Viewer

pLDDT pTM Quality
78.06 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map