F475226

General Info

Members Datasets Scaffolds Average Seq Length
687 361 658 280

Family's Representative Sequence

Representative Sequence 3300002705|JGI25156J39149_1000972|JGI25156J39149_100097216
Length 308
Sequence MDKNFKRPPQRQMFAAEPLSVRIRKWRPSVMQLALTISITLHAAVLGVRIVDPQDFNRVFQDTPLEVVLVNARSSEAPTKAQAIAQANLAGGGEAEAGLATSPLPPSPNELVGDEQTDSTRKIQADEQEQQQLLANVRRDIAAMPVPDPRKARMTPAERETEELRQQKLRLLAAIEKRINEENSRPRRRYISPSTREEVYAIYYDKLRHKIEDKGTANFPSLNGHKLYGELTVNLTIDARGRVVESEIVHSSNSRFLDQRALAIAQAAAPFGNFSDDMKRKADQIVVTSRFRFTKTEGMQATMTNNGG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221585 Pelomonas sp. Root662 Isolate Unclassified
10 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221609 Acidovorax sp. Root217 Isolate Unclassified
13 2643221611 Acidovorax sp. Root219 Isolate Unclassified
14 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
15 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
16 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
17 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
18 2643221652 Acidovorax sp. Root402 Isolate Unclassified
19 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2738541337 Pelomonas sp. BT06 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
25 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
26 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
27 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
28 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
29 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
32 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
33 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
34 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
47 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
48 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
65 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
66 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
120 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
145 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
223 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
224 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
225 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
230 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
231 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
232 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
233 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
234 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
258 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
289 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
330 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
339 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
345 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
346 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
347 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
350 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
351 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0
Isolates 4.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.78
Nodule 0.87
Rhizoplane 3.2
Rhizosphere 57.93
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011214 3300001979 Bacteria 3419
2 JGI25155J39150_1000029 3300002704 Bacteria 118964
3 JGI25156J39149_1000062 3300002705 Bacteria 84500
4 JGI25156J39149_1000972 3300002705 Bacteria 13646
5 JGI25156J39149_1002726 3300002705 Bacteria 6154
6 JGI25156J39149_1020393 3300002705 Bacteria 1168
7 JGI25154J39366_1000053 3300002738 Bacteria 119466
8 JGI25154J39366_1009191 3300002738 Bacteria 1229
9 JGI25157J39369_1000046 3300002741 Bacteria 119470
10 JGI25157J39369_1000566 3300002741 Bacteria 22112
11 JGI25164J39214_1008120 3300002772 Bacteria 1054
12 JGI25152J39213_1001870 3300002773 Bacteria 8476
13 JGI25150J39212_1009044 3300002774 Bacteria 1918
14 JGI25150J39212_1011469 3300002774 Bacteria 1605
15 JGI25159J45721_1000769 3300002987 Bacteria 13948
16 JGI25159J45721_1002357 3300002987 Bacteria 7218
17 JGI25151J46595_10002974 3300003187 Bacteria 9676
18 JGI25151J46595_10004157 3300003187 Bacteria 7731
19 JGI25153J46596_10001512 3300003215 Bacteria 13857
20 JGI25153J46596_10006965 3300003215 Bacteria 5632
21 rootH2_10039549 3300003320 Bacteria 3861
22 rootH2_10053827 3300003320 Bacteria 1125
23 rootL2_10133502 3300003322 Bacteria 2195
24 rootH1_10007874 3300003323 Bacteria 5429
25 rootH1_10079535 3300003323 Bacteria 2594
26 JGI25160J50197_1000253 3300003354 Bacteria 40838
27 JGI25161J50226_1000046 3300003374 Bacteria 116165
28 Ga0055539_1000858 3300003752 Bacteria 7077
29 Ga0055539_1000894 3300003752 Bacteria 6786
30 Ga0055539_1003632 3300003752 Bacteria 2133
31 Ga0055533_1000033 3300003756 Bacteria 265716
32 Ga0055525_1001219 3300003759 Bacteria 5640
33 Ga0055535_1000551 3300003761 Bacteria 32122
34 Ga0055535_1000729 3300003761 Bacteria 24824
35 Ga0055529_1000486 3300003763 Bacteria 36917
36 Ga0055526_1001278 3300003771 Bacteria 18039
37 Ga0055526_1001924 3300003771 Bacteria 14362
38 Ga0055526_1003435 3300003771 Bacteria 10051
39 Ga0055537_1000828 3300003773 Bacteria 15203
40 Ga0055537_1007772 3300003773 Bacteria 2542
41 Ga0055524_1000044 3300003775 Bacteria 151631
42 Ga0055524_1000146 3300003775 Bacteria 84190
43 Ga0055536_1024379 3300003781 Bacteria 1753
44 Ga0055528_1000287 3300003790 Bacteria 43121
45 Ga0055530_10001754 3300003791 Bacteria 15171
46 Ga0055540_1000116 3300003792 Bacteria 83801
47 Ga0055540_1007525 3300003792 Bacteria 4089
48 Ga0055531_10000181 3300003794 Bacteria 71324
49 Ga0055531_10001297 3300003794 Bacteria 18841
50 Ga0055531_10001570 3300003794 Bacteria 16720
51 Ga0055543_1000957 3300004625 Bacteria 13219
52 Ga0070658_10017380 3300005327 Bacteria 5755
53 Ga0070658_10047156 3300005327 Bacteria 3487
54 Ga0070658_10208714 3300005327 Bacteria 1649
55 Ga0070676_10003513 3300005328 Bacteria 8187
56 Ga0070676_10100387 3300005328 Bacteria 1787
57 Ga0070683_100228511 3300005329 Bacteria 1769
58 Ga0070683_100278424 3300005329 Bacteria 1591
59 Ga0070690_100033317 3300005330 Bacteria 3224
60 Ga0070670_100063695 3300005331 Bacteria 3164
61 Ga0070677_10026888 3300005333 Bacteria 2161
62 Ga0068869_100002073 3300005334 Bacteria 12041
63 Ga0068869_100016765 3300005334 Bacteria 4946
64 Ga0068869_100034989 3300005334 Bacteria 3557
65 Ga0068869_100096507 3300005334 Bacteria 2231
66 Ga0070680_100002568 3300005336 Bacteria 13425
67 Ga0068868_100009022 3300005338 Bacteria 7157
68 Ga0068868_100028923 3300005338 Bacteria 4242
69 Ga0068868_100131386 3300005338 Bacteria 2049
70 Ga0070660_100008567 3300005339 Bacteria 7161
71 Ga0070660_100139789 3300005339 Bacteria 1942
72 Ga0070660_100347536 3300005339 Bacteria 1221
73 Ga0070660_100357912 3300005339 Bacteria 1202
74 Ga0070661_100033654 3300005344 Bacteria 3713
75 Ga0070661_100259205 3300005344 Bacteria 1344
76 Ga0070692_10051867 3300005345 Bacteria 2135
77 Ga0070669_100014598 3300005353 Bacteria 5591
78 Ga0070669_100159050 3300005353 Bacteria 1754
79 Ga0070675_100005231 3300005354 Bacteria 9903
80 Ga0070675_100017521 3300005354 Bacteria 5692
81 Ga0070671_100005899 3300005355 Bacteria 9760
82 Ga0070671_100095936 3300005355 Bacteria 2486
83 Ga0070671_100162616 3300005355 Bacteria 1887
84 Ga0070671_100196592 3300005355 Bacteria 1709
85 Ga0070674_100081578 3300005356 Bacteria 2311
86 Ga0070673_100009689 3300005364 Bacteria 6480
87 Ga0070659_100011368 3300005366 Bacteria 6583
88 Ga0070659_100168388 3300005366 Bacteria 1793
89 Ga0070659_100276764 3300005366 Bacteria 1395
90 Ga0070667_100019496 3300005367 Bacteria 5628
91 Ga0070667_100039064 3300005367 Bacteria 3978
92 Ga0070667_100208636 3300005367 Bacteria 1736
93 Ga0070667_100319537 3300005367 Bacteria 1401
94 Ga0070708_100064215 3300005445 Bacteria 3289
95 Ga0070663_100000198 3300005455 Bacteria 29990
96 Ga0070678_100181835 3300005456 Bacteria 1722
97 Ga0070662_100001463 3300005457 Bacteria 14552
98 Ga0070662_100081218 3300005457 Bacteria 2415
99 Ga0070662_100439760 3300005457 Bacteria 1081
100 Ga0070681_10097499 3300005458 Bacteria 2887
101 Ga0068867_100005705 3300005459 Bacteria 8826
102 Ga0068867_100564593 3300005459 Bacteria 988
103 Ga0070706_100001272 3300005467 Bacteria 26932
104 Ga0070706_100083698 3300005467 Bacteria 2956
105 Ga0070707_100172792 3300005468 Bacteria 2106
106 Ga0070699_100108923 3300005518 Bacteria 2431
107 Ga0070684_100009956 3300005535 Bacteria 7516
108 Ga0070684_100036654 3300005535 Bacteria 4203
109 Ga0068853_100017239 3300005539 Bacteria 5961
110 Ga0068853_100170472 3300005539 Bacteria 1969
111 Ga0068853_100212017 3300005539 Bacteria 1766
112 Ga0068853_100232610 3300005539 Bacteria 1686
113 Ga0068853_100348651 3300005539 Bacteria 1377
114 Ga0070672_100003578 3300005543 Bacteria 10065
115 Ga0070672_100007343 3300005543 Bacteria 7473
116 Ga0070695_100115990 3300005545 Bacteria 1825
117 Ga0070693_100010390 3300005547 Bacteria 4665
118 Ga0070665_100214023 3300005548 Bacteria 1928
119 Ga0070665_100684470 3300005548 Bacteria 1039
120 Ga0068855_100006754 3300005563 Bacteria 13917
121 Ga0068855_100011358 3300005563 Bacteria 10752
122 Ga0068855_100095395 3300005563 Bacteria 3428
123 Ga0070664_100017065 3300005564 Bacteria 5959
124 Ga0070664_100136616 3300005564 Bacteria 2156
125 Ga0070664_100142743 3300005564 Bacteria 2109
126 Ga0070664_100212997 3300005564 Bacteria 1727
127 Ga0068857_100008700 3300005577 Bacteria 8785
128 Ga0068857_100021590 3300005577 Bacteria 5665
129 Ga0068854_100040764 3300005578 Bacteria 3278
130 Ga0068854_100044869 3300005578 Bacteria 3140
131 Ga0068854_100066543 3300005578 Bacteria 2623
132 Ga0068854_100135268 3300005578 Bacteria 1886
133 Ga0068856_100006477 3300005614 Bacteria 11480
134 Ga0068856_100043891 3300005614 Bacteria 4398
135 Ga0068856_100150851 3300005614 Bacteria 2333
136 Ga0068856_100558853 3300005614 Bacteria 1166
137 Ga0068852_100012059 3300005616 Bacteria 6542
138 Ga0068852_100020133 3300005616 Bacteria 5300
139 Ga0068852_100025591 3300005616 Bacteria 4784
140 Ga0068852_100035670 3300005616 Bacteria 4151
141 Ga0068852_100050103 3300005616 Bacteria 3576
142 Ga0068852_100099104 3300005616 Bacteria 2626
143 Ga0068852_100211832 3300005616 Bacteria 1839
144 Ga0068859_100152233 3300005617 Bacteria 2388
145 Ga0068859_100324239 3300005617 Bacteria 1634
146 Ga0068859_100414573 3300005617 Bacteria 1443
147 Ga0068864_100029161 3300005618 Bacteria 4669
148 Ga0068864_100100387 3300005618 Bacteria 2565
149 Ga0068861_100017625 3300005719 Bacteria 5075
150 Ga0068861_100574453 3300005719 Bacteria 1031
151 Ga0068870_10039137 3300005840 Bacteria 2452
152 Ga0068870_10092748 3300005840 Bacteria 1692
153 Ga0068858_100010785 3300005842 Bacteria 8638
154 Ga0068858_100011373 3300005842 Bacteria 8404
155 Ga0068860_100016235 3300005843 Bacteria 7260
156 Ga0068860_100059156 3300005843 Bacteria 3644
157 Ga0068860_100223856 3300005843 Bacteria 1827
158 Ga0068860_100259063 3300005843 Bacteria 1695
159 Ga0075365_10042544 3300006038 Bacteria 2970
160 Ga0075365_10079392 3300006038 Bacteria 2221
161 Ga0075368_10011203 3300006042 Bacteria 3258
162 Ga0075368_10016929 3300006042 Bacteria 2722
163 Ga0075368_10027570 3300006042 Bacteria 2192
164 Ga0075363_100034513 3300006048 Bacteria 2641
165 Ga0075363_100070325 3300006048 Bacteria 1900
166 Ga0075363_100083888 3300006048 Bacteria 1746
167 Ga0075364_10010377 3300006051 Bacteria 5625
168 Ga0075364_10086749 3300006051 Bacteria 2074
169 Ga0075432_10007220 3300006058 Bacteria 3781
170 Ga0075362_10024741 3300006177 Bacteria 2549
171 Ga0075362_10048743 3300006177 Bacteria 1890
172 Ga0075367_10009505 3300006178 Bacteria 5086
173 Ga0075367_10034083 3300006178 Bacteria 2938
174 Ga0075369_10002060 3300006186 Bacteria 7092
175 Ga0075369_10015885 3300006186 Bacteria 3029
176 Ga0075366_10005597 3300006195 Bacteria 6814
177 Ga0075366_10006389 3300006195 Bacteria 6456
178 Ga0075366_10009515 3300006195 Bacteria 5426
179 Ga0075366_10012697 3300006195 Bacteria 4784
180 Ga0075366_10014216 3300006195 Bacteria 4545
181 Ga0075366_10047676 3300006195 Bacteria 2540
182 Ga0075366_10126329 3300006195 Bacteria 1542
183 Ga0075366_10244316 3300006195 Bacteria 1094
184 Ga0097621_100047457 3300006237 Bacteria 3480
185 Ga0075370_10000655 3300006353 Bacteria 13473
186 Ga0075370_10006473 3300006353 Bacteria 5894
187 Ga0075370_10009074 3300006353 Bacteria 5143
188 Ga0075370_10011334 3300006353 Bacteria 4682
189 Ga0075370_10024535 3300006353 Bacteria 3332
190 Ga0075370_10032859 3300006353 Bacteria 2903
191 Ga0075370_10051300 3300006353 Bacteria 2340
192 Ga0075370_10107000 3300006353 Bacteria 1622
193 Ga0075370_10218939 3300006353 Bacteria 1125
194 Ga0075370_10261746 3300006353 Bacteria 1026
195 Ga0068871_100030276 3300006358 Bacteria 4260
196 Ga0097620_100152226 3300006931 Bacteria 2388
197 Ga0097620_100324274 3300006931 Bacteria 1634
198 Ga0097620_100414503 3300006931 Bacteria 1443
199 Ga0079104_1000001 3300006946 Bacteria 521847
200 Ga0079104_1000037 3300006946 Bacteria 189207
201 Ga0099826_10063663 3300006948 Bacteria 2382
202 Ga0075435_100146720 3300007076 Bacteria 1982
203 Ga0105250_10000294 3300009092 Bacteria 39500
204 Ga0105240_10007963 3300009093 Bacteria 15281
205 Ga0105240_10012876 3300009093 Bacteria 11520
206 Ga0105240_10049322 3300009093 Bacteria 5315
207 Ga0105240_10242553 3300009093 Bacteria 2088
208 Ga0105245_10402309 3300009098 Bacteria 1368
209 Ga0105245_10534768 3300009098 Bacteria 1192
210 Ga0105243_10053189 3300009148 Bacteria 3211
211 Ga0105243_10353677 3300009148 Bacteria 1350
212 Ga0105248_10152034 3300009177 Bacteria 2612
213 Ga0105248_10189109 3300009177 Bacteria 2320
214 Ga0105237_10000556 3300009545 Bacteria 52272
215 Ga0105237_10023375 3300009545 Bacteria 6334
216 Ga0105237_10041466 3300009545 Bacteria 4642
217 Ga0105238_10020120 3300009551 Bacteria 6793
218 Ga0105238_10027759 3300009551 Bacteria 5769
219 Ga0105238_10176341 3300009551 Bacteria 2114
220 Ga0105239_10003145 3300010375 Bacteria 20491
221 Ga0105239_10024247 3300010375 Bacteria 6682
222 Ga0105239_10040868 3300010375 Bacteria 5082
223 Ga0105246_10060985 3300011119 Bacteria 2622
224 Ga0105246_10331703 3300011119 Bacteria 1240
225 Ga0157347_1000790 3300012502 Bacteria 2231
226 Ga0157370_10010716 3300013104 Bacteria 9642
227 Ga0157370_10284216 3300013104 Bacteria 1528
228 Ga0157370_10413031 3300013104 Bacteria 1242
229 Ga0157369_10147163 3300013105 Bacteria 2490
230 Ga0157374_10037450 3300013296 Bacteria 4452
231 Ga0157374_10619658 3300013296 Bacteria 1093
232 Ga0157378_10179747 3300013297 Bacteria 1989
233 Ga0163162_10022700 3300013306 Bacteria 6187
234 Ga0157372_10071953 3300013307 Bacteria 3896
235 Ga0157372_10713454 3300013307 Bacteria 1167
236 Ga0157375_10006468 3300013308 Bacteria 10209
237 Ga0157375_10128587 3300013308 Bacteria 2651
238 Ga0157375_10145574 3300013308 Bacteria 2500
239 Ga0163163_10289892 3300014325 Bacteria 1689
240 Ga0182008_10001156 3300014497 Bacteria 18204
241 Ga0182008_10005465 3300014497 Bacteria 7236
242 Ga0157379_10013488 3300014968 Bacteria 7161
243 Ga0157379_10142805 3300014968 Bacteria 2158
244 Ga0157379_10363990 3300014968 Bacteria 1326
245 Ga0157376_10017149 3300014969 Bacteria 5516
246 Ga0163161_10000564 3300017792 Bacteria 29865
247 Ga0163161_10007666 3300017792 Bacteria 7464
248 Ga0213872_10000081 3300021361 Bacteria 88397
249 Ga0213872_10000104 3300021361 Bacteria 78306
250 Ga0213872_10115657 3300021361 Bacteria 1188
251 Ga0209435_100003 3300025206 Bacteria 669534
252 Ga0209674_100064 3300025226 Bacteria 265769
253 Ga0209563_100099 3300025230 Bacteria 153336
254 Ga0207427_102578 3300025231 Bacteria 4691
255 Ga0209258_100319 3300025242 Bacteria 74569
256 Ga0209258_100759 3300025242 Bacteria 20248
257 Ga0207425_1001180 3300025245 Bacteria 11637
258 Ga0207425_1004526 3300025245 Bacteria 4138
259 Ga0207425_1007256 3300025245 Bacteria 2947
260 Ga0209646_1000008 3300025246 Bacteria 669534
261 Ga0209646_1000060 3300025246 Bacteria 256386
262 Ga0209026_1000007 3300025250 Bacteria 669534
263 Ga0209026_1000049 3300025250 Bacteria 255273
264 Ga0209677_100331 3300025253 Bacteria 30340
265 Ga0209677_100823 3300025253 Bacteria 15482
266 Ga0209677_101638 3300025253 Bacteria 9421
267 Ga0209759_1000026 3300025256 Bacteria 311743
268 Ga0209759_1000272 3300025256 Bacteria 73495
269 Ga0209759_1000994 3300025256 Bacteria 19456
270 Ga0209759_1002607 3300025256 Bacteria 7778
271 Ga0209759_1016144 3300025256 Bacteria 1898
272 Ga0209129_1000342 3300025258 Bacteria 40192
273 Ga0209565_1000200 3300025263 Bacteria 71490
274 Ga0209565_1000559 3300025263 Bacteria 25609
275 Ga0209455_1000157 3300025272 Bacteria 119719
276 Ga0209673_1000009 3300025273 Bacteria 620735
277 Ga0209673_1000012 3300025273 Bacteria 579480
278 Ga0209673_1023111 3300025273 Bacteria 2126
279 Ga0209130_1000064 3300025284 Bacteria 196568
280 Ga0209130_1000712 3300025284 Bacteria 29562
281 Ga0209675_1000144 3300025291 Bacteria 94908
282 Ga0209675_1002213 3300025291 Bacteria 10172
283 Ga0209675_1007775 3300025291 Bacteria 4044
284 Ga0209675_1015397 3300025291 Bacteria 2272
285 Ga0209676_1000051 3300025292 Bacteria 389016
286 Ga0209676_1004766 3300025292 Bacteria 7389
287 Ga0209025_1007558 3300025294 Bacteria 8065
288 Ga0209025_1008226 3300025294 Bacteria 7543
289 Ga0209025_1015564 3300025294 Bacteria 4572
290 Ga0209564_1000136 3300025295 Bacteria 185198
291 Ga0209564_1002312 3300025295 Bacteria 15472
292 Ga0209564_1002490 3300025295 Bacteria 14385
293 Ga0209564_1004673 3300025295 Bacteria 8217
294 Ga0209758_1000045 3300025297 Bacteria 369174
295 Ga0209758_1000502 3300025297 Bacteria 63375
296 Ga0209758_1005804 3300025297 Bacteria 9253
297 Ga0209050_1000044 3300025298 Bacteria 391114
298 Ga0209050_1004206 3300025298 Bacteria 9954
299 Ga0209050_1005557 3300025298 Bacteria 7854
300 Ga0209050_1010422 3300025298 Bacteria 4584
301 Ga0209050_1024043 3300025298 Bacteria 2122
302 Ga0209256_1000003 3300025299 Bacteria 1661127
303 Ga0209256_1000015 3300025299 Bacteria 622953
304 Ga0209256_1013911 3300025299 Bacteria 2946
305 Ga0207426_1000116 3300025302 Bacteria 225245
306 Ga0207426_1002959 3300025302 Bacteria 9950
307 Ga0209051_1000025 3300025303 Bacteria 415397
308 Ga0209051_1000031 3300025303 Bacteria 391114
309 Ga0209051_1028775 3300025303 Bacteria 2188
310 Ga0209257_1000039 3300025304 Bacteria 591694
311 Ga0209257_1000053 3300025304 Bacteria 425160
312 Ga0209257_1000058 3300025304 Bacteria 381686
313 Ga0209257_1004718 3300025304 Bacteria 10222
314 Ga0209257_1010588 3300025304 Bacteria 4633
315 Ga0209257_1025307 3300025304 Bacteria 2030
316 Ga0207656_10012366 3300025321 Bacteria 3243
317 Ga0207682_10013165 3300025893 Bacteria 3225
318 Ga0207688_10014069 3300025901 Bacteria 4350
319 Ga0207645_10004178 3300025907 Bacteria 10720
320 Ga0207645_10016787 3300025907 Bacteria 4841
321 Ga0207643_10026718 3300025908 Bacteria 3197
322 Ga0207643_10049564 3300025908 Bacteria 2380
323 Ga0207643_10064311 3300025908 Bacteria 2099
324 Ga0207705_10111313 3300025909 Bacteria 2023
325 Ga0207705_10218367 3300025909 Bacteria 1447
326 Ga0207684_10003606 3300025910 Bacteria 15069
327 Ga0207684_10102156 3300025910 Bacteria 2451
328 Ga0207707_10023353 3300025912 Bacteria 5409
329 Ga0207695_10008486 3300025913 Bacteria 12850
330 Ga0207695_10011317 3300025913 Bacteria 10816
331 Ga0207695_10102107 3300025913 Bacteria 2861
332 Ga0207695_10242856 3300025913 Bacteria 1702
333 Ga0207671_10001994 3300025914 Bacteria 22499
334 Ga0207671_10014611 3300025914 Bacteria 6195
335 Ga0207671_10031203 3300025914 Bacteria 3971
336 Ga0207660_10184898 3300025917 Bacteria 1620
337 Ga0207662_10047176 3300025918 Bacteria 2551
338 Ga0207657_10017103 3300025919 Bacteria 6972
339 Ga0207657_10104616 3300025919 Bacteria 2344
340 Ga0207657_10148954 3300025919 Bacteria 1907
341 Ga0207657_10195011 3300025919 Bacteria 1632
342 Ga0207649_10010331 3300025920 Bacteria 5126
343 Ga0207649_10115382 3300025920 Bacteria 1802
344 Ga0207681_10009855 3300025923 Bacteria 5844
345 Ga0207694_10012667 3300025924 Bacteria 6354
346 Ga0207694_10033859 3300025924 Bacteria 3915
347 Ga0207650_10205841 3300025925 Bacteria 1578
348 Ga0207659_10003636 3300025926 Bacteria 9288
349 Ga0207659_10012868 3300025926 Bacteria 5342
350 Ga0207644_10026852 3300025931 Bacteria 3974
351 Ga0207644_10074570 3300025931 Bacteria 2490
352 Ga0207644_10238484 3300025931 Bacteria 1447
353 Ga0207690_10145322 3300025932 Bacteria 1753
354 Ga0207690_10232760 3300025932 Bacteria 1415
355 Ga0207706_10035099 3300025933 Bacteria 4461
356 Ga0207706_10165269 3300025933 Bacteria 1945
357 Ga0207686_10080915 3300025934 Bacteria 2119
358 Ga0207709_10000167 3300025935 Bacteria 88877
359 Ga0207709_10355769 3300025935 Bacteria 1107
360 Ga0207704_10223500 3300025938 Bacteria 1395
361 Ga0207691_10008114 3300025940 Bacteria 10080
362 Ga0207691_10008676 3300025940 Bacteria 9754
363 Ga0207691_10077575 3300025940 Bacteria 2993
364 Ga0207711_10049262 3300025941 Bacteria 3607
365 Ga0207711_10087883 3300025941 Bacteria 2728
366 Ga0207711_10330692 3300025941 Bacteria 1409
367 Ga0207689_10012076 3300025942 Bacteria 7398
368 Ga0207689_10028540 3300025942 Bacteria 4668
369 Ga0207689_10055686 3300025942 Bacteria 3254
370 Ga0207689_10127806 3300025942 Bacteria 2090
371 Ga0207661_10024950 3300025944 Bacteria 4540
372 Ga0207661_10054807 3300025944 Bacteria 3195
373 Ga0207661_10446005 3300025944 Bacteria 1178
374 Ga0207679_10176253 3300025945 Bacteria 1765
375 Ga0207667_10050496 3300025949 Bacteria 4388
376 Ga0207667_10058113 3300025949 Bacteria 4058
377 Ga0207667_10083721 3300025949 Bacteria 3303
378 Ga0207667_10126281 3300025949 Bacteria 2635
379 Ga0207651_10082429 3300025960 Bacteria 2322
380 Ga0207651_10239931 3300025960 Bacteria 1477
381 Ga0207640_10010011 3300025981 Bacteria 5326
382 Ga0207640_10098185 3300025981 Bacteria 2047
383 Ga0207640_10201356 3300025981 Bacteria 1509
384 Ga0207658_10020803 3300025986 Bacteria 4545
385 Ga0207658_10027903 3300025986 Bacteria 3971
386 Ga0207658_10247812 3300025986 Bacteria 1512
387 Ga0207677_10008652 3300026023 Bacteria 5697
388 Ga0207677_10008876 3300026023 Bacteria 5635
389 Ga0207677_10369024 3300026023 Bacteria 1208
390 Ga0207703_10003521 3300026035 Bacteria 13096
391 Ga0207703_10034671 3300026035 Bacteria 4006
392 Ga0207639_10005163 3300026041 Bacteria 8806
393 Ga0207639_10056773 3300026041 Bacteria 3002
394 Ga0207639_10063225 3300026041 Bacteria 2865
395 Ga0207639_10070410 3300026041 Bacteria 2732
396 Ga0207639_10090898 3300026041 Bacteria 2443
397 Ga0207639_10133886 3300026041 Bacteria 2055
398 Ga0207639_10338382 3300026041 Bacteria 1341
399 Ga0207678_10000684 3300026067 Bacteria 31001
400 Ga0207678_10007290 3300026067 Bacteria 9801
401 Ga0207702_10000395 3300026078 Bacteria 49788
402 Ga0207702_10014290 3300026078 Bacteria 6592
403 Ga0207641_10009819 3300026088 Bacteria 7881
404 Ga0207641_10463612 3300026088 Bacteria 1226
405 Ga0207648_10003979 3300026089 Bacteria 15346
406 Ga0207648_10055216 3300026089 Bacteria 3468
407 Ga0207676_10400617 3300026095 Bacteria 1282
408 Ga0207676_10446029 3300026095 Bacteria 1219
409 Ga0207674_10003791 3300026116 Bacteria 18445
410 Ga0207674_10015017 3300026116 Bacteria 8530
411 Ga0207675_100583168 3300026118 Bacteria 1120
412 Ga0207683_10253289 3300026121 Bacteria 1607
413 Ga0207683_10408333 3300026121 Bacteria 1250
414 Ga0207698_10011200 3300026142 Bacteria 5804
415 Ga0207698_10057605 3300026142 Bacteria 3007
416 Ga0207698_10258495 3300026142 Bacteria 1598
417 Ga0209281_1000002 3300027111 Bacteria 1924012
418 Ga0209281_1000057 3300027111 Bacteria 307145
419 Ga0209813_10041789 3300027866 Bacteria 1399
420 Ga0209974_10008157 3300027876 Bacteria 3586
421 Ga0268266_10087364 3300028379 Bacteria 2728
422 Ga0268264_10004863 3300028381 Bacteria 11381
423 Ga0265336_10000040 3300028666 Bacteria 138266
424 Ga0307515_10001613 3300028794 Bacteria 50267
425 Ga0307515_10003475 3300028794 Bacteria 33121
426 Ga0307515_10021372 3300028794 Bacteria 11480
427 Ga0307515_10056643 3300028794 Bacteria 5691
428 Ga0307515_10115937 3300028794 Bacteria 3080
429 Ga0307515_10139291 3300028794 Bacteria 2613
430 Ga0307515_10237819 3300028794 Bacteria 1599
431 Ga0265324_10001969 3300029957 Bacteria 11010
432 Ga0307512_10036130 3300030522 Bacteria 4196
433 Ga0265330_10000046 3300031235 Bacteria 108853
434 Ga0265332_10000028 3300031238 Bacteria 184029
435 Ga0265325_10001934 3300031241 Bacteria 14288
436 Ga0307513_10000008 3300031456 Bacteria 442128
437 Ga0307513_10000441 3300031456 Bacteria 59706
438 Ga0307513_10415004 3300031456 Bacteria 1077
439 Ga0307509_10000991 3300031507 Bacteria 48763
440 Ga0307509_10052470 3300031507 Bacteria 4353
441 Ga0307509_10059174 3300031507 Bacteria 4054
442 Ga0307408_100159845 3300031548 Bacteria 1788
443 Ga0307508_10000043 3300031616 Bacteria 143889
444 Ga0307508_10003877 3300031616 Bacteria 14878
445 Ga0307514_10000558 3300031649 Bacteria 71090
446 Ga0307514_10084638 3300031649 Bacteria 2333
447 Ga0307514_10101224 3300031649 Bacteria 2068
448 Ga0265314_10000054 3300031711 Bacteria 184029
449 Ga0307516_10001407 3300031730 Bacteria 33232
450 Ga0307516_10005507 3300031730 Bacteria 15108
451 Ga0307516_10118594 3300031730 Bacteria 2440
452 Ga0307405_10004482 3300031731 Bacteria 6605
453 Ga0307413_10413893 3300031824 Bacteria 1060
454 Ga0307406_10022019 3300031901 Bacteria 3777
455 Ga0307407_10222445 3300031903 Bacteria 1277
456 Ga0307412_10001244 3300031911 Bacteria 14411
457 Ga0307412_10034980 3300031911 Bacteria 3206
458 Ga0307409_100001001 3300031995 Bacteria 13228
459 Ga0307416_100010461 3300032002 Bacteria 6128
460 Ga0307414_10177699 3300032004 Bacteria 1709
461 Ga0307414_10215121 3300032004 Bacteria 1574
462 Ga0307411_10001837 3300032005 Bacteria 9014
463 Ga0307411_10298609 3300032005 Bacteria 1291
464 Ga0307415_100002908 3300032126 Bacteria 8591
465 Ga0307510_10000294 3300033180 Bacteria 46056
466 Ga0307510_10102687 3300033180 Bacteria 2640
467 Ga0373944_0058267 3300035089 Bacteria 1233
468 Ga0373946_0059806 3300035171 Bacteria 1618
469 Ga0373924_0047133 3300035410 Bacteria 1778
470 Ga0373931_0016307 3300035691 Bacteria 3656
471 Ga0373931_0081128 3300035691 Bacteria 1790
472 Ga0373935_0249640 3300035692 Bacteria 1241
473 Ga0373937_0151180 3300036401 Bacteria 2175
474 Ga0373925_0194322 3300037068 Bacteria 1611
475 Ga0373925_0458646 3300037068 Bacteria 1044
476 Ga0395900_0036742 3300037418 Bacteria 5049
477 Ga0395898_0061066 3300037466 Bacteria 3662
478 Ga0395898_0085060 3300037466 Bacteria 3049
479 Ga0395905_0017590 3300037471 Bacteria 6784
480 Ga0395905_0029251 3300037471 Bacteria 5193
481 Ga0395905_0030931 3300037471 Bacteria 5041
482 Ga0395905_0379185 3300037471 Bacteria 1308
483 Ga0395901_0001180 3300038443 Bacteria 27770
484 Ga0436361_0107660 3300039447 Bacteria 63286
485 Ga0436361_0178218 3300039447 Bacteria 1027
486 Ga0436361_0364626 3300039447 Bacteria 3886
487 Ga0436361_0745691 3300039447 Bacteria 89622
488 Ga0451789_0866159 3300041443 Bacteria 1386
489 Ga0451843_0782854 3300041509 Bacteria 1436
490 Ga0451853_2355776 3300041512 Bacteria 1272
491 Ga0451853_3936200 3300041512 Bacteria 1206
492 Ga0439449_0048916 3300042007 Bacteria 1565
493 Ga0439458_0027546 3300042157 Bacteria 1341
494 Ga0451577_0001915 3300042876 Bacteria 26373
495 Ga0451577_0027942 3300042876 Bacteria 5103
496 Ga0466969_0001965 3300044656 Bacteria 10990
497 Ga0466969_0041892 3300044656 Bacteria 2288
498 Ga0453683_0012856 3300044673 Bacteria 5478
499 Ga0453683_0079925 3300044673 Bacteria 2048
500 Ga0466965_0039041 3300044683 Bacteria 2333
501 Ga0466965_0065288 3300044683 Bacteria 1823
502 Ga0466961_0006094 3300044693 Bacteria 7650
503 Ga0466961_0116422 3300044693 Bacteria 1679
504 Ga0466963_0048757 3300044694 Bacteria 2800
505 Ga0466964_0020809 3300044706 Bacteria 2530
506 Ga0453684_0016471 3300044712 Bacteria 11553
507 Ga0453684_0018857 3300044712 Bacteria 10555
508 Ga0466971_0012864 3300044719 Bacteria 3669
509 Ga0466971_0069733 3300044719 Bacteria 1595
510 Ga0466970_0034940 3300044765 Bacteria 2662
511 Ga0466970_0100098 3300044765 Bacteria 1578
512 Ga0466957_0015737 3300044842 Bacteria 4419
513 Ga0466960_0016896 3300044901 Bacteria 3173
514 Ga0466959_0024270 3300045049 Bacteria 4490
515 Ga0451576_0012538 3300045051 Bacteria 9514
516 Ga0451576_0040673 3300045051 Bacteria 4917
517 Ga0451576_0089891 3300045051 Bacteria 3194
518 Ga0466958_0062369 3300045836 Bacteria 2272
519 Ga0466967_0171989 3300045976 Bacteria 2039
520 Ga0466967_0214421 3300045976 Bacteria 1827
521 Ga0495592_0000083 3300046454 Bacteria 83092
522 Ga0495651_0131559 3300046462 Bacteria 1826
523 Ga0495650_0012789 3300046471 Bacteria 4492
524 Ga0495580_0061350 3300046472 Bacteria 2640
525 Ga0495583_0000046 3300046506 Bacteria 218059
526 Ga0495606_0021661 3300046507 Bacteria 4702
527 Ga0495610_0041050 3300046512 Bacteria 2326
528 Ga0495610_0047763 3300046512 Bacteria 2104
529 Ga0495632_0014952 3300046519 Bacteria 4370
530 Ga0495632_0015142 3300046519 Bacteria 4336
531 Ga0495632_0054047 3300046519 Bacteria 1970
532 Ga0495643_0049136 3300046522 Bacteria 2276
533 Ga0495648_0229094 3300046524 Bacteria 911
534 Ga0495597_0000375 3300046542 Bacteria 39117
535 Ga0495645_0054269 3300046543 Bacteria 2912
536 Ga0495633_0001773 3300046558 Bacteria 15985
537 Ga0495656_0014709 3300046615 Bacteria 2939
538 Ga0495625_0014961 3300046660 Bacteria 6165
539 Ga0495625_0018673 3300046660 Bacteria 5404
540 Ga0495625_0021227 3300046660 Bacteria 5003
541 Ga0495625_0139309 3300046660 Bacteria 1638
542 Ga0495588_0011839 3300046674 Bacteria 4106
543 Ga0495646_0074550 3300046680 Bacteria 1991
544 Ga0495658_0217190 3300046683 Bacteria 1196
545 Ga0495624_0079091 3300046690 Bacteria 2039
546 Ga0495649_0001661 3300046694 Bacteria 16548
547 Ga0495589_0011934 3300046794 Bacteria 4504
548 Ga0495676_0130461 3300047321 Bacteria 1815
549 Ga0495680_0196936 3300047322 Bacteria 1447
550 Ga0495687_001691 3300047443 Bacteria 19685
551 Ga0495686_0076034 3300047472 Bacteria 2058
552 Ga0495614_0096387 3300048089 Bacteria 1290
553 Ga0495615_0015407 3300048090 Bacteria 1632
554 Ga0495626_0014929 3300048091 Bacteria 3987
555 Ga0495626_0035099 3300048091 Bacteria 2395
556 Ga0496100_0018155 3300048903 Bacteria 4168
557 Ga0496101_0032355 3300048904 Bacteria 3681
558 Ga0496102_0009788 3300048905 Bacteria 8243
559 Ga0496102_0015544 3300048905 Bacteria 6632
560 Ga0496102_0122425 3300048905 Bacteria 2430
561 Ga0496104_0287748 3300048907 Bacteria 1556
562 Ga0496104_0305658 3300048907 Bacteria 1503
563 Ga0496106_0027831 3300048909 Bacteria 4209
564 Ga0496107_0054184 3300048910 Bacteria 2894
565 Ga0496108_0007144 3300048911 Bacteria 9052
566 Ga0496108_0072339 3300048911 Bacteria 2910
567 Ga0496108_0513017 3300048911 Bacteria 1047
568 Ga0496109_0050112 3300048912 Bacteria 3803
569 Ga0496109_0370478 3300048912 Bacteria 1353
570 Ga0496109_0438352 3300048912 Bacteria 1234
571 Ga0496110_0017947 3300048913 Bacteria 5926
572 Ga0496112_0194909 3300048915 Bacteria 1987
573 Ga0496113_0004477 3300048916 Bacteria 8597
574 Ga0496114_0010776 3300048917 Bacteria 7276
575 Ga0496114_0041467 3300048917 Bacteria 3815
576 Ga0496115_0026390 3300048918 Bacteria 4534
577 Ga0496122_0042267 3300048925 Bacteria 3588
578 Ga0496122_0086310 3300048925 Bacteria 2161
579 Ga0496123_0101812 3300048926 Bacteria 1669
580 Ga0496123_0178107 3300048926 Bacteria 1113
581 Ga0496125_0000319 3300048928 Bacteria 93727
582 Ga0496125_0066725 3300048928 Bacteria 2841
583 Ga0496126_0019070 3300048929 Bacteria 6767
584 Ga0501031_0001318 3300049568 Bacteria 15252
585 Ga0501036_0138222 3300049572 Bacteria 2056
586 Ga0501043_0000057 3300049579 Bacteria 103997
587 Ga0501043_0150733 3300049579 Bacteria 1820
588 Ga0501046_0000075 3300049580 Bacteria 104000
589 Ga0501046_0047014 3300049580 Bacteria 3423
590 Ga0501047_0000081 3300049581 Bacteria 122697
591 Ga0501047_0322041 3300049581 Bacteria 1385
592 Ga0501048_0002921 3300049582 Bacteria 13057
593 Ga0501227_008444 3300049665 Bacteria 2209
594 Ga0501035_0146738 3300049822 Bacteria 2048
595 Ga0501044_0062784 3300049823 Bacteria 3796
596 Ga0501045_0002738 3300049824 Bacteria 12043
597 nmdc:mga03683_13049_c1 3300050489 Bacteria 3050
598 nmdc:mga03683_214266_c1 3300050489 Bacteria 887
599 nmdc:mga03683_7894_c1 3300050489 Bacteria 3716
600 nmdc:mga03683_7924_c1 3300050489 Bacteria 3711
601 nmdc:mga00v17_27021_c1 3300050491 Bacteria 3348
602 nmdc:mga00v17_387535_c1 3300050491 Bacteria 908
603 nmdc:mga0yw44_155736_c1 3300050492 Bacteria 1493
604 nmdc:mga0yw44_277429_c1 3300050492 Bacteria 1120
605 nmdc:mga0k408_147497_c1 3300050493 Bacteria 1401
606 nmdc:mga0k408_161_c1 3300050493 Bacteria 34843
607 nmdc:mga0k408_178873_c1 3300050493 Bacteria 1265
608 nmdc:mga0k408_180_c1 3300050493 Bacteria 33189
609 nmdc:mga0k408_1901_c1 3300050493 Bacteria 11173
610 nmdc:mga0k408_2769_c1 3300050493 Bacteria 9320
611 nmdc:mga0k408_3641_c1 3300050493 Bacteria 8158
612 nmdc:mga0k408_58692_c1 3300050493 Bacteria 2235
613 nmdc:mga0k408_76182_c1 3300050493 Bacteria 1960
614 nmdc:mga0k408_8906_c1 3300050493 Bacteria 5400
615 nmdc:mga06z11_342090_c1 3300050494 Bacteria 895
616 nmdc:mga06z11_97021_c1 3300050494 Bacteria 1611
617 nmdc:mga04h51_50128_c1 3300050495 Bacteria 1398
618 nmdc:mga07m45_134411_c1 3300050496 Bacteria 1431
619 nmdc:mga07m45_15789_c1 3300050496 Bacteria 4036
620 nmdc:mga07m45_260_c1 3300050496 Bacteria 21450
621 nmdc:mga07m45_26675_c2 3300050496 Bacteria 2127
622 nmdc:mga07m45_26703_c1 3300050496 Bacteria 3175
623 nmdc:mga07m45_287_c1 3300050496 Bacteria 20366
624 nmdc:mga07m45_31900_c1 3300050496 Bacteria 2921
625 nmdc:mga07m45_35343_c1 3300050496 Bacteria 2779
626 nmdc:mga07m45_4971_c1 3300050496 Bacteria 6562
627 nmdc:mga0n895_293927_c1 3300050512 Bacteria 1647
628 nmdc:mga0sz30_1923_c2 3300050516 Bacteria 7090
629 nmdc:mga0sz30_55036_c1 3300050516 Bacteria 1693
630 Ga0500635_0000440 3300053080 Bacteria 12001
631 Ga0495619_0341975 3300053085 Bacteria 1035
632 Ga0500644_0013299 3300053088 Bacteria 2296
633 Ga0500644_0042428 3300053088 Bacteria 1516
634 Ga0500650_0143386 3300053098 Bacteria 1107
635 Ga0500593_005834 3300053117 Bacteria 4888
636 Ga0500593_036096 3300053117 Bacteria 2212
637 Ga0500594_0000825 3300053118 Bacteria 6606
638 Ga0500608_072733 3300053122 Bacteria 1633
639 Ga0500628_019308 3300053129 Bacteria 1355
640 Ga0500652_004319 3300053131 Bacteria 4391
641 Ga0500658_0001840 3300053134 Bacteria 8347
642 Ga0500559_0000019 3300053136 Bacteria 134862
643 Ga0500559_0012113 3300053136 Bacteria 3672
644 Ga0500564_015387 3300053138 Bacteria 3455
645 Ga0500564_074163 3300053138 Bacteria 1532
646 Ga0500568_0029407 3300053139 Bacteria 2281
647 Ga0500577_0001979 3300053142 Bacteria 5247
648 Ga0500604_0009570 3300053151 Bacteria 2582
649 Ga0500604_0036077 3300053151 Bacteria 1473
650 Ga0500622_0007525 3300053156 Bacteria 6180
651 Ga0500622_0012262 3300053156 Bacteria 4647
652 Ga0500622_0078978 3300053156 Bacteria 1650
653 Ga0500636_0069923 3300053177 Bacteria 2037
654 Ga0500636_0073357 3300053177 Bacteria 1982
655 Ga0500645_003082 3300053730 Bacteria 6985
656 Ga0500661_007912 3300055283 Bacteria 1959
657 Ga0466962_0027502 3300061719 Bacteria 2729
658 Ga0466962_0035189 3300061719 Bacteria 2397

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025909 Ga0207705_10111313 Ga0207705_101113132 206
2 3300003320 rootH2_10053827 rootH2_100538272 229
3 3300049572 Ga0501036_0138222 Ga0501036_0138222_445_1314 237
4 3300046471 Ga0495650_0012789 Ga0495650_0012789_1976_2902 239
5 3300049579 Ga0501043_0150733 Ga0501043_0150733_802_1671 239
6 3300049580 Ga0501046_0047014 Ga0501046_0047014_1601_2470 239
7 3300049581 Ga0501047_0322041 Ga0501047_0322041_167_1036 239
8 3300049822 Ga0501035_0146738 Ga0501035_0146738_477_1346 239
9 3300049823 Ga0501044_0062784 Ga0501044_0062784_1601_2470 239
10 3300037471 Ga0395905_0379185 Ga0395905_0379185_420_1286 240
11 3300005338 Ga0068868_100131386 Ga0068868_1001313862 241
12 3300009098 Ga0105245_10402309 Ga0105245_104023092 241
13 3300003761 Ga0055535_1000551 Ga0055535_100055126 242
14 3300003761 Ga0055535_1000729 Ga0055535_100072915 242
15 3300003763 Ga0055529_1000486 Ga0055529_100048614 242
16 3300025242 Ga0209258_100319 Ga0209258_10031914 242
17 3300025256 Ga0209759_1000994 Ga0209759_10009948 242
18 3300025272 Ga0209455_1000157 Ga0209455_100015753 242
19 3300005843 Ga0068860_100059156 Ga0068860_1000591563 244
20 3300014968 Ga0157379_10363990 Ga0157379_103639902 244
21 3300026088 Ga0207641_10463612 Ga0207641_104636122 244
22 3300005539 Ga0068853_100170472 Ga0068853_1001704722 245
23 3300005548 Ga0070665_100214023 Ga0070665_1002140232 245
24 3300006038 Ga0075365_10079392 Ga0075365_100793922 245
25 3300009093 Ga0105240_10012876 Ga0105240_100128767 245
26 3300009545 Ga0105237_10000556 Ga0105237_1000055620 245
27 3300009551 Ga0105238_10027759 Ga0105238_100277593 245
28 3300010375 Ga0105239_10003145 Ga0105239_100031457 245
29 3300025913 Ga0207695_10008486 Ga0207695_1000848610 245
30 3300025914 Ga0207671_10001994 Ga0207671_1000199414 245
31 3300025924 Ga0207694_10012667 Ga0207694_100126674 245
32 3300026041 Ga0207639_10056773 Ga0207639_100567732 245
33 3300028794 Ga0307515_10139291 Ga0307515_101392912 247
34 3300021361 Ga0213872_10000104 Ga0213872_1000010449 248
35 3300039447 Ga0436361_0745691 Ga0436361_0745691_13885_14736 248
36 3300003323 rootH1_10007874 rootH1_100078748 250
37 3300031903 Ga0307407_10222445 Ga0307407_102224451 251
38 3300032005 Ga0307411_10001837 Ga0307411_100018375 251
39 3300046462 Ga0495651_0131559 Ga0495651_0131559_307_1233 251
40 3300049665 Ga0501227_008444 Ga0501227_008444_580_1434 251
41 3300003752 Ga0055539_1003632 Ga0055539_10036322 252
42 3300006353 Ga0075370_10032859 Ga0075370_100328592 252
43 3300025253 Ga0209677_101638 Ga0209677_1016384 252
44 3300031730 Ga0307516_10001407 Ga0307516_1000140720 252
45 3300050496 nmdc:mga07m45_287_c1 nmdc:mga07m45_287_c1_4886_5812 252
46 3300031235 Ga0265330_10000046 Ga0265330_10000046102 253
47 3300031238 Ga0265332_10000028 Ga0265332_1000002811 253
48 3300031241 Ga0265325_10001934 Ga0265325_100019347 253
49 3300031711 Ga0265314_10000054 Ga0265314_1000005411 253
50 3300005339 Ga0070660_100347536 Ga0070660_1003475362 254
51 3300025932 Ga0207690_10232760 Ga0207690_102327601 254
52 3300006058 Ga0075432_10007220 Ga0075432_100072203 256
53 3300021361 Ga0213872_10115657 Ga0213872_101156572 257
54 3300039447 Ga0436361_0364626 Ga0436361_0364626_222_1073 257
55 3300053080 Ga0500635_0000440 Ga0500635_0000440_6194_7120 257
56 3300006946 Ga0079104_1000037 Ga0079104_100003749 258
57 3300009092 Ga0105250_10000294 Ga0105250_1000029427 258
58 3300021361 Ga0213872_10000081 Ga0213872_1000008177 258
59 3300025935 Ga0207709_10000167 Ga0207709_1000016740 258
60 3300027111 Ga0209281_1000002 Ga0209281_1000002833 258
61 3300039447 Ga0436361_0107660 Ga0436361_0107660_29938_30795 258
62 3300046506 Ga0495583_0000046 Ga0495583_0000046_22321_23253 258
63 3300046507 Ga0495606_0021661 Ga0495606_0021661_1476_2408 258
64 3300046694 Ga0495649_0001661 Ga0495649_0001661_5129_6061 258
65 3300046794 Ga0495589_0011934 Ga0495589_0011934_2580_3512 258
66 3300031548 Ga0307408_100159845 Ga0307408_1001598452 259
67 3300031901 Ga0307406_10022019 Ga0307406_100220192 259
68 3300006353 Ga0075370_10107000 Ga0075370_101070002 260
69 3300031649 Ga0307514_10000558 Ga0307514_1000055865 260
70 3300031824 Ga0307413_10413893 Ga0307413_104138932 260
71 3300042876 Ga0451577_0027942 Ga0451577_0027942_3133_3990 260
72 3300044712 Ga0453684_0018857 Ga0453684_0018857_9462_10319 260
73 3300045051 Ga0451576_0040673 Ga0451576_0040673_907_1764 260
74 3300002705 JGI25156J39149_1020393 JGI25156J39149_10203932 261
75 3300002987 JGI25159J45721_1002357 JGI25159J45721_10023576 261
76 3300003187 JGI25151J46595_10004157 JGI25151J46595_100041576 261
77 3300003771 Ga0055526_1001278 Ga0055526_10012786 261
78 3300003771 Ga0055526_1003435 Ga0055526_10034354 261
79 3300003773 Ga0055537_1000828 Ga0055537_10008286 261
80 3300003775 Ga0055524_1000044 Ga0055524_1000044117 261
81 3300003781 Ga0055536_1024379 Ga0055536_10243792 261
82 3300003790 Ga0055528_1000287 Ga0055528_10002879 261
83 3300003791 Ga0055530_10001754 Ga0055530_1000175410 261
84 3300003792 Ga0055540_1000116 Ga0055540_100011659 261
85 3300003794 Ga0055531_10001297 Ga0055531_1000129711 261
86 3300005327 Ga0070658_10017380 Ga0070658_100173802 261
87 3300005328 Ga0070676_10003513 Ga0070676_100035137 261
88 3300005334 Ga0068869_100002073 Ga0068869_10000207311 261
89 3300005338 Ga0068868_100028923 Ga0068868_1000289234 261
90 3300005339 Ga0070660_100008567 Ga0070660_1000085675 261
91 3300005344 Ga0070661_100259205 Ga0070661_1002592052 261
92 3300005345 Ga0070692_10051867 Ga0070692_100518671 261
93 3300005353 Ga0070669_100014598 Ga0070669_1000145983 261
94 3300005354 Ga0070675_100017521 Ga0070675_1000175215 261
95 3300005366 Ga0070659_100168388 Ga0070659_1001683882 261
96 3300005457 Ga0070662_100001463 Ga0070662_1000014635 261
97 3300005535 Ga0070684_100036654 Ga0070684_1000366545 261
98 3300005539 Ga0068853_100017239 Ga0068853_1000172397 261
99 3300005545 Ga0070695_100115990 Ga0070695_1001159902 261
100 3300005547 Ga0070693_100010390 Ga0070693_1000103904 261
101 3300005578 Ga0068854_100044869 Ga0068854_1000448692 261
102 3300005614 Ga0068856_100043891 Ga0068856_1000438913 261
103 3300005616 Ga0068852_100012059 Ga0068852_1000120596 261
104 3300005618 Ga0068864_100029161 Ga0068864_1000291613 261
105 3300005842 Ga0068858_100010785 Ga0068858_1000107854 261
106 3300006237 Ga0097621_100047457 Ga0097621_1000474574 261
107 3300006358 Ga0068871_100030276 Ga0068871_1000302763 261
108 3300007076 Ga0075435_100146720 Ga0075435_1001467202 261
109 3300009177 Ga0105248_10189109 Ga0105248_101891092 261
110 3300013296 Ga0157374_10037450 Ga0157374_100374504 261
111 3300013306 Ga0163162_10022700 Ga0163162_100227004 261
112 3300013307 Ga0157372_10071953 Ga0157372_100719534 261
113 3300014968 Ga0157379_10013488 Ga0157379_100134883 261
114 3300014969 Ga0157376_10017149 Ga0157376_100171494 261
115 3300017792 Ga0163161_10007666 Ga0163161_100076664 261
116 3300025245 Ga0207425_1007256 Ga0207425_10072564 261
117 3300025256 Ga0209759_1002607 Ga0209759_10026078 261
118 3300025263 Ga0209565_1000200 Ga0209565_100020055 261
119 3300025273 Ga0209673_1000009 Ga0209673_1000009454 261
120 3300025273 Ga0209673_1000012 Ga0209673_1000012355 261
121 3300025284 Ga0209130_1000712 Ga0209130_100071222 261
122 3300025291 Ga0209675_1000144 Ga0209675_100014419 261
123 3300025292 Ga0209676_1000051 Ga0209676_1000051219 261
124 3300025294 Ga0209025_1015564 Ga0209025_10155642 261
125 3300025295 Ga0209564_1002312 Ga0209564_100231210 261
126 3300025295 Ga0209564_1002490 Ga0209564_100249011 261
127 3300025298 Ga0209050_1000044 Ga0209050_1000044127 261
128 3300025299 Ga0209256_1000003 Ga0209256_1000003609 261
129 3300025302 Ga0207426_1002959 Ga0207426_10029596 261
130 3300025303 Ga0209051_1000031 Ga0209051_1000031127 261
131 3300025304 Ga0209257_1000058 Ga0209257_1000058121 261
132 3300025321 Ga0207656_10012366 Ga0207656_100123663 261
133 3300025893 Ga0207682_10013165 Ga0207682_100131652 261
134 3300025901 Ga0207688_10014069 Ga0207688_100140692 261
135 3300025907 Ga0207645_10016787 Ga0207645_100167875 261
136 3300025919 Ga0207657_10104616 Ga0207657_101046162 261
137 3300025923 Ga0207681_10009855 Ga0207681_100098555 261
138 3300025926 Ga0207659_10003636 Ga0207659_100036368 261
139 3300025932 Ga0207690_10145322 Ga0207690_101453222 261
140 3300025941 Ga0207711_10049262 Ga0207711_100492623 261
141 3300025981 Ga0207640_10201356 Ga0207640_102013562 261
142 3300026023 Ga0207677_10008652 Ga0207677_100086527 261
143 3300026023 Ga0207677_10369024 Ga0207677_103690241 261
144 3300026035 Ga0207703_10034671 Ga0207703_100346712 261
145 3300026041 Ga0207639_10005163 Ga0207639_100051635 261
146 3300026067 Ga0207678_10007290 Ga0207678_100072902 261
147 3300026088 Ga0207641_10009819 Ga0207641_100098194 261
148 3300026142 Ga0207698_10057605 Ga0207698_100576052 261
149 3300035691 Ga0373931_0081128 Ga0373931_0081128_698_1561 261
150 3300044673 Ga0453683_0079925 Ga0453683_0079925_64_924 261
151 3300048903 Ga0496100_0018155 Ga0496100_0018155_666_1529 261
152 3300048904 Ga0496101_0032355 Ga0496101_0032355_2519_3382 261
153 3300048905 Ga0496102_0122425 Ga0496102_0122425_378_1241 261
154 3300048909 Ga0496106_0027831 Ga0496106_0027831_3048_3911 261
155 3300048910 Ga0496107_0054184 Ga0496107_0054184_1298_2161 261
156 3300048911 Ga0496108_0007144 Ga0496108_0007144_2933_3796 261
157 3300048912 Ga0496109_0050112 Ga0496109_0050112_2101_2964 261
158 3300048913 Ga0496110_0017947 Ga0496110_0017947_2031_2894 261
159 3300048915 Ga0496112_0194909 Ga0496112_0194909_264_1127 261
160 3300048918 Ga0496115_0026390 Ga0496115_0026390_2927_3790 261
161 3300050512 nmdc:mga0n895_293927_c1 nmdc:mga0n895_293927_c1_451_1314 261
162 3300053730 Ga0500645_003082 Ga0500645_003082_83_931 261
163 3300005327 Ga0070658_10047156 Ga0070658_100471562 262
164 3300031456 Ga0307513_10000008 Ga0307513_10000008224 262
165 3300005467 Ga0070706_100083698 Ga0070706_1000836982 263
166 3300005843 Ga0068860_100223856 Ga0068860_1002238562 263
167 3300025910 Ga0207684_10102156 Ga0207684_101021562 263
168 3300031456 Ga0307513_10000441 Ga0307513_1000044135 263
169 3300053139 Ga0500568_0029407 Ga0500568_0029407_869_1744 263
170 3300048911 Ga0496108_0513017 Ga0496108_0513017_23_895 264
171 3300002774 JGI25150J39212_1009044 JGI25150J39212_10090442 265
172 3300003773 Ga0055537_1007772 Ga0055537_10077722 265
173 3300005339 Ga0070660_100357912 Ga0070660_1003579122 265
174 3300005355 Ga0070671_100095936 Ga0070671_1000959362 265
175 3300005456 Ga0070678_100181835 Ga0070678_1001818351 265
176 3300005578 Ga0068854_100135268 Ga0068854_1001352681 265
177 3300005616 Ga0068852_100020133 Ga0068852_1000201332 265
178 3300005618 Ga0068864_100100387 Ga0068864_1001003872 265
179 3300006048 Ga0075363_100070325 Ga0075363_1000703253 265
180 3300006051 Ga0075364_10086749 Ga0075364_100867491 265
181 3300013296 Ga0157374_10619658 Ga0157374_106196581 265
182 3300013308 Ga0157375_10145574 Ga0157375_101455743 265
183 3300025245 Ga0207425_1004526 Ga0207425_10045263 265
184 3300025263 Ga0209565_1000559 Ga0209565_100055918 265
185 3300025291 Ga0209675_1002213 Ga0209675_10022139 265
186 3300025294 Ga0209025_1007558 Ga0209025_10075582 265
187 3300025297 Ga0209758_1005804 Ga0209758_10058047 265
188 3300025960 Ga0207651_10239931 Ga0207651_102399312 265
189 3300025981 Ga0207640_10098185 Ga0207640_100981853 265
190 3300044694 Ga0466963_0048757 Ga0466963_0048757_984_1925 265
191 3300048912 Ga0496109_0438352 Ga0496109_0438352_227_1090 265
192 3300050489 nmdc:mga03683_214266_c1 nmdc:mga03683_214266_c1_15_863 265
193 3300050491 nmdc:mga00v17_27021_c1 nmdc:mga00v17_27021_c1_1206_2054 265
194 3300053088 Ga0500644_0013299 Ga0500644_0013299_769_1617 265
195 3300053117 Ga0500593_005834 Ga0500593_005834_1433_2281 265
196 3300053151 Ga0500604_0036077 Ga0500604_0036077_464_1312 265
197 3300055283 Ga0500661_007912 Ga0500661_007912_716_1564 265
198 3300003320 rootH2_10039549 rootH2_100395493 266
199 3300005564 Ga0070664_100142743 Ga0070664_1001427432 266
200 3300025920 Ga0207649_10115382 Ga0207649_101153822 266
201 3300025931 Ga0207644_10074570 Ga0207644_100745703 266
202 3300037466 Ga0395898_0085060 Ga0395898_0085060_1866_2792 266
203 3300038443 Ga0395901_0001180 Ga0395901_0001180_20781_21707 266
204 3300046660 Ga0495625_0018673 Ga0495625_0018673_3093_4025 266
205 3300048907 Ga0496104_0287748 Ga0496104_0287748_94_957 266
206 3300053138 Ga0500564_074163 Ga0500564_074163_206_1138 266
207 3300053177 Ga0500636_0073357 Ga0500636_0073357_438_1370 266
208 3300002704 JGI25155J39150_1000029 JGI25155J39150_100002949 267
209 3300002705 JGI25156J39149_1000062 JGI25156J39149_100006220 267
210 3300002738 JGI25154J39366_1000053 JGI25154J39366_100005360 267
211 3300002741 JGI25157J39369_1000046 JGI25157J39369_100004649 267
212 3300005333 Ga0070677_10026888 Ga0070677_100268881 267
213 3300006948 Ga0099826_10063663 Ga0099826_100636633 267
214 3300025206 Ga0209435_100003 Ga0209435_100003231 267
215 3300025246 Ga0209646_1000008 Ga0209646_1000008231 267
216 3300025250 Ga0209026_1000007 Ga0209026_1000007231 267
217 3300025256 Ga0209759_1000026 Ga0209759_100002649 267
218 3300028794 Ga0307515_10237819 Ga0307515_102378192 267
219 3300048925 Ga0496122_0042267 Ga0496122_0042267_60_920 267
220 3300048926 Ga0496123_0178107 Ga0496123_0178107_59_919 267
221 3300048928 Ga0496125_0000319 Ga0496125_0000319_15544_16404 267
222 3300048929 Ga0496126_0019070 Ga0496126_0019070_1851_2711 267
223 3300025938 Ga0207704_10223500 Ga0207704_102235002 268
224 3300053122 Ga0500608_072733 Ga0500608_072733_309_1241 268
225 3300046615 Ga0495656_0014709 Ga0495656_0014709_268_1122 269
226 3300048090 Ga0495615_0015407 Ga0495615_0015407_544_1398 269
227 3300049579 Ga0501043_0000057 Ga0501043_0000057_97461_98318 269
228 3300049580 Ga0501046_0000075 Ga0501046_0000075_97461_98318 269
229 3300049581 Ga0501047_0000081 Ga0501047_0000081_97461_98318 269
230 3300049582 Ga0501048_0002921 Ga0501048_0002921_2926_3783 269
231 3300049824 Ga0501045_0002738 Ga0501045_0002738_1038_1895 269
232 3300009177 Ga0105248_10152034 Ga0105248_101520342 270
233 3300014325 Ga0163163_10289892 Ga0163163_102898922 270
234 3300025256 Ga0209759_1016144 Ga0209759_10161442 270
235 3300025908 Ga0207643_10064311 Ga0207643_100643112 270
236 3300025926 Ga0207659_10012868 Ga0207659_100128683 270
237 3300025941 Ga0207711_10330692 Ga0207711_103306922 270
238 3300003794 Ga0055531_10000181 Ga0055531_100001818 271
239 3300005367 Ga0070667_100319537 Ga0070667_1003195372 271
240 3300005543 Ga0070672_100007343 Ga0070672_1000073437 271
241 3300005616 Ga0068852_100035670 Ga0068852_1000356702 271
242 3300005617 Ga0068859_100152233 Ga0068859_1001522332 271
243 3300005842 Ga0068858_100011373 Ga0068858_1000113732 271
244 3300005843 Ga0068860_100016235 Ga0068860_1000162356 271
245 3300006931 Ga0097620_100152226 Ga0097620_1001522262 271
246 3300013308 Ga0157375_10128587 Ga0157375_101285873 271
247 3300025298 Ga0209050_1004206 Ga0209050_10042062 271
248 3300025303 Ga0209051_1028775 Ga0209051_10287752 271
249 3300025304 Ga0209257_1000053 Ga0209257_100005312 271
250 3300025940 Ga0207691_10008676 Ga0207691_100086768 271
251 3300025941 Ga0207711_10087883 Ga0207711_100878833 271
252 3300026035 Ga0207703_10003521 Ga0207703_1000352112 271
253 3300026041 Ga0207639_10090898 Ga0207639_100908981 271
254 3300028381 Ga0268264_10004863 Ga0268264_100048639 271
255 3300045051 Ga0451576_0089891 Ga0451576_0089891_1100_1966 271
256 3300046522 Ga0495643_0049136 Ga0495643_0049136_52_909 271
257 3300053136 Ga0500559_0012113 Ga0500559_0012113_499_1443 271
258 3300053138 Ga0500564_015387 Ga0500564_015387_1918_2862 271
259 3300005356 Ga0070674_100081578 Ga0070674_1000815781 272
260 3300042876 Ga0451577_0001915 Ga0451577_0001915_20947_21801 272
261 3300044656 Ga0466969_0001965 Ga0466969_0001965_2397_3338 272
262 3300044683 Ga0466965_0065288 Ga0466965_0065288_849_1790 272
263 3300044693 Ga0466961_0116422 Ga0466961_0116422_597_1538 272
264 3300044719 Ga0466971_0012864 Ga0466971_0012864_2397_3338 272
265 3300044765 Ga0466970_0034940 Ga0466970_0034940_1025_1966 272
266 3300044842 Ga0466957_0015737 Ga0466957_0015737_2675_3616 272
267 3300045049 Ga0466959_0024270 Ga0466959_0024270_3386_4327 272
268 3300045836 Ga0466958_0062369 Ga0466958_0062369_402_1343 272
269 3300045976 Ga0466967_0214421 Ga0466967_0214421_558_1499 272
270 3300061719 Ga0466962_0035189 Ga0466962_0035189_735_1676 272
271 3300002987 JGI25159J45721_1000769 JGI25159J45721_10007696 273
272 3300003354 JGI25160J50197_1000253 JGI25160J50197_100025318 273
273 3300003374 JGI25161J50226_1000046 JGI25161J50226_100004670 273
274 3300004625 Ga0055543_1000957 Ga0055543_100095713 273
275 3300005336 Ga0070680_100002568 Ga0070680_10000256813 273
276 3300005458 Ga0070681_10097499 Ga0070681_100974992 273
277 3300025284 Ga0209130_1000064 Ga0209130_100006470 273
278 3300025298 Ga0209050_1005557 Ga0209050_10055574 273
279 3300025302 Ga0207426_1000116 Ga0207426_100011647 273
280 3300025912 Ga0207707_10023353 Ga0207707_100233535 273
281 3300025917 Ga0207660_10184898 Ga0207660_101848982 273
282 3300003322 rootL2_10133502 rootL2_101335022 274
283 3300003323 rootH1_10079535 rootH1_100795353 274
284 3300028794 Ga0307515_10056643 Ga0307515_100566431 274
285 3300031649 Ga0307514_10084638 Ga0307514_100846382 274
286 3300031730 Ga0307516_10005507 Ga0307516_100055079 274
287 3300041443 Ga0451789_0866159 Ga0451789_0866159_468_1334 274
288 3300041509 Ga0451843_0782854 Ga0451843_0782854_170_1036 274
289 3300041512 Ga0451853_2355776 Ga0451853_2355776_90_956 274
290 3300046512 Ga0495610_0041050 Ga0495610_0041050_535_1401 274
291 3300046519 Ga0495632_0014952 Ga0495632_0014952_631_1497 274
292 3300046660 Ga0495625_0014961 Ga0495625_0014961_4320_5186 274
293 3300047472 Ga0495686_0076034 Ga0495686_0076034_591_1457 274
294 3300050493 nmdc:mga0k408_58692_c1 nmdc:mga0k408_58692_c1_73_939 274
295 3300050496 nmdc:mga07m45_35343_c1 nmdc:mga07m45_35343_c1_840_1706 274
296 3300005840 Ga0068870_10092748 Ga0068870_100927482 275
297 3300012502 Ga0157347_1000790 Ga0157347_10007902 275
298 3300013104 Ga0157370_10010716 Ga0157370_100107167 275
299 3300014497 Ga0182008_10005465 Ga0182008_100054652 275
300 3300017792 Ga0163161_10000564 Ga0163161_1000056419 275
301 3300025908 Ga0207643_10049564 Ga0207643_100495643 275
302 3300028666 Ga0265336_10000040 Ga0265336_1000004075 275
303 3300028794 Ga0307515_10001613 Ga0307515_1000161337 275
304 3300028794 Ga0307515_10003475 Ga0307515_1000347518 275
305 3300029957 Ga0265324_10001969 Ga0265324_100019693 275
306 3300031616 Ga0307508_10000043 Ga0307508_10000043109 275
307 3300031911 Ga0307412_10001244 Ga0307412_100012445 275
308 3300046674 Ga0495588_0011839 Ga0495588_0011839_610_1461 275
309 3300014497 Ga0182008_10001156 Ga0182008_100011562 276
310 3300035089 Ga0373944_0058267 Ga0373944_0058267_303_1166 276
311 3300035171 Ga0373946_0059806 Ga0373946_0059806_736_1599 276
312 3300035410 Ga0373924_0047133 Ga0373924_0047133_444_1307 276
313 3300037068 Ga0373925_0194322 Ga0373925_0194322_88_951 276
314 3300044901 Ga0466960_0016896 Ga0466960_0016896_2170_3027 276
315 3300046683 Ga0495658_0217190 Ga0495658_0217190_194_1057 276
316 3300053085 Ga0495619_0341975 Ga0495619_0341975_103_966 276
317 3300005329 Ga0070683_100278424 Ga0070683_1002784242 277
318 3300005344 Ga0070661_100033654 Ga0070661_1000336542 277
319 3300005366 Ga0070659_100011368 Ga0070659_1000113682 277
320 3300005367 Ga0070667_100019496 Ga0070667_1000194962 277
321 3300005535 Ga0070684_100009956 Ga0070684_1000099563 277
322 3300005548 Ga0070665_100684470 Ga0070665_1006844701 277
323 3300005563 Ga0068855_100095395 Ga0068855_1000953953 277
324 3300005564 Ga0070664_100017065 Ga0070664_1000170652 277
325 3300005616 Ga0068852_100050103 Ga0068852_1000501032 277
326 3300009551 Ga0105238_10176341 Ga0105238_101763412 277
327 3300013104 Ga0157370_10284216 Ga0157370_102842162 277
328 3300025919 Ga0207657_10017103 Ga0207657_100171037 277
329 3300025920 Ga0207649_10010331 Ga0207649_100103312 277
330 3300025944 Ga0207661_10054807 Ga0207661_100548072 277
331 3300026078 Ga0207702_10014290 Ga0207702_100142907 277
332 3300028379 Ga0268266_10087364 Ga0268266_100873642 277
333 3300031731 Ga0307405_10004482 Ga0307405_100044825 277
334 3300031911 Ga0307412_10034980 Ga0307412_100349802 277
335 3300031995 Ga0307409_100001001 Ga0307409_10000100112 277
336 3300032002 Ga0307416_100010461 Ga0307416_1000104612 277
337 3300032126 Ga0307415_100002908 Ga0307415_1000029086 277
338 3300039447 Ga0436361_0178218 Ga0436361_0178218_79_930 277
339 iso_pu_bacteria 2511231002 2511243581 277
340 3300005367 Ga0070667_100039064 Ga0070667_1000390642 278
341 3300025986 Ga0207658_10020803 Ga0207658_100208032 278
342 3300037068 Ga0373925_0458646 Ga0373925_0458646_66_926 278
343 3300027876 Ga0209974_10008157 Ga0209974_100081572 279
344 iso_pu_bacteria 2643221544 2643742993 279
345 iso_pu_bacteria 2643221585 2643932989 279
346 iso_pu_bacteria 2643221639 2644217137 279
347 iso_pu_bacteria 2643221646 2644260490 279
348 iso_pu_bacteria 2738541337 2739055843 279
349 iso_pu_bacteria 2881101125 2881103089 279
350 3300026116 Ga0207674_10015017 Ga0207674_100150172 280
351 3300028794 Ga0307515_10115937 Ga0307515_101159372 280
352 3300032004 Ga0307414_10177699 Ga0307414_101776992 280
353 3300032005 Ga0307411_10298609 Ga0307411_102986092 280
354 3300003187 JGI25151J46595_10002974 JGI25151J46595_100029746 281
355 3300025291 Ga0209675_1015397 Ga0209675_10153972 281
356 3300025292 Ga0209676_1004766 Ga0209676_10047663 281
357 3300025294 Ga0209025_1008226 Ga0209025_10082265 281
358 3300025295 Ga0209564_1004673 Ga0209564_10046736 281
359 3300025298 Ga0209050_1010422 Ga0209050_10104225 281
360 3300025304 Ga0209257_1004718 Ga0209257_100471810 281
361 3300046542 Ga0495597_0000375 Ga0495597_0000375_24297_25157 281
362 iso_pu_bacteria 2547132374 2548501517 281
363 iso_pu_bacteria 2643221570 2643867284 281
364 iso_pu_bacteria 2643221596 2643990201 281
365 iso_pu_bacteria 2643221609 2644059256 281
366 iso_pu_bacteria 2643221611 2644075706 281
367 iso_pu_bacteria 2643221652 2644295692 281
368 iso_pu_bacteria 2643221654 2644301343 281
369 iso_pu_bacteria 2643221717 2644645236 281
370 iso_pu_bacteria 2738543012 2739240751 281
371 iso_pu_bacteria 2816332133 2816472170 281
372 iso_pu_bacteria 2894023352 2894027368 281
373 iso_pu_bacteria 2928115317 2928117236 281
374 iso_pu_bacteria 2974320154 2974320663 281
375 iso_pu_bacteria 2990710928 2990711080 281
376 3300003792 Ga0055540_1007525 Ga0055540_10075254 282
377 3300003794 Ga0055531_10001570 Ga0055531_100015709 282
378 3300005327 Ga0070658_10208714 Ga0070658_102087142 282
379 3300005329 Ga0070683_100228511 Ga0070683_1002285112 282
380 3300005331 Ga0070670_100063695 Ga0070670_1000636952 282
381 3300005355 Ga0070671_100196592 Ga0070671_1001965921 282
382 3300005366 Ga0070659_100276764 Ga0070659_1002767641 282
383 3300005539 Ga0068853_100232610 Ga0068853_1002326102 282
384 3300005563 Ga0068855_100006754 Ga0068855_10000675411 282
385 3300005564 Ga0070664_100136616 Ga0070664_1001366162 282
386 3300005614 Ga0068856_100150851 Ga0068856_1001508512 282
387 3300005614 Ga0068856_100558853 Ga0068856_1005588532 282
388 3300005616 Ga0068852_100025591 Ga0068852_1000255916 282
389 3300009093 Ga0105240_10049322 Ga0105240_100493227 282
390 3300013104 Ga0157370_10413031 Ga0157370_104130312 282
391 3300025273 Ga0209673_1023111 Ga0209673_10231112 282
392 3300025303 Ga0209051_1000025 Ga0209051_1000025297 282
393 3300025304 Ga0209257_1000039 Ga0209257_1000039311 282
394 3300025913 Ga0207695_10102107 Ga0207695_101021071 282
395 3300025919 Ga0207657_10195011 Ga0207657_101950111 282
396 3300025931 Ga0207644_10238484 Ga0207644_102384842 282
397 3300025940 Ga0207691_10077575 Ga0207691_100775751 282
398 3300025944 Ga0207661_10446005 Ga0207661_104460051 282
399 3300025949 Ga0207667_10126281 Ga0207667_101262814 282
400 3300026041 Ga0207639_10133886 Ga0207639_101338862 282
401 3300026121 Ga0207683_10253289 Ga0207683_102532892 282
402 3300026121 Ga0207683_10408333 Ga0207683_104083331 282
403 3300026142 Ga0207698_10011200 Ga0207698_100112004 282
404 3300037418 Ga0395900_0036742 Ga0395900_0036742_853_1707 282
405 3300037466 Ga0395898_0061066 Ga0395898_0061066_2246_3100 282
406 3300037471 Ga0395905_0017590 Ga0395905_0017590_1773_2624 282
407 3300037471 Ga0395905_0029251 Ga0395905_0029251_2455_3309 282
408 3300037471 Ga0395905_0030931 Ga0395905_0030931_2922_3776 282
409 3300041512 Ga0451853_3936200 Ga0451853_3936200_248_1111 282
410 3300044673 Ga0453683_0012856 Ga0453683_0012856_2842_3696 282
411 3300044712 Ga0453684_0016471 Ga0453684_0016471_6587_7453 282
412 3300045051 Ga0451576_0012538 Ga0451576_0012538_4504_5358 282
413 3300045976 Ga0466967_0171989 Ga0466967_0171989_137_991 282
414 3300046472 Ga0495580_0061350 Ga0495580_0061350_724_1590 282
415 3300046558 Ga0495633_0001773 Ga0495633_0001773_9891_10763 282
416 3300047322 Ga0495680_0196936 Ga0495680_0196936_447_1310 282
417 3300048917 Ga0496114_0041467 Ga0496114_0041467_141_1004 282
418 3300048925 Ga0496122_0086310 Ga0496122_0086310_687_1559 282
419 3300048926 Ga0496123_0101812 Ga0496123_0101812_347_1219 282
420 3300048928 Ga0496125_0066725 Ga0496125_0066725_1318_2190 282
421 3300050492 nmdc:mga0yw44_155736_c1 nmdc:mga0yw44_155736_c1_142_996 282
422 iso_pu_bacteria 2585428057 2587725683 282
423 iso_pu_bacteria 2585428058 2587735118 282
424 iso_pu_bacteria 2588253510 2588290614 282
425 iso_pu_bacteria 2643221592 2643968328 282
426 iso_pu_bacteria 2643221625 2644143519 282
427 iso_pu_bacteria 2643221648 2644272106 282
428 iso_pu_bacteria 2932422444 2932425465 282
429 3300002705 JGI25156J39149_1000972 JGI25156J39149_100097216 283
430 3300002705 JGI25156J39149_1002726 JGI25156J39149_10027262 283
431 3300002738 JGI25154J39366_1009191 JGI25154J39366_10091911 283
432 3300002741 JGI25157J39369_1000566 JGI25157J39369_100056611 283
433 3300002772 JGI25164J39214_1008120 JGI25164J39214_10081201 283
434 3300003752 Ga0055539_1000858 Ga0055539_10008587 283
435 3300003752 Ga0055539_1000894 Ga0055539_10008942 283
436 3300003756 Ga0055533_1000033 Ga0055533_1000033188 283
437 3300003759 Ga0055525_1001219 Ga0055525_10012194 283
438 3300005330 Ga0070690_100033317 Ga0070690_1000333173 283
439 3300005334 Ga0068869_100034989 Ga0068869_1000349893 283
440 3300005353 Ga0070669_100159050 Ga0070669_1001590502 283
441 3300005355 Ga0070671_100005899 Ga0070671_1000058999 283
442 3300005539 Ga0068853_100212017 Ga0068853_1002120172 283
443 3300005563 Ga0068855_100011358 Ga0068855_1000113587 283
444 3300005577 Ga0068857_100021590 Ga0068857_1000215902 283
445 3300005578 Ga0068854_100040764 Ga0068854_1000407642 283
446 3300005614 Ga0068856_100006477 Ga0068856_10000647712 283
447 3300005616 Ga0068852_100211832 Ga0068852_1002118322 283
448 3300005719 Ga0068861_100017625 Ga0068861_1000176253 283
449 3300005843 Ga0068860_100259063 Ga0068860_1002590632 283
450 3300006195 Ga0075366_10009515 Ga0075366_100095155 283
451 3300006195 Ga0075366_10012697 Ga0075366_100126972 283
452 3300009093 Ga0105240_10007963 Ga0105240_1000796313 283
453 3300009545 Ga0105237_10041466 Ga0105237_100414663 283
454 3300009551 Ga0105238_10020120 Ga0105238_100201205 283
455 3300010375 Ga0105239_10024247 Ga0105239_100242472 283
456 3300011119 Ga0105246_10060985 Ga0105246_100609852 283
457 3300013105 Ga0157369_10147163 Ga0157369_101471632 283
458 3300013297 Ga0157378_10179747 Ga0157378_101797472 283
459 3300013307 Ga0157372_10713454 Ga0157372_107134542 283
460 3300025226 Ga0209674_100064 Ga0209674_10006460 283
461 3300025230 Ga0209563_100099 Ga0209563_10009960 283
462 3300025231 Ga0207427_102578 Ga0207427_1025783 283
463 3300025242 Ga0209258_100759 Ga0209258_10075911 283
464 3300025246 Ga0209646_1000060 Ga0209646_1000060183 283
465 3300025250 Ga0209026_1000049 Ga0209026_1000049181 283
466 3300025253 Ga0209677_100331 Ga0209677_10033115 283
467 3300025253 Ga0209677_100823 Ga0209677_1008237 283
468 3300025256 Ga0209759_1000272 Ga0209759_100027212 283
469 3300025909 Ga0207705_10218367 Ga0207705_102183672 283
470 3300025913 Ga0207695_10011317 Ga0207695_100113176 283
471 3300025914 Ga0207671_10014611 Ga0207671_100146112 283
472 3300025918 Ga0207662_10047176 Ga0207662_100471762 283
473 3300025924 Ga0207694_10033859 Ga0207694_100338592 283
474 3300025942 Ga0207689_10055686 Ga0207689_100556863 283
475 3300025944 Ga0207661_10024950 Ga0207661_100249505 283
476 3300025949 Ga0207667_10058113 Ga0207667_100581132 283
477 3300025949 Ga0207667_10083721 Ga0207667_100837212 283
478 3300025981 Ga0207640_10010011 Ga0207640_100100112 283
479 3300026041 Ga0207639_10070410 Ga0207639_100704102 283
480 3300026078 Ga0207702_10000395 Ga0207702_1000039548 283
481 3300026095 Ga0207676_10400617 Ga0207676_104006172 283
482 3300026116 Ga0207674_10003791 Ga0207674_100037917 283
483 3300026142 Ga0207698_10258495 Ga0207698_102584952 283
484 3300032004 Ga0307414_10215121 Ga0307414_102151212 283
485 3300035692 Ga0373935_0249640 Ga0373935_0249640_189_1064 283
486 3300036401 Ga0373937_0151180 Ga0373937_0151180_59_913 283
487 3300046543 Ga0495645_0054269 Ga0495645_0054269_1227_2096 283
488 3300048907 Ga0496104_0305658 Ga0496104_0305658_229_1089 283
489 3300048911 Ga0496108_0072339 Ga0496108_0072339_712_1572 283
490 3300048912 Ga0496109_0370478 Ga0496109_0370478_443_1303 283
491 3300048916 Ga0496113_0004477 Ga0496113_0004477_2381_3241 283
492 3300049568 Ga0501031_0001318 Ga0501031_0001318_7310_8173 283
493 3300050493 nmdc:mga0k408_3641_c1 nmdc:mga0k408_3641_c1_1312_2181 283
494 3300050493 nmdc:mga0k408_8906_c1 nmdc:mga0k408_8906_c1_4368_5243 283
495 3300006195 Ga0075366_10006389 Ga0075366_100063896 284
496 3300006353 Ga0075370_10006473 Ga0075370_100064732 284
497 3300006353 Ga0075370_10024535 Ga0075370_100245352 284
498 3300028794 Ga0307515_10021372 Ga0307515_100213727 284
499 3300050493 nmdc:mga0k408_1901_c1 nmdc:mga0k408_1901_c1_8215_9072 284
500 3300050496 nmdc:mga07m45_260_c1 nmdc:mga07m45_260_c1_4192_5049 284
501 3300050496 nmdc:mga07m45_26703_c1 nmdc:mga07m45_26703_c1_987_1868 284
502 iso_pu_bacteria 2585428062 2587754108 284
503 3300005328 Ga0070676_10100387 Ga0070676_101003872 285
504 3300005334 Ga0068869_100016765 Ga0068869_1000167652 285
505 3300005334 Ga0068869_100096507 Ga0068869_1000965072 285
506 3300005338 Ga0068868_100009022 Ga0068868_1000090227 285
507 3300005339 Ga0070660_100139789 Ga0070660_1001397892 285
508 3300005354 Ga0070675_100005231 Ga0070675_1000052315 285
509 3300005355 Ga0070671_100162616 Ga0070671_1001626162 285
510 3300005364 Ga0070673_100009689 Ga0070673_1000096898 285
511 3300005367 Ga0070667_100208636 Ga0070667_1002086362 285
512 3300005445 Ga0070708_100064215 Ga0070708_1000642153 285
513 3300005455 Ga0070663_100000198 Ga0070663_10000019824 285
514 3300005457 Ga0070662_100081218 Ga0070662_1000812182 285
515 3300005457 Ga0070662_100439760 Ga0070662_1004397601 285
516 3300005459 Ga0068867_100005705 Ga0068867_1000057055 285
517 3300005459 Ga0068867_100564593 Ga0068867_1005645931 285
518 3300005467 Ga0070706_100001272 Ga0070706_10000127213 285
519 3300005468 Ga0070707_100172792 Ga0070707_1001727921 285
520 3300005518 Ga0070699_100108923 Ga0070699_1001089232 285
521 3300005539 Ga0068853_100348651 Ga0068853_1003486512 285
522 3300005543 Ga0070672_100003578 Ga0070672_1000035786 285
523 3300005564 Ga0070664_100212997 Ga0070664_1002129972 285
524 3300005577 Ga0068857_100008700 Ga0068857_1000087008 285
525 3300005578 Ga0068854_100066543 Ga0068854_1000665432 285
526 3300005616 Ga0068852_100099104 Ga0068852_1000991042 285
527 3300005617 Ga0068859_100324239 Ga0068859_1003242392 285
528 3300005617 Ga0068859_100414573 Ga0068859_1004145732 285
529 3300005719 Ga0068861_100574453 Ga0068861_1005744531 285
530 3300005840 Ga0068870_10039137 Ga0068870_100391373 285
531 3300006038 Ga0075365_10042544 Ga0075365_100425443 285
532 3300006042 Ga0075368_10011203 Ga0075368_100112032 285
533 3300006042 Ga0075368_10016929 Ga0075368_100169292 285
534 3300006042 Ga0075368_10027570 Ga0075368_100275702 285
535 3300006048 Ga0075363_100034513 Ga0075363_1000345134 285
536 3300006048 Ga0075363_100083888 Ga0075363_1000838882 285
537 3300006051 Ga0075364_10010377 Ga0075364_100103773 285
538 3300006177 Ga0075362_10024741 Ga0075362_100247412 285
539 3300006177 Ga0075362_10048743 Ga0075362_100487431 285
540 3300006178 Ga0075367_10009505 Ga0075367_100095052 285
541 3300006178 Ga0075367_10034083 Ga0075367_100340832 285
542 3300006186 Ga0075369_10002060 Ga0075369_100020609 285
543 3300006186 Ga0075369_10015885 Ga0075369_100158852 285
544 3300006195 Ga0075366_10005597 Ga0075366_100055972 285
545 3300006195 Ga0075366_10014216 Ga0075366_100142166 285
546 3300006195 Ga0075366_10047676 Ga0075366_100476763 285
547 3300006195 Ga0075366_10244316 Ga0075366_102443162 285
548 3300006353 Ga0075370_10000655 Ga0075370_1000065510 285
549 3300006353 Ga0075370_10009074 Ga0075370_100090743 285
550 3300006353 Ga0075370_10011334 Ga0075370_100113342 285
551 3300006353 Ga0075370_10051300 Ga0075370_100513003 285
552 3300006353 Ga0075370_10218939 Ga0075370_102189392 285
553 3300006353 Ga0075370_10261746 Ga0075370_102617462 285
554 3300006931 Ga0097620_100324274 Ga0097620_1003242742 285
555 3300006931 Ga0097620_100414503 Ga0097620_1004145032 285
556 3300009093 Ga0105240_10242553 Ga0105240_102425532 285
557 3300009098 Ga0105245_10534768 Ga0105245_105347681 285
558 3300009148 Ga0105243_10053189 Ga0105243_100531892 285
559 3300009148 Ga0105243_10353677 Ga0105243_103536772 285
560 3300009545 Ga0105237_10023375 Ga0105237_100233752 285
561 3300010375 Ga0105239_10040868 Ga0105239_100408685 285
562 3300011119 Ga0105246_10331703 Ga0105246_103317032 285
563 3300013308 Ga0157375_10006468 Ga0157375_100064686 285
564 3300014968 Ga0157379_10142805 Ga0157379_101428052 285
565 3300025907 Ga0207645_10004178 Ga0207645_100041784 285
566 3300025908 Ga0207643_10026718 Ga0207643_100267182 285
567 3300025910 Ga0207684_10003606 Ga0207684_1000360615 285
568 3300025913 Ga0207695_10242856 Ga0207695_102428562 285
569 3300025914 Ga0207671_10031203 Ga0207671_100312032 285
570 3300025919 Ga0207657_10148954 Ga0207657_101489542 285
571 3300025925 Ga0207650_10205841 Ga0207650_102058412 285
572 3300025931 Ga0207644_10026852 Ga0207644_100268523 285
573 3300025933 Ga0207706_10035099 Ga0207706_100350995 285
574 3300025933 Ga0207706_10165269 Ga0207706_101652692 285
575 3300025935 Ga0207709_10355769 Ga0207709_103557691 285
576 3300025940 Ga0207691_10008114 Ga0207691_100081146 285
577 3300025942 Ga0207689_10012076 Ga0207689_100120765 285
578 3300025942 Ga0207689_10028540 Ga0207689_100285402 285
579 3300025942 Ga0207689_10127806 Ga0207689_101278062 285
580 3300025945 Ga0207679_10176253 Ga0207679_101762532 285
581 3300025960 Ga0207651_10082429 Ga0207651_100824292 285
582 3300025986 Ga0207658_10027903 Ga0207658_100279035 285
583 3300025986 Ga0207658_10247812 Ga0207658_102478122 285
584 3300026023 Ga0207677_10008876 Ga0207677_100088765 285
585 3300026041 Ga0207639_10338382 Ga0207639_103383822 285
586 3300026067 Ga0207678_10000684 Ga0207678_100006846 285
587 3300026089 Ga0207648_10003979 Ga0207648_1000397910 285
588 3300026089 Ga0207648_10055216 Ga0207648_100552163 285
589 3300026095 Ga0207676_10446029 Ga0207676_104460292 285
590 3300026118 Ga0207675_100583168 Ga0207675_1005831681 285
591 3300027866 Ga0209813_10041789 Ga0209813_100417892 285
592 3300030522 Ga0307512_10036130 Ga0307512_100361304 285
593 3300031456 Ga0307513_10415004 Ga0307513_104150041 285
594 3300031507 Ga0307509_10000991 Ga0307509_1000099145 285
595 3300031507 Ga0307509_10052470 Ga0307509_100524703 285
596 3300031507 Ga0307509_10059174 Ga0307509_100591742 285
597 3300031616 Ga0307508_10003877 Ga0307508_1000387710 285
598 3300031649 Ga0307514_10101224 Ga0307514_101012242 285
599 3300031730 Ga0307516_10118594 Ga0307516_101185943 285
600 3300033180 Ga0307510_10000294 Ga0307510_1000029412 285
601 3300033180 Ga0307510_10102687 Ga0307510_101026872 285
602 3300035691 Ga0373931_0016307 Ga0373931_0016307_179_1039 285
603 3300042157 Ga0439458_0027546 Ga0439458_0027546_332_1189 285
604 3300044656 Ga0466969_0041892 Ga0466969_0041892_948_1805 285
605 3300044683 Ga0466965_0039041 Ga0466965_0039041_634_1491 285
606 3300044693 Ga0466961_0006094 Ga0466961_0006094_1724_2581 285
607 3300044706 Ga0466964_0020809 Ga0466964_0020809_831_1688 285
608 3300044719 Ga0466971_0069733 Ga0466971_0069733_223_1080 285
609 3300044765 Ga0466970_0100098 Ga0466970_0100098_454_1311 285
610 3300046454 Ga0495592_0000083 Ga0495592_0000083_24475_25332 285
611 3300046512 Ga0495610_0047763 Ga0495610_0047763_488_1345 285
612 3300046519 Ga0495632_0054047 Ga0495632_0054047_39_899 285
613 3300046524 Ga0495648_0229094 Ga0495648_0229094_13_873 285
614 3300046660 Ga0495625_0021227 Ga0495625_0021227_715_1572 285
615 3300046660 Ga0495625_0139309 Ga0495625_0139309_35_895 285
616 3300046680 Ga0495646_0074550 Ga0495646_0074550_703_1560 285
617 3300046690 Ga0495624_0079091 Ga0495624_0079091_414_1274 285
618 3300047321 Ga0495676_0130461 Ga0495676_0130461_131_991 285
619 3300047443 Ga0495687_001691 Ga0495687_001691_8156_9013 285
620 3300048089 Ga0495614_0096387 Ga0495614_0096387_392_1252 285
621 3300048091 Ga0495626_0014929 Ga0495626_0014929_1301_2158 285
622 3300048091 Ga0495626_0035099 Ga0495626_0035099_268_1125 285
623 3300050489 nmdc:mga03683_13049_c1 nmdc:mga03683_13049_c1_774_1631 285
624 3300050489 nmdc:mga03683_7894_c1 nmdc:mga03683_7894_c1_2204_3061 285
625 3300050489 nmdc:mga03683_7924_c1 nmdc:mga03683_7924_c1_2769_3626 285
626 3300050492 nmdc:mga0yw44_277429_c1 nmdc:mga0yw44_277429_c1_18_875 285
627 3300050493 nmdc:mga0k408_161_c1 nmdc:mga0k408_161_c1_30112_30969 285
628 3300050493 nmdc:mga0k408_178873_c1 nmdc:mga0k408_178873_c1_74_931 285
629 3300050493 nmdc:mga0k408_180_c1 nmdc:mga0k408_180_c1_22498_23355 285
630 3300050493 nmdc:mga0k408_2769_c1 nmdc:mga0k408_2769_c1_954_1811 285
631 3300050493 nmdc:mga0k408_76182_c1 nmdc:mga0k408_76182_c1_892_1752 285
632 3300050494 nmdc:mga06z11_342090_c1 nmdc:mga06z11_342090_c1_16_873 285
633 3300050494 nmdc:mga06z11_97021_c1 nmdc:mga06z11_97021_c1_464_1321 285
634 3300050495 nmdc:mga04h51_50128_c1 nmdc:mga04h51_50128_c1_117_974 285
635 3300050496 nmdc:mga07m45_134411_c1 nmdc:mga07m45_134411_c1_506_1366 285
636 3300050496 nmdc:mga07m45_15789_c1 nmdc:mga07m45_15789_c1_543_1400 285
637 3300050496 nmdc:mga07m45_26675_c2 nmdc:mga07m45_26675_c2_713_1582 285
638 3300050496 nmdc:mga07m45_31900_c1 nmdc:mga07m45_31900_c1_914_1771 285
639 3300050516 nmdc:mga0sz30_1923_c2 nmdc:mga0sz30_1923_c2_918_1775 285
640 3300050516 nmdc:mga0sz30_55036_c1 nmdc:mga0sz30_55036_c1_580_1437 285
641 3300053088 Ga0500644_0042428 Ga0500644_0042428_404_1261 285
642 3300053098 Ga0500650_0143386 Ga0500650_0143386_45_905 285
643 3300053118 Ga0500594_0000825 Ga0500594_0000825_5049_5906 285
644 3300053134 Ga0500658_0001840 Ga0500658_0001840_3654_4511 285
645 3300053136 Ga0500559_0000019 Ga0500559_0000019_76651_77508 285
646 3300053156 Ga0500622_0007525 Ga0500622_0007525_4641_5498 285
647 3300053177 Ga0500636_0069923 Ga0500636_0069923_692_1549 285
648 3300061719 Ga0466962_0027502 Ga0466962_0027502_1157_2014 285
649 3300002773 JGI25152J39213_1001870 JGI25152J39213_10018705 286
650 3300002774 JGI25150J39212_1011469 JGI25150J39212_10114692 286
651 3300003215 JGI25153J46596_10001512 JGI25153J46596_100015127 286
652 3300003215 JGI25153J46596_10006965 JGI25153J46596_100069652 286
653 3300003771 Ga0055526_1001924 Ga0055526_10019242 286
654 3300003775 Ga0055524_1000146 Ga0055524_10001469 286
655 3300006195 Ga0075366_10126329 Ga0075366_101263292 286
656 3300006946 Ga0079104_1000001 Ga0079104_1000001304 286
657 3300025245 Ga0207425_1001180 Ga0207425_10011807 286
658 3300025258 Ga0209129_1000342 Ga0209129_100034235 286
659 3300025291 Ga0209675_1007775 Ga0209675_10077752 286
660 3300025295 Ga0209564_1000136 Ga0209564_100013646 286
661 3300025297 Ga0209758_1000045 Ga0209758_1000045335 286
662 3300025297 Ga0209758_1000502 Ga0209758_100050246 286
663 3300025298 Ga0209050_1024043 Ga0209050_10240432 286
664 3300025299 Ga0209256_1000015 Ga0209256_1000015396 286
665 3300025299 Ga0209256_1013911 Ga0209256_10139112 286
666 3300025304 Ga0209257_1010588 Ga0209257_10105885 286
667 3300025304 Ga0209257_1025307 Ga0209257_10253072 286
668 3300026041 Ga0207639_10063225 Ga0207639_100632252 286
669 3300027111 Ga0209281_1000057 Ga0209281_100005715 286
670 3300046519 Ga0495632_0015142 Ga0495632_0015142_2644_3504 286
671 3300048905 Ga0496102_0009788 Ga0496102_0009788_2835_3698 286
672 3300048905 Ga0496102_0015544 Ga0496102_0015544_2337_3200 286
673 3300048917 Ga0496114_0010776 Ga0496114_0010776_1672_2532 286
674 3300050491 nmdc:mga00v17_387535_c1 nmdc:mga00v17_387535_c1_21_881 286
675 3300050493 nmdc:mga0k408_147497_c1 nmdc:mga0k408_147497_c1_297_1157 286
676 3300050496 nmdc:mga07m45_4971_c1 nmdc:mga07m45_4971_c1_22_882 286
677 3300053117 Ga0500593_036096 Ga0500593_036096_370_1233 286
678 3300053129 Ga0500628_019308 Ga0500628_019308_112_972 286
679 3300053131 Ga0500652_004319 Ga0500652_004319_433_1293 286
680 3300053142 Ga0500577_0001979 Ga0500577_0001979_4044_4904 286
681 3300053151 Ga0500604_0009570 Ga0500604_0009570_1492_2352 286
682 3300053156 Ga0500622_0012262 Ga0500622_0012262_441_1301 286
683 3300053156 Ga0500622_0078978 Ga0500622_0078978_507_1367 286
684 3300001979 JGI24740J21852_10011214 JGI24740J21852_100112142 288
685 3300025934 Ga0207686_10080915 Ga0207686_100809152 288
686 3300025949 Ga0207667_10050496 Ga0207667_100504966 288
687 3300042007 Ga0439449_0048916 Ga0439449_0048916_581_1459 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03544

TonB_C

Gram-negative bacterial TonB protein C-terminal

223

294

0.86

PF13103

TonB_2

TonB C terminal

200

289

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lw8-assembly1.cif.gz_A nmr solution structure of helicobacter pylori tonb-ctd (residues 194-285) 0.7383 180 271
1y2o-assembly1.cif.gz_B structure of n-terminal domain irsp53/baiap2 0.7005 94 152
1tol-assembly1.cif.gz_A fusion of n-terminal domain of the minor coat protein from gene iii in phage m13, and c-terminal domain of e. coli protein-tola 0.6992 179 282
2x9a-assembly1.cif.gz_D crystal structure of g3p from phage if1 in complex with its coreceptor, the c-terminal domain of tola 0.6952 178 265
6fip-assembly1.cif.gz_A solution nmr structure of pseudomonas aeruginosa tonb ctd 0.6855 204 273
ID Description Score Start End Superfamily
af_P38873_702_876_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7886 100 153 1.25.10.10
3d0tC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7388 89 154 1.20.58.890
3d0tB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7035 89 162 1.20.58.890
af_A0A0R4ITC8_9_100_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6861 93 163 1.20.58.80
3d0tB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6551 89 162 1.20.58.890
ID Description Score Start End GO Terms
AF-A0A4Q5WHL5-F1-model_v4 deleted 0.9827 104 283
AF-A0A7V8BS15-F1-model_v4 deleted 0.9738 158 285
AF-A0A4Q5WHL5-F1-model_v4 deleted 0.972 104 283
AF-A0A259JV99-F1-model_v4 deleted 0.9606 180 283
AF-A0A259JV99-F1-model_v4 deleted 0.9515 180 283

Feature Viewer

pLDDT pTM Quality
77.14 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map