F475226
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 687 | 361 | 658 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300002705|JGI25156J39149_1000972|JGI25156J39149_100097216 |
| Length | 308 |
| Sequence | MDKNFKRPPQRQMFAAEPLSVRIRKWRPSVMQLALTISITLHAAVLGVRIVDPQDFNRVFQDTPLEVVLVNARSSEAPTKAQAIAQANLAGGGEAEAGLATSPLPPSPNELVGDEQTDSTRKIQADEQEQQQLLANVRRDIAAMPVPDPRKARMTPAERETEELRQQKLRLLAAIEKRINEENSRPRRRYISPSTREEVYAIYYDKLRHKIEDKGTANFPSLNGHKLYGELTVNLTIDARGRVVESEIVHSSNSRFLDQRALAIAQAAAPFGNFSDDMKRKADQIVVTSRFRFTKTEGMQATMTNNGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 10 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 11 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 12 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 13 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 14 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 15 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 16 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 17 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 18 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 19 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 20 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 21 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 22 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 23 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 24 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 25 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 26 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 27 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 28 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 29 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 30 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 31 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 32 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 33 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 34 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 35 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 36 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 37 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 38 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 39 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 44 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 45 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 46 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 47 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 67 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 69 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 95 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 97 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 98 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 120 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 145 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 224 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 230 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 231 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 232 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 234 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 237 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 262 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 320 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 330 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 337 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 347 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 349 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 350 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 351 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 358 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 360 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.78 |
| Metatranscriptomes | 0 |
| Isolates | 4.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.78 |
| Nodule | 0.87 |
| Rhizoplane | 3.2 |
| Rhizosphere | 57.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011214 | 3300001979 | Bacteria | 3419 |
| 2 | JGI25155J39150_1000029 | 3300002704 | Bacteria | 118964 |
| 3 | JGI25156J39149_1000062 | 3300002705 | Bacteria | 84500 |
| 4 | JGI25156J39149_1000972 | 3300002705 | Bacteria | 13646 |
| 5 | JGI25156J39149_1002726 | 3300002705 | Bacteria | 6154 |
| 6 | JGI25156J39149_1020393 | 3300002705 | Bacteria | 1168 |
| 7 | JGI25154J39366_1000053 | 3300002738 | Bacteria | 119466 |
| 8 | JGI25154J39366_1009191 | 3300002738 | Bacteria | 1229 |
| 9 | JGI25157J39369_1000046 | 3300002741 | Bacteria | 119470 |
| 10 | JGI25157J39369_1000566 | 3300002741 | Bacteria | 22112 |
| 11 | JGI25164J39214_1008120 | 3300002772 | Bacteria | 1054 |
| 12 | JGI25152J39213_1001870 | 3300002773 | Bacteria | 8476 |
| 13 | JGI25150J39212_1009044 | 3300002774 | Bacteria | 1918 |
| 14 | JGI25150J39212_1011469 | 3300002774 | Bacteria | 1605 |
| 15 | JGI25159J45721_1000769 | 3300002987 | Bacteria | 13948 |
| 16 | JGI25159J45721_1002357 | 3300002987 | Bacteria | 7218 |
| 17 | JGI25151J46595_10002974 | 3300003187 | Bacteria | 9676 |
| 18 | JGI25151J46595_10004157 | 3300003187 | Bacteria | 7731 |
| 19 | JGI25153J46596_10001512 | 3300003215 | Bacteria | 13857 |
| 20 | JGI25153J46596_10006965 | 3300003215 | Bacteria | 5632 |
| 21 | rootH2_10039549 | 3300003320 | Bacteria | 3861 |
| 22 | rootH2_10053827 | 3300003320 | Bacteria | 1125 |
| 23 | rootL2_10133502 | 3300003322 | Bacteria | 2195 |
| 24 | rootH1_10007874 | 3300003323 | Bacteria | 5429 |
| 25 | rootH1_10079535 | 3300003323 | Bacteria | 2594 |
| 26 | JGI25160J50197_1000253 | 3300003354 | Bacteria | 40838 |
| 27 | JGI25161J50226_1000046 | 3300003374 | Bacteria | 116165 |
| 28 | Ga0055539_1000858 | 3300003752 | Bacteria | 7077 |
| 29 | Ga0055539_1000894 | 3300003752 | Bacteria | 6786 |
| 30 | Ga0055539_1003632 | 3300003752 | Bacteria | 2133 |
| 31 | Ga0055533_1000033 | 3300003756 | Bacteria | 265716 |
| 32 | Ga0055525_1001219 | 3300003759 | Bacteria | 5640 |
| 33 | Ga0055535_1000551 | 3300003761 | Bacteria | 32122 |
| 34 | Ga0055535_1000729 | 3300003761 | Bacteria | 24824 |
| 35 | Ga0055529_1000486 | 3300003763 | Bacteria | 36917 |
| 36 | Ga0055526_1001278 | 3300003771 | Bacteria | 18039 |
| 37 | Ga0055526_1001924 | 3300003771 | Bacteria | 14362 |
| 38 | Ga0055526_1003435 | 3300003771 | Bacteria | 10051 |
| 39 | Ga0055537_1000828 | 3300003773 | Bacteria | 15203 |
| 40 | Ga0055537_1007772 | 3300003773 | Bacteria | 2542 |
| 41 | Ga0055524_1000044 | 3300003775 | Bacteria | 151631 |
| 42 | Ga0055524_1000146 | 3300003775 | Bacteria | 84190 |
| 43 | Ga0055536_1024379 | 3300003781 | Bacteria | 1753 |
| 44 | Ga0055528_1000287 | 3300003790 | Bacteria | 43121 |
| 45 | Ga0055530_10001754 | 3300003791 | Bacteria | 15171 |
| 46 | Ga0055540_1000116 | 3300003792 | Bacteria | 83801 |
| 47 | Ga0055540_1007525 | 3300003792 | Bacteria | 4089 |
| 48 | Ga0055531_10000181 | 3300003794 | Bacteria | 71324 |
| 49 | Ga0055531_10001297 | 3300003794 | Bacteria | 18841 |
| 50 | Ga0055531_10001570 | 3300003794 | Bacteria | 16720 |
| 51 | Ga0055543_1000957 | 3300004625 | Bacteria | 13219 |
| 52 | Ga0070658_10017380 | 3300005327 | Bacteria | 5755 |
| 53 | Ga0070658_10047156 | 3300005327 | Bacteria | 3487 |
| 54 | Ga0070658_10208714 | 3300005327 | Bacteria | 1649 |
| 55 | Ga0070676_10003513 | 3300005328 | Bacteria | 8187 |
| 56 | Ga0070676_10100387 | 3300005328 | Bacteria | 1787 |
| 57 | Ga0070683_100228511 | 3300005329 | Bacteria | 1769 |
| 58 | Ga0070683_100278424 | 3300005329 | Bacteria | 1591 |
| 59 | Ga0070690_100033317 | 3300005330 | Bacteria | 3224 |
| 60 | Ga0070670_100063695 | 3300005331 | Bacteria | 3164 |
| 61 | Ga0070677_10026888 | 3300005333 | Bacteria | 2161 |
| 62 | Ga0068869_100002073 | 3300005334 | Bacteria | 12041 |
| 63 | Ga0068869_100016765 | 3300005334 | Bacteria | 4946 |
| 64 | Ga0068869_100034989 | 3300005334 | Bacteria | 3557 |
| 65 | Ga0068869_100096507 | 3300005334 | Bacteria | 2231 |
| 66 | Ga0070680_100002568 | 3300005336 | Bacteria | 13425 |
| 67 | Ga0068868_100009022 | 3300005338 | Bacteria | 7157 |
| 68 | Ga0068868_100028923 | 3300005338 | Bacteria | 4242 |
| 69 | Ga0068868_100131386 | 3300005338 | Bacteria | 2049 |
| 70 | Ga0070660_100008567 | 3300005339 | Bacteria | 7161 |
| 71 | Ga0070660_100139789 | 3300005339 | Bacteria | 1942 |
| 72 | Ga0070660_100347536 | 3300005339 | Bacteria | 1221 |
| 73 | Ga0070660_100357912 | 3300005339 | Bacteria | 1202 |
| 74 | Ga0070661_100033654 | 3300005344 | Bacteria | 3713 |
| 75 | Ga0070661_100259205 | 3300005344 | Bacteria | 1344 |
| 76 | Ga0070692_10051867 | 3300005345 | Bacteria | 2135 |
| 77 | Ga0070669_100014598 | 3300005353 | Bacteria | 5591 |
| 78 | Ga0070669_100159050 | 3300005353 | Bacteria | 1754 |
| 79 | Ga0070675_100005231 | 3300005354 | Bacteria | 9903 |
| 80 | Ga0070675_100017521 | 3300005354 | Bacteria | 5692 |
| 81 | Ga0070671_100005899 | 3300005355 | Bacteria | 9760 |
| 82 | Ga0070671_100095936 | 3300005355 | Bacteria | 2486 |
| 83 | Ga0070671_100162616 | 3300005355 | Bacteria | 1887 |
| 84 | Ga0070671_100196592 | 3300005355 | Bacteria | 1709 |
| 85 | Ga0070674_100081578 | 3300005356 | Bacteria | 2311 |
| 86 | Ga0070673_100009689 | 3300005364 | Bacteria | 6480 |
| 87 | Ga0070659_100011368 | 3300005366 | Bacteria | 6583 |
| 88 | Ga0070659_100168388 | 3300005366 | Bacteria | 1793 |
| 89 | Ga0070659_100276764 | 3300005366 | Bacteria | 1395 |
| 90 | Ga0070667_100019496 | 3300005367 | Bacteria | 5628 |
| 91 | Ga0070667_100039064 | 3300005367 | Bacteria | 3978 |
| 92 | Ga0070667_100208636 | 3300005367 | Bacteria | 1736 |
| 93 | Ga0070667_100319537 | 3300005367 | Bacteria | 1401 |
| 94 | Ga0070708_100064215 | 3300005445 | Bacteria | 3289 |
| 95 | Ga0070663_100000198 | 3300005455 | Bacteria | 29990 |
| 96 | Ga0070678_100181835 | 3300005456 | Bacteria | 1722 |
| 97 | Ga0070662_100001463 | 3300005457 | Bacteria | 14552 |
| 98 | Ga0070662_100081218 | 3300005457 | Bacteria | 2415 |
| 99 | Ga0070662_100439760 | 3300005457 | Bacteria | 1081 |
| 100 | Ga0070681_10097499 | 3300005458 | Bacteria | 2887 |
| 101 | Ga0068867_100005705 | 3300005459 | Bacteria | 8826 |
| 102 | Ga0068867_100564593 | 3300005459 | Bacteria | 988 |
| 103 | Ga0070706_100001272 | 3300005467 | Bacteria | 26932 |
| 104 | Ga0070706_100083698 | 3300005467 | Bacteria | 2956 |
| 105 | Ga0070707_100172792 | 3300005468 | Bacteria | 2106 |
| 106 | Ga0070699_100108923 | 3300005518 | Bacteria | 2431 |
| 107 | Ga0070684_100009956 | 3300005535 | Bacteria | 7516 |
| 108 | Ga0070684_100036654 | 3300005535 | Bacteria | 4203 |
| 109 | Ga0068853_100017239 | 3300005539 | Bacteria | 5961 |
| 110 | Ga0068853_100170472 | 3300005539 | Bacteria | 1969 |
| 111 | Ga0068853_100212017 | 3300005539 | Bacteria | 1766 |
| 112 | Ga0068853_100232610 | 3300005539 | Bacteria | 1686 |
| 113 | Ga0068853_100348651 | 3300005539 | Bacteria | 1377 |
| 114 | Ga0070672_100003578 | 3300005543 | Bacteria | 10065 |
| 115 | Ga0070672_100007343 | 3300005543 | Bacteria | 7473 |
| 116 | Ga0070695_100115990 | 3300005545 | Bacteria | 1825 |
| 117 | Ga0070693_100010390 | 3300005547 | Bacteria | 4665 |
| 118 | Ga0070665_100214023 | 3300005548 | Bacteria | 1928 |
| 119 | Ga0070665_100684470 | 3300005548 | Bacteria | 1039 |
| 120 | Ga0068855_100006754 | 3300005563 | Bacteria | 13917 |
| 121 | Ga0068855_100011358 | 3300005563 | Bacteria | 10752 |
| 122 | Ga0068855_100095395 | 3300005563 | Bacteria | 3428 |
| 123 | Ga0070664_100017065 | 3300005564 | Bacteria | 5959 |
| 124 | Ga0070664_100136616 | 3300005564 | Bacteria | 2156 |
| 125 | Ga0070664_100142743 | 3300005564 | Bacteria | 2109 |
| 126 | Ga0070664_100212997 | 3300005564 | Bacteria | 1727 |
| 127 | Ga0068857_100008700 | 3300005577 | Bacteria | 8785 |
| 128 | Ga0068857_100021590 | 3300005577 | Bacteria | 5665 |
| 129 | Ga0068854_100040764 | 3300005578 | Bacteria | 3278 |
| 130 | Ga0068854_100044869 | 3300005578 | Bacteria | 3140 |
| 131 | Ga0068854_100066543 | 3300005578 | Bacteria | 2623 |
| 132 | Ga0068854_100135268 | 3300005578 | Bacteria | 1886 |
| 133 | Ga0068856_100006477 | 3300005614 | Bacteria | 11480 |
| 134 | Ga0068856_100043891 | 3300005614 | Bacteria | 4398 |
| 135 | Ga0068856_100150851 | 3300005614 | Bacteria | 2333 |
| 136 | Ga0068856_100558853 | 3300005614 | Bacteria | 1166 |
| 137 | Ga0068852_100012059 | 3300005616 | Bacteria | 6542 |
| 138 | Ga0068852_100020133 | 3300005616 | Bacteria | 5300 |
| 139 | Ga0068852_100025591 | 3300005616 | Bacteria | 4784 |
| 140 | Ga0068852_100035670 | 3300005616 | Bacteria | 4151 |
| 141 | Ga0068852_100050103 | 3300005616 | Bacteria | 3576 |
| 142 | Ga0068852_100099104 | 3300005616 | Bacteria | 2626 |
| 143 | Ga0068852_100211832 | 3300005616 | Bacteria | 1839 |
| 144 | Ga0068859_100152233 | 3300005617 | Bacteria | 2388 |
| 145 | Ga0068859_100324239 | 3300005617 | Bacteria | 1634 |
| 146 | Ga0068859_100414573 | 3300005617 | Bacteria | 1443 |
| 147 | Ga0068864_100029161 | 3300005618 | Bacteria | 4669 |
| 148 | Ga0068864_100100387 | 3300005618 | Bacteria | 2565 |
| 149 | Ga0068861_100017625 | 3300005719 | Bacteria | 5075 |
| 150 | Ga0068861_100574453 | 3300005719 | Bacteria | 1031 |
| 151 | Ga0068870_10039137 | 3300005840 | Bacteria | 2452 |
| 152 | Ga0068870_10092748 | 3300005840 | Bacteria | 1692 |
| 153 | Ga0068858_100010785 | 3300005842 | Bacteria | 8638 |
| 154 | Ga0068858_100011373 | 3300005842 | Bacteria | 8404 |
| 155 | Ga0068860_100016235 | 3300005843 | Bacteria | 7260 |
| 156 | Ga0068860_100059156 | 3300005843 | Bacteria | 3644 |
| 157 | Ga0068860_100223856 | 3300005843 | Bacteria | 1827 |
| 158 | Ga0068860_100259063 | 3300005843 | Bacteria | 1695 |
| 159 | Ga0075365_10042544 | 3300006038 | Bacteria | 2970 |
| 160 | Ga0075365_10079392 | 3300006038 | Bacteria | 2221 |
| 161 | Ga0075368_10011203 | 3300006042 | Bacteria | 3258 |
| 162 | Ga0075368_10016929 | 3300006042 | Bacteria | 2722 |
| 163 | Ga0075368_10027570 | 3300006042 | Bacteria | 2192 |
| 164 | Ga0075363_100034513 | 3300006048 | Bacteria | 2641 |
| 165 | Ga0075363_100070325 | 3300006048 | Bacteria | 1900 |
| 166 | Ga0075363_100083888 | 3300006048 | Bacteria | 1746 |
| 167 | Ga0075364_10010377 | 3300006051 | Bacteria | 5625 |
| 168 | Ga0075364_10086749 | 3300006051 | Bacteria | 2074 |
| 169 | Ga0075432_10007220 | 3300006058 | Bacteria | 3781 |
| 170 | Ga0075362_10024741 | 3300006177 | Bacteria | 2549 |
| 171 | Ga0075362_10048743 | 3300006177 | Bacteria | 1890 |
| 172 | Ga0075367_10009505 | 3300006178 | Bacteria | 5086 |
| 173 | Ga0075367_10034083 | 3300006178 | Bacteria | 2938 |
| 174 | Ga0075369_10002060 | 3300006186 | Bacteria | 7092 |
| 175 | Ga0075369_10015885 | 3300006186 | Bacteria | 3029 |
| 176 | Ga0075366_10005597 | 3300006195 | Bacteria | 6814 |
| 177 | Ga0075366_10006389 | 3300006195 | Bacteria | 6456 |
| 178 | Ga0075366_10009515 | 3300006195 | Bacteria | 5426 |
| 179 | Ga0075366_10012697 | 3300006195 | Bacteria | 4784 |
| 180 | Ga0075366_10014216 | 3300006195 | Bacteria | 4545 |
| 181 | Ga0075366_10047676 | 3300006195 | Bacteria | 2540 |
| 182 | Ga0075366_10126329 | 3300006195 | Bacteria | 1542 |
| 183 | Ga0075366_10244316 | 3300006195 | Bacteria | 1094 |
| 184 | Ga0097621_100047457 | 3300006237 | Bacteria | 3480 |
| 185 | Ga0075370_10000655 | 3300006353 | Bacteria | 13473 |
| 186 | Ga0075370_10006473 | 3300006353 | Bacteria | 5894 |
| 187 | Ga0075370_10009074 | 3300006353 | Bacteria | 5143 |
| 188 | Ga0075370_10011334 | 3300006353 | Bacteria | 4682 |
| 189 | Ga0075370_10024535 | 3300006353 | Bacteria | 3332 |
| 190 | Ga0075370_10032859 | 3300006353 | Bacteria | 2903 |
| 191 | Ga0075370_10051300 | 3300006353 | Bacteria | 2340 |
| 192 | Ga0075370_10107000 | 3300006353 | Bacteria | 1622 |
| 193 | Ga0075370_10218939 | 3300006353 | Bacteria | 1125 |
| 194 | Ga0075370_10261746 | 3300006353 | Bacteria | 1026 |
| 195 | Ga0068871_100030276 | 3300006358 | Bacteria | 4260 |
| 196 | Ga0097620_100152226 | 3300006931 | Bacteria | 2388 |
| 197 | Ga0097620_100324274 | 3300006931 | Bacteria | 1634 |
| 198 | Ga0097620_100414503 | 3300006931 | Bacteria | 1443 |
| 199 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 200 | Ga0079104_1000037 | 3300006946 | Bacteria | 189207 |
| 201 | Ga0099826_10063663 | 3300006948 | Bacteria | 2382 |
| 202 | Ga0075435_100146720 | 3300007076 | Bacteria | 1982 |
| 203 | Ga0105250_10000294 | 3300009092 | Bacteria | 39500 |
| 204 | Ga0105240_10007963 | 3300009093 | Bacteria | 15281 |
| 205 | Ga0105240_10012876 | 3300009093 | Bacteria | 11520 |
| 206 | Ga0105240_10049322 | 3300009093 | Bacteria | 5315 |
| 207 | Ga0105240_10242553 | 3300009093 | Bacteria | 2088 |
| 208 | Ga0105245_10402309 | 3300009098 | Bacteria | 1368 |
| 209 | Ga0105245_10534768 | 3300009098 | Bacteria | 1192 |
| 210 | Ga0105243_10053189 | 3300009148 | Bacteria | 3211 |
| 211 | Ga0105243_10353677 | 3300009148 | Bacteria | 1350 |
| 212 | Ga0105248_10152034 | 3300009177 | Bacteria | 2612 |
| 213 | Ga0105248_10189109 | 3300009177 | Bacteria | 2320 |
| 214 | Ga0105237_10000556 | 3300009545 | Bacteria | 52272 |
| 215 | Ga0105237_10023375 | 3300009545 | Bacteria | 6334 |
| 216 | Ga0105237_10041466 | 3300009545 | Bacteria | 4642 |
| 217 | Ga0105238_10020120 | 3300009551 | Bacteria | 6793 |
| 218 | Ga0105238_10027759 | 3300009551 | Bacteria | 5769 |
| 219 | Ga0105238_10176341 | 3300009551 | Bacteria | 2114 |
| 220 | Ga0105239_10003145 | 3300010375 | Bacteria | 20491 |
| 221 | Ga0105239_10024247 | 3300010375 | Bacteria | 6682 |
| 222 | Ga0105239_10040868 | 3300010375 | Bacteria | 5082 |
| 223 | Ga0105246_10060985 | 3300011119 | Bacteria | 2622 |
| 224 | Ga0105246_10331703 | 3300011119 | Bacteria | 1240 |
| 225 | Ga0157347_1000790 | 3300012502 | Bacteria | 2231 |
| 226 | Ga0157370_10010716 | 3300013104 | Bacteria | 9642 |
| 227 | Ga0157370_10284216 | 3300013104 | Bacteria | 1528 |
| 228 | Ga0157370_10413031 | 3300013104 | Bacteria | 1242 |
| 229 | Ga0157369_10147163 | 3300013105 | Bacteria | 2490 |
| 230 | Ga0157374_10037450 | 3300013296 | Bacteria | 4452 |
| 231 | Ga0157374_10619658 | 3300013296 | Bacteria | 1093 |
| 232 | Ga0157378_10179747 | 3300013297 | Bacteria | 1989 |
| 233 | Ga0163162_10022700 | 3300013306 | Bacteria | 6187 |
| 234 | Ga0157372_10071953 | 3300013307 | Bacteria | 3896 |
| 235 | Ga0157372_10713454 | 3300013307 | Bacteria | 1167 |
| 236 | Ga0157375_10006468 | 3300013308 | Bacteria | 10209 |
| 237 | Ga0157375_10128587 | 3300013308 | Bacteria | 2651 |
| 238 | Ga0157375_10145574 | 3300013308 | Bacteria | 2500 |
| 239 | Ga0163163_10289892 | 3300014325 | Bacteria | 1689 |
| 240 | Ga0182008_10001156 | 3300014497 | Bacteria | 18204 |
| 241 | Ga0182008_10005465 | 3300014497 | Bacteria | 7236 |
| 242 | Ga0157379_10013488 | 3300014968 | Bacteria | 7161 |
| 243 | Ga0157379_10142805 | 3300014968 | Bacteria | 2158 |
| 244 | Ga0157379_10363990 | 3300014968 | Bacteria | 1326 |
| 245 | Ga0157376_10017149 | 3300014969 | Bacteria | 5516 |
| 246 | Ga0163161_10000564 | 3300017792 | Bacteria | 29865 |
| 247 | Ga0163161_10007666 | 3300017792 | Bacteria | 7464 |
| 248 | Ga0213872_10000081 | 3300021361 | Bacteria | 88397 |
| 249 | Ga0213872_10000104 | 3300021361 | Bacteria | 78306 |
| 250 | Ga0213872_10115657 | 3300021361 | Bacteria | 1188 |
| 251 | Ga0209435_100003 | 3300025206 | Bacteria | 669534 |
| 252 | Ga0209674_100064 | 3300025226 | Bacteria | 265769 |
| 253 | Ga0209563_100099 | 3300025230 | Bacteria | 153336 |
| 254 | Ga0207427_102578 | 3300025231 | Bacteria | 4691 |
| 255 | Ga0209258_100319 | 3300025242 | Bacteria | 74569 |
| 256 | Ga0209258_100759 | 3300025242 | Bacteria | 20248 |
| 257 | Ga0207425_1001180 | 3300025245 | Bacteria | 11637 |
| 258 | Ga0207425_1004526 | 3300025245 | Bacteria | 4138 |
| 259 | Ga0207425_1007256 | 3300025245 | Bacteria | 2947 |
| 260 | Ga0209646_1000008 | 3300025246 | Bacteria | 669534 |
| 261 | Ga0209646_1000060 | 3300025246 | Bacteria | 256386 |
| 262 | Ga0209026_1000007 | 3300025250 | Bacteria | 669534 |
| 263 | Ga0209026_1000049 | 3300025250 | Bacteria | 255273 |
| 264 | Ga0209677_100331 | 3300025253 | Bacteria | 30340 |
| 265 | Ga0209677_100823 | 3300025253 | Bacteria | 15482 |
| 266 | Ga0209677_101638 | 3300025253 | Bacteria | 9421 |
| 267 | Ga0209759_1000026 | 3300025256 | Bacteria | 311743 |
| 268 | Ga0209759_1000272 | 3300025256 | Bacteria | 73495 |
| 269 | Ga0209759_1000994 | 3300025256 | Bacteria | 19456 |
| 270 | Ga0209759_1002607 | 3300025256 | Bacteria | 7778 |
| 271 | Ga0209759_1016144 | 3300025256 | Bacteria | 1898 |
| 272 | Ga0209129_1000342 | 3300025258 | Bacteria | 40192 |
| 273 | Ga0209565_1000200 | 3300025263 | Bacteria | 71490 |
| 274 | Ga0209565_1000559 | 3300025263 | Bacteria | 25609 |
| 275 | Ga0209455_1000157 | 3300025272 | Bacteria | 119719 |
| 276 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 277 | Ga0209673_1000012 | 3300025273 | Bacteria | 579480 |
| 278 | Ga0209673_1023111 | 3300025273 | Bacteria | 2126 |
| 279 | Ga0209130_1000064 | 3300025284 | Bacteria | 196568 |
| 280 | Ga0209130_1000712 | 3300025284 | Bacteria | 29562 |
| 281 | Ga0209675_1000144 | 3300025291 | Bacteria | 94908 |
| 282 | Ga0209675_1002213 | 3300025291 | Bacteria | 10172 |
| 283 | Ga0209675_1007775 | 3300025291 | Bacteria | 4044 |
| 284 | Ga0209675_1015397 | 3300025291 | Bacteria | 2272 |
| 285 | Ga0209676_1000051 | 3300025292 | Bacteria | 389016 |
| 286 | Ga0209676_1004766 | 3300025292 | Bacteria | 7389 |
| 287 | Ga0209025_1007558 | 3300025294 | Bacteria | 8065 |
| 288 | Ga0209025_1008226 | 3300025294 | Bacteria | 7543 |
| 289 | Ga0209025_1015564 | 3300025294 | Bacteria | 4572 |
| 290 | Ga0209564_1000136 | 3300025295 | Bacteria | 185198 |
| 291 | Ga0209564_1002312 | 3300025295 | Bacteria | 15472 |
| 292 | Ga0209564_1002490 | 3300025295 | Bacteria | 14385 |
| 293 | Ga0209564_1004673 | 3300025295 | Bacteria | 8217 |
| 294 | Ga0209758_1000045 | 3300025297 | Bacteria | 369174 |
| 295 | Ga0209758_1000502 | 3300025297 | Bacteria | 63375 |
| 296 | Ga0209758_1005804 | 3300025297 | Bacteria | 9253 |
| 297 | Ga0209050_1000044 | 3300025298 | Bacteria | 391114 |
| 298 | Ga0209050_1004206 | 3300025298 | Bacteria | 9954 |
| 299 | Ga0209050_1005557 | 3300025298 | Bacteria | 7854 |
| 300 | Ga0209050_1010422 | 3300025298 | Bacteria | 4584 |
| 301 | Ga0209050_1024043 | 3300025298 | Bacteria | 2122 |
| 302 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 303 | Ga0209256_1000015 | 3300025299 | Bacteria | 622953 |
| 304 | Ga0209256_1013911 | 3300025299 | Bacteria | 2946 |
| 305 | Ga0207426_1000116 | 3300025302 | Bacteria | 225245 |
| 306 | Ga0207426_1002959 | 3300025302 | Bacteria | 9950 |
| 307 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 308 | Ga0209051_1000031 | 3300025303 | Bacteria | 391114 |
| 309 | Ga0209051_1028775 | 3300025303 | Bacteria | 2188 |
| 310 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 311 | Ga0209257_1000053 | 3300025304 | Bacteria | 425160 |
| 312 | Ga0209257_1000058 | 3300025304 | Bacteria | 381686 |
| 313 | Ga0209257_1004718 | 3300025304 | Bacteria | 10222 |
| 314 | Ga0209257_1010588 | 3300025304 | Bacteria | 4633 |
| 315 | Ga0209257_1025307 | 3300025304 | Bacteria | 2030 |
| 316 | Ga0207656_10012366 | 3300025321 | Bacteria | 3243 |
| 317 | Ga0207682_10013165 | 3300025893 | Bacteria | 3225 |
| 318 | Ga0207688_10014069 | 3300025901 | Bacteria | 4350 |
| 319 | Ga0207645_10004178 | 3300025907 | Bacteria | 10720 |
| 320 | Ga0207645_10016787 | 3300025907 | Bacteria | 4841 |
| 321 | Ga0207643_10026718 | 3300025908 | Bacteria | 3197 |
| 322 | Ga0207643_10049564 | 3300025908 | Bacteria | 2380 |
| 323 | Ga0207643_10064311 | 3300025908 | Bacteria | 2099 |
| 324 | Ga0207705_10111313 | 3300025909 | Bacteria | 2023 |
| 325 | Ga0207705_10218367 | 3300025909 | Bacteria | 1447 |
| 326 | Ga0207684_10003606 | 3300025910 | Bacteria | 15069 |
| 327 | Ga0207684_10102156 | 3300025910 | Bacteria | 2451 |
| 328 | Ga0207707_10023353 | 3300025912 | Bacteria | 5409 |
| 329 | Ga0207695_10008486 | 3300025913 | Bacteria | 12850 |
| 330 | Ga0207695_10011317 | 3300025913 | Bacteria | 10816 |
| 331 | Ga0207695_10102107 | 3300025913 | Bacteria | 2861 |
| 332 | Ga0207695_10242856 | 3300025913 | Bacteria | 1702 |
| 333 | Ga0207671_10001994 | 3300025914 | Bacteria | 22499 |
| 334 | Ga0207671_10014611 | 3300025914 | Bacteria | 6195 |
| 335 | Ga0207671_10031203 | 3300025914 | Bacteria | 3971 |
| 336 | Ga0207660_10184898 | 3300025917 | Bacteria | 1620 |
| 337 | Ga0207662_10047176 | 3300025918 | Bacteria | 2551 |
| 338 | Ga0207657_10017103 | 3300025919 | Bacteria | 6972 |
| 339 | Ga0207657_10104616 | 3300025919 | Bacteria | 2344 |
| 340 | Ga0207657_10148954 | 3300025919 | Bacteria | 1907 |
| 341 | Ga0207657_10195011 | 3300025919 | Bacteria | 1632 |
| 342 | Ga0207649_10010331 | 3300025920 | Bacteria | 5126 |
| 343 | Ga0207649_10115382 | 3300025920 | Bacteria | 1802 |
| 344 | Ga0207681_10009855 | 3300025923 | Bacteria | 5844 |
| 345 | Ga0207694_10012667 | 3300025924 | Bacteria | 6354 |
| 346 | Ga0207694_10033859 | 3300025924 | Bacteria | 3915 |
| 347 | Ga0207650_10205841 | 3300025925 | Bacteria | 1578 |
| 348 | Ga0207659_10003636 | 3300025926 | Bacteria | 9288 |
| 349 | Ga0207659_10012868 | 3300025926 | Bacteria | 5342 |
| 350 | Ga0207644_10026852 | 3300025931 | Bacteria | 3974 |
| 351 | Ga0207644_10074570 | 3300025931 | Bacteria | 2490 |
| 352 | Ga0207644_10238484 | 3300025931 | Bacteria | 1447 |
| 353 | Ga0207690_10145322 | 3300025932 | Bacteria | 1753 |
| 354 | Ga0207690_10232760 | 3300025932 | Bacteria | 1415 |
| 355 | Ga0207706_10035099 | 3300025933 | Bacteria | 4461 |
| 356 | Ga0207706_10165269 | 3300025933 | Bacteria | 1945 |
| 357 | Ga0207686_10080915 | 3300025934 | Bacteria | 2119 |
| 358 | Ga0207709_10000167 | 3300025935 | Bacteria | 88877 |
| 359 | Ga0207709_10355769 | 3300025935 | Bacteria | 1107 |
| 360 | Ga0207704_10223500 | 3300025938 | Bacteria | 1395 |
| 361 | Ga0207691_10008114 | 3300025940 | Bacteria | 10080 |
| 362 | Ga0207691_10008676 | 3300025940 | Bacteria | 9754 |
| 363 | Ga0207691_10077575 | 3300025940 | Bacteria | 2993 |
| 364 | Ga0207711_10049262 | 3300025941 | Bacteria | 3607 |
| 365 | Ga0207711_10087883 | 3300025941 | Bacteria | 2728 |
| 366 | Ga0207711_10330692 | 3300025941 | Bacteria | 1409 |
| 367 | Ga0207689_10012076 | 3300025942 | Bacteria | 7398 |
| 368 | Ga0207689_10028540 | 3300025942 | Bacteria | 4668 |
| 369 | Ga0207689_10055686 | 3300025942 | Bacteria | 3254 |
| 370 | Ga0207689_10127806 | 3300025942 | Bacteria | 2090 |
| 371 | Ga0207661_10024950 | 3300025944 | Bacteria | 4540 |
| 372 | Ga0207661_10054807 | 3300025944 | Bacteria | 3195 |
| 373 | Ga0207661_10446005 | 3300025944 | Bacteria | 1178 |
| 374 | Ga0207679_10176253 | 3300025945 | Bacteria | 1765 |
| 375 | Ga0207667_10050496 | 3300025949 | Bacteria | 4388 |
| 376 | Ga0207667_10058113 | 3300025949 | Bacteria | 4058 |
| 377 | Ga0207667_10083721 | 3300025949 | Bacteria | 3303 |
| 378 | Ga0207667_10126281 | 3300025949 | Bacteria | 2635 |
| 379 | Ga0207651_10082429 | 3300025960 | Bacteria | 2322 |
| 380 | Ga0207651_10239931 | 3300025960 | Bacteria | 1477 |
| 381 | Ga0207640_10010011 | 3300025981 | Bacteria | 5326 |
| 382 | Ga0207640_10098185 | 3300025981 | Bacteria | 2047 |
| 383 | Ga0207640_10201356 | 3300025981 | Bacteria | 1509 |
| 384 | Ga0207658_10020803 | 3300025986 | Bacteria | 4545 |
| 385 | Ga0207658_10027903 | 3300025986 | Bacteria | 3971 |
| 386 | Ga0207658_10247812 | 3300025986 | Bacteria | 1512 |
| 387 | Ga0207677_10008652 | 3300026023 | Bacteria | 5697 |
| 388 | Ga0207677_10008876 | 3300026023 | Bacteria | 5635 |
| 389 | Ga0207677_10369024 | 3300026023 | Bacteria | 1208 |
| 390 | Ga0207703_10003521 | 3300026035 | Bacteria | 13096 |
| 391 | Ga0207703_10034671 | 3300026035 | Bacteria | 4006 |
| 392 | Ga0207639_10005163 | 3300026041 | Bacteria | 8806 |
| 393 | Ga0207639_10056773 | 3300026041 | Bacteria | 3002 |
| 394 | Ga0207639_10063225 | 3300026041 | Bacteria | 2865 |
| 395 | Ga0207639_10070410 | 3300026041 | Bacteria | 2732 |
| 396 | Ga0207639_10090898 | 3300026041 | Bacteria | 2443 |
| 397 | Ga0207639_10133886 | 3300026041 | Bacteria | 2055 |
| 398 | Ga0207639_10338382 | 3300026041 | Bacteria | 1341 |
| 399 | Ga0207678_10000684 | 3300026067 | Bacteria | 31001 |
| 400 | Ga0207678_10007290 | 3300026067 | Bacteria | 9801 |
| 401 | Ga0207702_10000395 | 3300026078 | Bacteria | 49788 |
| 402 | Ga0207702_10014290 | 3300026078 | Bacteria | 6592 |
| 403 | Ga0207641_10009819 | 3300026088 | Bacteria | 7881 |
| 404 | Ga0207641_10463612 | 3300026088 | Bacteria | 1226 |
| 405 | Ga0207648_10003979 | 3300026089 | Bacteria | 15346 |
| 406 | Ga0207648_10055216 | 3300026089 | Bacteria | 3468 |
| 407 | Ga0207676_10400617 | 3300026095 | Bacteria | 1282 |
| 408 | Ga0207676_10446029 | 3300026095 | Bacteria | 1219 |
| 409 | Ga0207674_10003791 | 3300026116 | Bacteria | 18445 |
| 410 | Ga0207674_10015017 | 3300026116 | Bacteria | 8530 |
| 411 | Ga0207675_100583168 | 3300026118 | Bacteria | 1120 |
| 412 | Ga0207683_10253289 | 3300026121 | Bacteria | 1607 |
| 413 | Ga0207683_10408333 | 3300026121 | Bacteria | 1250 |
| 414 | Ga0207698_10011200 | 3300026142 | Bacteria | 5804 |
| 415 | Ga0207698_10057605 | 3300026142 | Bacteria | 3007 |
| 416 | Ga0207698_10258495 | 3300026142 | Bacteria | 1598 |
| 417 | Ga0209281_1000002 | 3300027111 | Bacteria | 1924012 |
| 418 | Ga0209281_1000057 | 3300027111 | Bacteria | 307145 |
| 419 | Ga0209813_10041789 | 3300027866 | Bacteria | 1399 |
| 420 | Ga0209974_10008157 | 3300027876 | Bacteria | 3586 |
| 421 | Ga0268266_10087364 | 3300028379 | Bacteria | 2728 |
| 422 | Ga0268264_10004863 | 3300028381 | Bacteria | 11381 |
| 423 | Ga0265336_10000040 | 3300028666 | Bacteria | 138266 |
| 424 | Ga0307515_10001613 | 3300028794 | Bacteria | 50267 |
| 425 | Ga0307515_10003475 | 3300028794 | Bacteria | 33121 |
| 426 | Ga0307515_10021372 | 3300028794 | Bacteria | 11480 |
| 427 | Ga0307515_10056643 | 3300028794 | Bacteria | 5691 |
| 428 | Ga0307515_10115937 | 3300028794 | Bacteria | 3080 |
| 429 | Ga0307515_10139291 | 3300028794 | Bacteria | 2613 |
| 430 | Ga0307515_10237819 | 3300028794 | Bacteria | 1599 |
| 431 | Ga0265324_10001969 | 3300029957 | Bacteria | 11010 |
| 432 | Ga0307512_10036130 | 3300030522 | Bacteria | 4196 |
| 433 | Ga0265330_10000046 | 3300031235 | Bacteria | 108853 |
| 434 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 435 | Ga0265325_10001934 | 3300031241 | Bacteria | 14288 |
| 436 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 437 | Ga0307513_10000441 | 3300031456 | Bacteria | 59706 |
| 438 | Ga0307513_10415004 | 3300031456 | Bacteria | 1077 |
| 439 | Ga0307509_10000991 | 3300031507 | Bacteria | 48763 |
| 440 | Ga0307509_10052470 | 3300031507 | Bacteria | 4353 |
| 441 | Ga0307509_10059174 | 3300031507 | Bacteria | 4054 |
| 442 | Ga0307408_100159845 | 3300031548 | Bacteria | 1788 |
| 443 | Ga0307508_10000043 | 3300031616 | Bacteria | 143889 |
| 444 | Ga0307508_10003877 | 3300031616 | Bacteria | 14878 |
| 445 | Ga0307514_10000558 | 3300031649 | Bacteria | 71090 |
| 446 | Ga0307514_10084638 | 3300031649 | Bacteria | 2333 |
| 447 | Ga0307514_10101224 | 3300031649 | Bacteria | 2068 |
| 448 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 449 | Ga0307516_10001407 | 3300031730 | Bacteria | 33232 |
| 450 | Ga0307516_10005507 | 3300031730 | Bacteria | 15108 |
| 451 | Ga0307516_10118594 | 3300031730 | Bacteria | 2440 |
| 452 | Ga0307405_10004482 | 3300031731 | Bacteria | 6605 |
| 453 | Ga0307413_10413893 | 3300031824 | Bacteria | 1060 |
| 454 | Ga0307406_10022019 | 3300031901 | Bacteria | 3777 |
| 455 | Ga0307407_10222445 | 3300031903 | Bacteria | 1277 |
| 456 | Ga0307412_10001244 | 3300031911 | Bacteria | 14411 |
| 457 | Ga0307412_10034980 | 3300031911 | Bacteria | 3206 |
| 458 | Ga0307409_100001001 | 3300031995 | Bacteria | 13228 |
| 459 | Ga0307416_100010461 | 3300032002 | Bacteria | 6128 |
| 460 | Ga0307414_10177699 | 3300032004 | Bacteria | 1709 |
| 461 | Ga0307414_10215121 | 3300032004 | Bacteria | 1574 |
| 462 | Ga0307411_10001837 | 3300032005 | Bacteria | 9014 |
| 463 | Ga0307411_10298609 | 3300032005 | Bacteria | 1291 |
| 464 | Ga0307415_100002908 | 3300032126 | Bacteria | 8591 |
| 465 | Ga0307510_10000294 | 3300033180 | Bacteria | 46056 |
| 466 | Ga0307510_10102687 | 3300033180 | Bacteria | 2640 |
| 467 | Ga0373944_0058267 | 3300035089 | Bacteria | 1233 |
| 468 | Ga0373946_0059806 | 3300035171 | Bacteria | 1618 |
| 469 | Ga0373924_0047133 | 3300035410 | Bacteria | 1778 |
| 470 | Ga0373931_0016307 | 3300035691 | Bacteria | 3656 |
| 471 | Ga0373931_0081128 | 3300035691 | Bacteria | 1790 |
| 472 | Ga0373935_0249640 | 3300035692 | Bacteria | 1241 |
| 473 | Ga0373937_0151180 | 3300036401 | Bacteria | 2175 |
| 474 | Ga0373925_0194322 | 3300037068 | Bacteria | 1611 |
| 475 | Ga0373925_0458646 | 3300037068 | Bacteria | 1044 |
| 476 | Ga0395900_0036742 | 3300037418 | Bacteria | 5049 |
| 477 | Ga0395898_0061066 | 3300037466 | Bacteria | 3662 |
| 478 | Ga0395898_0085060 | 3300037466 | Bacteria | 3049 |
| 479 | Ga0395905_0017590 | 3300037471 | Bacteria | 6784 |
| 480 | Ga0395905_0029251 | 3300037471 | Bacteria | 5193 |
| 481 | Ga0395905_0030931 | 3300037471 | Bacteria | 5041 |
| 482 | Ga0395905_0379185 | 3300037471 | Bacteria | 1308 |
| 483 | Ga0395901_0001180 | 3300038443 | Bacteria | 27770 |
| 484 | Ga0436361_0107660 | 3300039447 | Bacteria | 63286 |
| 485 | Ga0436361_0178218 | 3300039447 | Bacteria | 1027 |
| 486 | Ga0436361_0364626 | 3300039447 | Bacteria | 3886 |
| 487 | Ga0436361_0745691 | 3300039447 | Bacteria | 89622 |
| 488 | Ga0451789_0866159 | 3300041443 | Bacteria | 1386 |
| 489 | Ga0451843_0782854 | 3300041509 | Bacteria | 1436 |
| 490 | Ga0451853_2355776 | 3300041512 | Bacteria | 1272 |
| 491 | Ga0451853_3936200 | 3300041512 | Bacteria | 1206 |
| 492 | Ga0439449_0048916 | 3300042007 | Bacteria | 1565 |
| 493 | Ga0439458_0027546 | 3300042157 | Bacteria | 1341 |
| 494 | Ga0451577_0001915 | 3300042876 | Bacteria | 26373 |
| 495 | Ga0451577_0027942 | 3300042876 | Bacteria | 5103 |
| 496 | Ga0466969_0001965 | 3300044656 | Bacteria | 10990 |
| 497 | Ga0466969_0041892 | 3300044656 | Bacteria | 2288 |
| 498 | Ga0453683_0012856 | 3300044673 | Bacteria | 5478 |
| 499 | Ga0453683_0079925 | 3300044673 | Bacteria | 2048 |
| 500 | Ga0466965_0039041 | 3300044683 | Bacteria | 2333 |
| 501 | Ga0466965_0065288 | 3300044683 | Bacteria | 1823 |
| 502 | Ga0466961_0006094 | 3300044693 | Bacteria | 7650 |
| 503 | Ga0466961_0116422 | 3300044693 | Bacteria | 1679 |
| 504 | Ga0466963_0048757 | 3300044694 | Bacteria | 2800 |
| 505 | Ga0466964_0020809 | 3300044706 | Bacteria | 2530 |
| 506 | Ga0453684_0016471 | 3300044712 | Bacteria | 11553 |
| 507 | Ga0453684_0018857 | 3300044712 | Bacteria | 10555 |
| 508 | Ga0466971_0012864 | 3300044719 | Bacteria | 3669 |
| 509 | Ga0466971_0069733 | 3300044719 | Bacteria | 1595 |
| 510 | Ga0466970_0034940 | 3300044765 | Bacteria | 2662 |
| 511 | Ga0466970_0100098 | 3300044765 | Bacteria | 1578 |
| 512 | Ga0466957_0015737 | 3300044842 | Bacteria | 4419 |
| 513 | Ga0466960_0016896 | 3300044901 | Bacteria | 3173 |
| 514 | Ga0466959_0024270 | 3300045049 | Bacteria | 4490 |
| 515 | Ga0451576_0012538 | 3300045051 | Bacteria | 9514 |
| 516 | Ga0451576_0040673 | 3300045051 | Bacteria | 4917 |
| 517 | Ga0451576_0089891 | 3300045051 | Bacteria | 3194 |
| 518 | Ga0466958_0062369 | 3300045836 | Bacteria | 2272 |
| 519 | Ga0466967_0171989 | 3300045976 | Bacteria | 2039 |
| 520 | Ga0466967_0214421 | 3300045976 | Bacteria | 1827 |
| 521 | Ga0495592_0000083 | 3300046454 | Bacteria | 83092 |
| 522 | Ga0495651_0131559 | 3300046462 | Bacteria | 1826 |
| 523 | Ga0495650_0012789 | 3300046471 | Bacteria | 4492 |
| 524 | Ga0495580_0061350 | 3300046472 | Bacteria | 2640 |
| 525 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 526 | Ga0495606_0021661 | 3300046507 | Bacteria | 4702 |
| 527 | Ga0495610_0041050 | 3300046512 | Bacteria | 2326 |
| 528 | Ga0495610_0047763 | 3300046512 | Bacteria | 2104 |
| 529 | Ga0495632_0014952 | 3300046519 | Bacteria | 4370 |
| 530 | Ga0495632_0015142 | 3300046519 | Bacteria | 4336 |
| 531 | Ga0495632_0054047 | 3300046519 | Bacteria | 1970 |
| 532 | Ga0495643_0049136 | 3300046522 | Bacteria | 2276 |
| 533 | Ga0495648_0229094 | 3300046524 | Bacteria | 911 |
| 534 | Ga0495597_0000375 | 3300046542 | Bacteria | 39117 |
| 535 | Ga0495645_0054269 | 3300046543 | Bacteria | 2912 |
| 536 | Ga0495633_0001773 | 3300046558 | Bacteria | 15985 |
| 537 | Ga0495656_0014709 | 3300046615 | Bacteria | 2939 |
| 538 | Ga0495625_0014961 | 3300046660 | Bacteria | 6165 |
| 539 | Ga0495625_0018673 | 3300046660 | Bacteria | 5404 |
| 540 | Ga0495625_0021227 | 3300046660 | Bacteria | 5003 |
| 541 | Ga0495625_0139309 | 3300046660 | Bacteria | 1638 |
| 542 | Ga0495588_0011839 | 3300046674 | Bacteria | 4106 |
| 543 | Ga0495646_0074550 | 3300046680 | Bacteria | 1991 |
| 544 | Ga0495658_0217190 | 3300046683 | Bacteria | 1196 |
| 545 | Ga0495624_0079091 | 3300046690 | Bacteria | 2039 |
| 546 | Ga0495649_0001661 | 3300046694 | Bacteria | 16548 |
| 547 | Ga0495589_0011934 | 3300046794 | Bacteria | 4504 |
| 548 | Ga0495676_0130461 | 3300047321 | Bacteria | 1815 |
| 549 | Ga0495680_0196936 | 3300047322 | Bacteria | 1447 |
| 550 | Ga0495687_001691 | 3300047443 | Bacteria | 19685 |
| 551 | Ga0495686_0076034 | 3300047472 | Bacteria | 2058 |
| 552 | Ga0495614_0096387 | 3300048089 | Bacteria | 1290 |
| 553 | Ga0495615_0015407 | 3300048090 | Bacteria | 1632 |
| 554 | Ga0495626_0014929 | 3300048091 | Bacteria | 3987 |
| 555 | Ga0495626_0035099 | 3300048091 | Bacteria | 2395 |
| 556 | Ga0496100_0018155 | 3300048903 | Bacteria | 4168 |
| 557 | Ga0496101_0032355 | 3300048904 | Bacteria | 3681 |
| 558 | Ga0496102_0009788 | 3300048905 | Bacteria | 8243 |
| 559 | Ga0496102_0015544 | 3300048905 | Bacteria | 6632 |
| 560 | Ga0496102_0122425 | 3300048905 | Bacteria | 2430 |
| 561 | Ga0496104_0287748 | 3300048907 | Bacteria | 1556 |
| 562 | Ga0496104_0305658 | 3300048907 | Bacteria | 1503 |
| 563 | Ga0496106_0027831 | 3300048909 | Bacteria | 4209 |
| 564 | Ga0496107_0054184 | 3300048910 | Bacteria | 2894 |
| 565 | Ga0496108_0007144 | 3300048911 | Bacteria | 9052 |
| 566 | Ga0496108_0072339 | 3300048911 | Bacteria | 2910 |
| 567 | Ga0496108_0513017 | 3300048911 | Bacteria | 1047 |
| 568 | Ga0496109_0050112 | 3300048912 | Bacteria | 3803 |
| 569 | Ga0496109_0370478 | 3300048912 | Bacteria | 1353 |
| 570 | Ga0496109_0438352 | 3300048912 | Bacteria | 1234 |
| 571 | Ga0496110_0017947 | 3300048913 | Bacteria | 5926 |
| 572 | Ga0496112_0194909 | 3300048915 | Bacteria | 1987 |
| 573 | Ga0496113_0004477 | 3300048916 | Bacteria | 8597 |
| 574 | Ga0496114_0010776 | 3300048917 | Bacteria | 7276 |
| 575 | Ga0496114_0041467 | 3300048917 | Bacteria | 3815 |
| 576 | Ga0496115_0026390 | 3300048918 | Bacteria | 4534 |
| 577 | Ga0496122_0042267 | 3300048925 | Bacteria | 3588 |
| 578 | Ga0496122_0086310 | 3300048925 | Bacteria | 2161 |
| 579 | Ga0496123_0101812 | 3300048926 | Bacteria | 1669 |
| 580 | Ga0496123_0178107 | 3300048926 | Bacteria | 1113 |
| 581 | Ga0496125_0000319 | 3300048928 | Bacteria | 93727 |
| 582 | Ga0496125_0066725 | 3300048928 | Bacteria | 2841 |
| 583 | Ga0496126_0019070 | 3300048929 | Bacteria | 6767 |
| 584 | Ga0501031_0001318 | 3300049568 | Bacteria | 15252 |
| 585 | Ga0501036_0138222 | 3300049572 | Bacteria | 2056 |
| 586 | Ga0501043_0000057 | 3300049579 | Bacteria | 103997 |
| 587 | Ga0501043_0150733 | 3300049579 | Bacteria | 1820 |
| 588 | Ga0501046_0000075 | 3300049580 | Bacteria | 104000 |
| 589 | Ga0501046_0047014 | 3300049580 | Bacteria | 3423 |
| 590 | Ga0501047_0000081 | 3300049581 | Bacteria | 122697 |
| 591 | Ga0501047_0322041 | 3300049581 | Bacteria | 1385 |
| 592 | Ga0501048_0002921 | 3300049582 | Bacteria | 13057 |
| 593 | Ga0501227_008444 | 3300049665 | Bacteria | 2209 |
| 594 | Ga0501035_0146738 | 3300049822 | Bacteria | 2048 |
| 595 | Ga0501044_0062784 | 3300049823 | Bacteria | 3796 |
| 596 | Ga0501045_0002738 | 3300049824 | Bacteria | 12043 |
| 597 | nmdc:mga03683_13049_c1 | 3300050489 | Bacteria | 3050 |
| 598 | nmdc:mga03683_214266_c1 | 3300050489 | Bacteria | 887 |
| 599 | nmdc:mga03683_7894_c1 | 3300050489 | Bacteria | 3716 |
| 600 | nmdc:mga03683_7924_c1 | 3300050489 | Bacteria | 3711 |
| 601 | nmdc:mga00v17_27021_c1 | 3300050491 | Bacteria | 3348 |
| 602 | nmdc:mga00v17_387535_c1 | 3300050491 | Bacteria | 908 |
| 603 | nmdc:mga0yw44_155736_c1 | 3300050492 | Bacteria | 1493 |
| 604 | nmdc:mga0yw44_277429_c1 | 3300050492 | Bacteria | 1120 |
| 605 | nmdc:mga0k408_147497_c1 | 3300050493 | Bacteria | 1401 |
| 606 | nmdc:mga0k408_161_c1 | 3300050493 | Bacteria | 34843 |
| 607 | nmdc:mga0k408_178873_c1 | 3300050493 | Bacteria | 1265 |
| 608 | nmdc:mga0k408_180_c1 | 3300050493 | Bacteria | 33189 |
| 609 | nmdc:mga0k408_1901_c1 | 3300050493 | Bacteria | 11173 |
| 610 | nmdc:mga0k408_2769_c1 | 3300050493 | Bacteria | 9320 |
| 611 | nmdc:mga0k408_3641_c1 | 3300050493 | Bacteria | 8158 |
| 612 | nmdc:mga0k408_58692_c1 | 3300050493 | Bacteria | 2235 |
| 613 | nmdc:mga0k408_76182_c1 | 3300050493 | Bacteria | 1960 |
| 614 | nmdc:mga0k408_8906_c1 | 3300050493 | Bacteria | 5400 |
| 615 | nmdc:mga06z11_342090_c1 | 3300050494 | Bacteria | 895 |
| 616 | nmdc:mga06z11_97021_c1 | 3300050494 | Bacteria | 1611 |
| 617 | nmdc:mga04h51_50128_c1 | 3300050495 | Bacteria | 1398 |
| 618 | nmdc:mga07m45_134411_c1 | 3300050496 | Bacteria | 1431 |
| 619 | nmdc:mga07m45_15789_c1 | 3300050496 | Bacteria | 4036 |
| 620 | nmdc:mga07m45_260_c1 | 3300050496 | Bacteria | 21450 |
| 621 | nmdc:mga07m45_26675_c2 | 3300050496 | Bacteria | 2127 |
| 622 | nmdc:mga07m45_26703_c1 | 3300050496 | Bacteria | 3175 |
| 623 | nmdc:mga07m45_287_c1 | 3300050496 | Bacteria | 20366 |
| 624 | nmdc:mga07m45_31900_c1 | 3300050496 | Bacteria | 2921 |
| 625 | nmdc:mga07m45_35343_c1 | 3300050496 | Bacteria | 2779 |
| 626 | nmdc:mga07m45_4971_c1 | 3300050496 | Bacteria | 6562 |
| 627 | nmdc:mga0n895_293927_c1 | 3300050512 | Bacteria | 1647 |
| 628 | nmdc:mga0sz30_1923_c2 | 3300050516 | Bacteria | 7090 |
| 629 | nmdc:mga0sz30_55036_c1 | 3300050516 | Bacteria | 1693 |
| 630 | Ga0500635_0000440 | 3300053080 | Bacteria | 12001 |
| 631 | Ga0495619_0341975 | 3300053085 | Bacteria | 1035 |
| 632 | Ga0500644_0013299 | 3300053088 | Bacteria | 2296 |
| 633 | Ga0500644_0042428 | 3300053088 | Bacteria | 1516 |
| 634 | Ga0500650_0143386 | 3300053098 | Bacteria | 1107 |
| 635 | Ga0500593_005834 | 3300053117 | Bacteria | 4888 |
| 636 | Ga0500593_036096 | 3300053117 | Bacteria | 2212 |
| 637 | Ga0500594_0000825 | 3300053118 | Bacteria | 6606 |
| 638 | Ga0500608_072733 | 3300053122 | Bacteria | 1633 |
| 639 | Ga0500628_019308 | 3300053129 | Bacteria | 1355 |
| 640 | Ga0500652_004319 | 3300053131 | Bacteria | 4391 |
| 641 | Ga0500658_0001840 | 3300053134 | Bacteria | 8347 |
| 642 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 643 | Ga0500559_0012113 | 3300053136 | Bacteria | 3672 |
| 644 | Ga0500564_015387 | 3300053138 | Bacteria | 3455 |
| 645 | Ga0500564_074163 | 3300053138 | Bacteria | 1532 |
| 646 | Ga0500568_0029407 | 3300053139 | Bacteria | 2281 |
| 647 | Ga0500577_0001979 | 3300053142 | Bacteria | 5247 |
| 648 | Ga0500604_0009570 | 3300053151 | Bacteria | 2582 |
| 649 | Ga0500604_0036077 | 3300053151 | Bacteria | 1473 |
| 650 | Ga0500622_0007525 | 3300053156 | Bacteria | 6180 |
| 651 | Ga0500622_0012262 | 3300053156 | Bacteria | 4647 |
| 652 | Ga0500622_0078978 | 3300053156 | Bacteria | 1650 |
| 653 | Ga0500636_0069923 | 3300053177 | Bacteria | 2037 |
| 654 | Ga0500636_0073357 | 3300053177 | Bacteria | 1982 |
| 655 | Ga0500645_003082 | 3300053730 | Bacteria | 6985 |
| 656 | Ga0500661_007912 | 3300055283 | Bacteria | 1959 |
| 657 | Ga0466962_0027502 | 3300061719 | Bacteria | 2729 |
| 658 | Ga0466962_0035189 | 3300061719 | Bacteria | 2397 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025909 | Ga0207705_10111313 | Ga0207705_101113132 | 206 |
| 2 | 3300003320 | rootH2_10053827 | rootH2_100538272 | 229 |
| 3 | 3300049572 | Ga0501036_0138222 | Ga0501036_0138222_445_1314 | 237 |
| 4 | 3300046471 | Ga0495650_0012789 | Ga0495650_0012789_1976_2902 | 239 |
| 5 | 3300049579 | Ga0501043_0150733 | Ga0501043_0150733_802_1671 | 239 |
| 6 | 3300049580 | Ga0501046_0047014 | Ga0501046_0047014_1601_2470 | 239 |
| 7 | 3300049581 | Ga0501047_0322041 | Ga0501047_0322041_167_1036 | 239 |
| 8 | 3300049822 | Ga0501035_0146738 | Ga0501035_0146738_477_1346 | 239 |
| 9 | 3300049823 | Ga0501044_0062784 | Ga0501044_0062784_1601_2470 | 239 |
| 10 | 3300037471 | Ga0395905_0379185 | Ga0395905_0379185_420_1286 | 240 |
| 11 | 3300005338 | Ga0068868_100131386 | Ga0068868_1001313862 | 241 |
| 12 | 3300009098 | Ga0105245_10402309 | Ga0105245_104023092 | 241 |
| 13 | 3300003761 | Ga0055535_1000551 | Ga0055535_100055126 | 242 |
| 14 | 3300003761 | Ga0055535_1000729 | Ga0055535_100072915 | 242 |
| 15 | 3300003763 | Ga0055529_1000486 | Ga0055529_100048614 | 242 |
| 16 | 3300025242 | Ga0209258_100319 | Ga0209258_10031914 | 242 |
| 17 | 3300025256 | Ga0209759_1000994 | Ga0209759_10009948 | 242 |
| 18 | 3300025272 | Ga0209455_1000157 | Ga0209455_100015753 | 242 |
| 19 | 3300005843 | Ga0068860_100059156 | Ga0068860_1000591563 | 244 |
| 20 | 3300014968 | Ga0157379_10363990 | Ga0157379_103639902 | 244 |
| 21 | 3300026088 | Ga0207641_10463612 | Ga0207641_104636122 | 244 |
| 22 | 3300005539 | Ga0068853_100170472 | Ga0068853_1001704722 | 245 |
| 23 | 3300005548 | Ga0070665_100214023 | Ga0070665_1002140232 | 245 |
| 24 | 3300006038 | Ga0075365_10079392 | Ga0075365_100793922 | 245 |
| 25 | 3300009093 | Ga0105240_10012876 | Ga0105240_100128767 | 245 |
| 26 | 3300009545 | Ga0105237_10000556 | Ga0105237_1000055620 | 245 |
| 27 | 3300009551 | Ga0105238_10027759 | Ga0105238_100277593 | 245 |
| 28 | 3300010375 | Ga0105239_10003145 | Ga0105239_100031457 | 245 |
| 29 | 3300025913 | Ga0207695_10008486 | Ga0207695_1000848610 | 245 |
| 30 | 3300025914 | Ga0207671_10001994 | Ga0207671_1000199414 | 245 |
| 31 | 3300025924 | Ga0207694_10012667 | Ga0207694_100126674 | 245 |
| 32 | 3300026041 | Ga0207639_10056773 | Ga0207639_100567732 | 245 |
| 33 | 3300028794 | Ga0307515_10139291 | Ga0307515_101392912 | 247 |
| 34 | 3300021361 | Ga0213872_10000104 | Ga0213872_1000010449 | 248 |
| 35 | 3300039447 | Ga0436361_0745691 | Ga0436361_0745691_13885_14736 | 248 |
| 36 | 3300003323 | rootH1_10007874 | rootH1_100078748 | 250 |
| 37 | 3300031903 | Ga0307407_10222445 | Ga0307407_102224451 | 251 |
| 38 | 3300032005 | Ga0307411_10001837 | Ga0307411_100018375 | 251 |
| 39 | 3300046462 | Ga0495651_0131559 | Ga0495651_0131559_307_1233 | 251 |
| 40 | 3300049665 | Ga0501227_008444 | Ga0501227_008444_580_1434 | 251 |
| 41 | 3300003752 | Ga0055539_1003632 | Ga0055539_10036322 | 252 |
| 42 | 3300006353 | Ga0075370_10032859 | Ga0075370_100328592 | 252 |
| 43 | 3300025253 | Ga0209677_101638 | Ga0209677_1016384 | 252 |
| 44 | 3300031730 | Ga0307516_10001407 | Ga0307516_1000140720 | 252 |
| 45 | 3300050496 | nmdc:mga07m45_287_c1 | nmdc:mga07m45_287_c1_4886_5812 | 252 |
| 46 | 3300031235 | Ga0265330_10000046 | Ga0265330_10000046102 | 253 |
| 47 | 3300031238 | Ga0265332_10000028 | Ga0265332_1000002811 | 253 |
| 48 | 3300031241 | Ga0265325_10001934 | Ga0265325_100019347 | 253 |
| 49 | 3300031711 | Ga0265314_10000054 | Ga0265314_1000005411 | 253 |
| 50 | 3300005339 | Ga0070660_100347536 | Ga0070660_1003475362 | 254 |
| 51 | 3300025932 | Ga0207690_10232760 | Ga0207690_102327601 | 254 |
| 52 | 3300006058 | Ga0075432_10007220 | Ga0075432_100072203 | 256 |
| 53 | 3300021361 | Ga0213872_10115657 | Ga0213872_101156572 | 257 |
| 54 | 3300039447 | Ga0436361_0364626 | Ga0436361_0364626_222_1073 | 257 |
| 55 | 3300053080 | Ga0500635_0000440 | Ga0500635_0000440_6194_7120 | 257 |
| 56 | 3300006946 | Ga0079104_1000037 | Ga0079104_100003749 | 258 |
| 57 | 3300009092 | Ga0105250_10000294 | Ga0105250_1000029427 | 258 |
| 58 | 3300021361 | Ga0213872_10000081 | Ga0213872_1000008177 | 258 |
| 59 | 3300025935 | Ga0207709_10000167 | Ga0207709_1000016740 | 258 |
| 60 | 3300027111 | Ga0209281_1000002 | Ga0209281_1000002833 | 258 |
| 61 | 3300039447 | Ga0436361_0107660 | Ga0436361_0107660_29938_30795 | 258 |
| 62 | 3300046506 | Ga0495583_0000046 | Ga0495583_0000046_22321_23253 | 258 |
| 63 | 3300046507 | Ga0495606_0021661 | Ga0495606_0021661_1476_2408 | 258 |
| 64 | 3300046694 | Ga0495649_0001661 | Ga0495649_0001661_5129_6061 | 258 |
| 65 | 3300046794 | Ga0495589_0011934 | Ga0495589_0011934_2580_3512 | 258 |
| 66 | 3300031548 | Ga0307408_100159845 | Ga0307408_1001598452 | 259 |
| 67 | 3300031901 | Ga0307406_10022019 | Ga0307406_100220192 | 259 |
| 68 | 3300006353 | Ga0075370_10107000 | Ga0075370_101070002 | 260 |
| 69 | 3300031649 | Ga0307514_10000558 | Ga0307514_1000055865 | 260 |
| 70 | 3300031824 | Ga0307413_10413893 | Ga0307413_104138932 | 260 |
| 71 | 3300042876 | Ga0451577_0027942 | Ga0451577_0027942_3133_3990 | 260 |
| 72 | 3300044712 | Ga0453684_0018857 | Ga0453684_0018857_9462_10319 | 260 |
| 73 | 3300045051 | Ga0451576_0040673 | Ga0451576_0040673_907_1764 | 260 |
| 74 | 3300002705 | JGI25156J39149_1020393 | JGI25156J39149_10203932 | 261 |
| 75 | 3300002987 | JGI25159J45721_1002357 | JGI25159J45721_10023576 | 261 |
| 76 | 3300003187 | JGI25151J46595_10004157 | JGI25151J46595_100041576 | 261 |
| 77 | 3300003771 | Ga0055526_1001278 | Ga0055526_10012786 | 261 |
| 78 | 3300003771 | Ga0055526_1003435 | Ga0055526_10034354 | 261 |
| 79 | 3300003773 | Ga0055537_1000828 | Ga0055537_10008286 | 261 |
| 80 | 3300003775 | Ga0055524_1000044 | Ga0055524_1000044117 | 261 |
| 81 | 3300003781 | Ga0055536_1024379 | Ga0055536_10243792 | 261 |
| 82 | 3300003790 | Ga0055528_1000287 | Ga0055528_10002879 | 261 |
| 83 | 3300003791 | Ga0055530_10001754 | Ga0055530_1000175410 | 261 |
| 84 | 3300003792 | Ga0055540_1000116 | Ga0055540_100011659 | 261 |
| 85 | 3300003794 | Ga0055531_10001297 | Ga0055531_1000129711 | 261 |
| 86 | 3300005327 | Ga0070658_10017380 | Ga0070658_100173802 | 261 |
| 87 | 3300005328 | Ga0070676_10003513 | Ga0070676_100035137 | 261 |
| 88 | 3300005334 | Ga0068869_100002073 | Ga0068869_10000207311 | 261 |
| 89 | 3300005338 | Ga0068868_100028923 | Ga0068868_1000289234 | 261 |
| 90 | 3300005339 | Ga0070660_100008567 | Ga0070660_1000085675 | 261 |
| 91 | 3300005344 | Ga0070661_100259205 | Ga0070661_1002592052 | 261 |
| 92 | 3300005345 | Ga0070692_10051867 | Ga0070692_100518671 | 261 |
| 93 | 3300005353 | Ga0070669_100014598 | Ga0070669_1000145983 | 261 |
| 94 | 3300005354 | Ga0070675_100017521 | Ga0070675_1000175215 | 261 |
| 95 | 3300005366 | Ga0070659_100168388 | Ga0070659_1001683882 | 261 |
| 96 | 3300005457 | Ga0070662_100001463 | Ga0070662_1000014635 | 261 |
| 97 | 3300005535 | Ga0070684_100036654 | Ga0070684_1000366545 | 261 |
| 98 | 3300005539 | Ga0068853_100017239 | Ga0068853_1000172397 | 261 |
| 99 | 3300005545 | Ga0070695_100115990 | Ga0070695_1001159902 | 261 |
| 100 | 3300005547 | Ga0070693_100010390 | Ga0070693_1000103904 | 261 |
| 101 | 3300005578 | Ga0068854_100044869 | Ga0068854_1000448692 | 261 |
| 102 | 3300005614 | Ga0068856_100043891 | Ga0068856_1000438913 | 261 |
| 103 | 3300005616 | Ga0068852_100012059 | Ga0068852_1000120596 | 261 |
| 104 | 3300005618 | Ga0068864_100029161 | Ga0068864_1000291613 | 261 |
| 105 | 3300005842 | Ga0068858_100010785 | Ga0068858_1000107854 | 261 |
| 106 | 3300006237 | Ga0097621_100047457 | Ga0097621_1000474574 | 261 |
| 107 | 3300006358 | Ga0068871_100030276 | Ga0068871_1000302763 | 261 |
| 108 | 3300007076 | Ga0075435_100146720 | Ga0075435_1001467202 | 261 |
| 109 | 3300009177 | Ga0105248_10189109 | Ga0105248_101891092 | 261 |
| 110 | 3300013296 | Ga0157374_10037450 | Ga0157374_100374504 | 261 |
| 111 | 3300013306 | Ga0163162_10022700 | Ga0163162_100227004 | 261 |
| 112 | 3300013307 | Ga0157372_10071953 | Ga0157372_100719534 | 261 |
| 113 | 3300014968 | Ga0157379_10013488 | Ga0157379_100134883 | 261 |
| 114 | 3300014969 | Ga0157376_10017149 | Ga0157376_100171494 | 261 |
| 115 | 3300017792 | Ga0163161_10007666 | Ga0163161_100076664 | 261 |
| 116 | 3300025245 | Ga0207425_1007256 | Ga0207425_10072564 | 261 |
| 117 | 3300025256 | Ga0209759_1002607 | Ga0209759_10026078 | 261 |
| 118 | 3300025263 | Ga0209565_1000200 | Ga0209565_100020055 | 261 |
| 119 | 3300025273 | Ga0209673_1000009 | Ga0209673_1000009454 | 261 |
| 120 | 3300025273 | Ga0209673_1000012 | Ga0209673_1000012355 | 261 |
| 121 | 3300025284 | Ga0209130_1000712 | Ga0209130_100071222 | 261 |
| 122 | 3300025291 | Ga0209675_1000144 | Ga0209675_100014419 | 261 |
| 123 | 3300025292 | Ga0209676_1000051 | Ga0209676_1000051219 | 261 |
| 124 | 3300025294 | Ga0209025_1015564 | Ga0209025_10155642 | 261 |
| 125 | 3300025295 | Ga0209564_1002312 | Ga0209564_100231210 | 261 |
| 126 | 3300025295 | Ga0209564_1002490 | Ga0209564_100249011 | 261 |
| 127 | 3300025298 | Ga0209050_1000044 | Ga0209050_1000044127 | 261 |
| 128 | 3300025299 | Ga0209256_1000003 | Ga0209256_1000003609 | 261 |
| 129 | 3300025302 | Ga0207426_1002959 | Ga0207426_10029596 | 261 |
| 130 | 3300025303 | Ga0209051_1000031 | Ga0209051_1000031127 | 261 |
| 131 | 3300025304 | Ga0209257_1000058 | Ga0209257_1000058121 | 261 |
| 132 | 3300025321 | Ga0207656_10012366 | Ga0207656_100123663 | 261 |
| 133 | 3300025893 | Ga0207682_10013165 | Ga0207682_100131652 | 261 |
| 134 | 3300025901 | Ga0207688_10014069 | Ga0207688_100140692 | 261 |
| 135 | 3300025907 | Ga0207645_10016787 | Ga0207645_100167875 | 261 |
| 136 | 3300025919 | Ga0207657_10104616 | Ga0207657_101046162 | 261 |
| 137 | 3300025923 | Ga0207681_10009855 | Ga0207681_100098555 | 261 |
| 138 | 3300025926 | Ga0207659_10003636 | Ga0207659_100036368 | 261 |
| 139 | 3300025932 | Ga0207690_10145322 | Ga0207690_101453222 | 261 |
| 140 | 3300025941 | Ga0207711_10049262 | Ga0207711_100492623 | 261 |
| 141 | 3300025981 | Ga0207640_10201356 | Ga0207640_102013562 | 261 |
| 142 | 3300026023 | Ga0207677_10008652 | Ga0207677_100086527 | 261 |
| 143 | 3300026023 | Ga0207677_10369024 | Ga0207677_103690241 | 261 |
| 144 | 3300026035 | Ga0207703_10034671 | Ga0207703_100346712 | 261 |
| 145 | 3300026041 | Ga0207639_10005163 | Ga0207639_100051635 | 261 |
| 146 | 3300026067 | Ga0207678_10007290 | Ga0207678_100072902 | 261 |
| 147 | 3300026088 | Ga0207641_10009819 | Ga0207641_100098194 | 261 |
| 148 | 3300026142 | Ga0207698_10057605 | Ga0207698_100576052 | 261 |
| 149 | 3300035691 | Ga0373931_0081128 | Ga0373931_0081128_698_1561 | 261 |
| 150 | 3300044673 | Ga0453683_0079925 | Ga0453683_0079925_64_924 | 261 |
| 151 | 3300048903 | Ga0496100_0018155 | Ga0496100_0018155_666_1529 | 261 |
| 152 | 3300048904 | Ga0496101_0032355 | Ga0496101_0032355_2519_3382 | 261 |
| 153 | 3300048905 | Ga0496102_0122425 | Ga0496102_0122425_378_1241 | 261 |
| 154 | 3300048909 | Ga0496106_0027831 | Ga0496106_0027831_3048_3911 | 261 |
| 155 | 3300048910 | Ga0496107_0054184 | Ga0496107_0054184_1298_2161 | 261 |
| 156 | 3300048911 | Ga0496108_0007144 | Ga0496108_0007144_2933_3796 | 261 |
| 157 | 3300048912 | Ga0496109_0050112 | Ga0496109_0050112_2101_2964 | 261 |
| 158 | 3300048913 | Ga0496110_0017947 | Ga0496110_0017947_2031_2894 | 261 |
| 159 | 3300048915 | Ga0496112_0194909 | Ga0496112_0194909_264_1127 | 261 |
| 160 | 3300048918 | Ga0496115_0026390 | Ga0496115_0026390_2927_3790 | 261 |
| 161 | 3300050512 | nmdc:mga0n895_293927_c1 | nmdc:mga0n895_293927_c1_451_1314 | 261 |
| 162 | 3300053730 | Ga0500645_003082 | Ga0500645_003082_83_931 | 261 |
| 163 | 3300005327 | Ga0070658_10047156 | Ga0070658_100471562 | 262 |
| 164 | 3300031456 | Ga0307513_10000008 | Ga0307513_10000008224 | 262 |
| 165 | 3300005467 | Ga0070706_100083698 | Ga0070706_1000836982 | 263 |
| 166 | 3300005843 | Ga0068860_100223856 | Ga0068860_1002238562 | 263 |
| 167 | 3300025910 | Ga0207684_10102156 | Ga0207684_101021562 | 263 |
| 168 | 3300031456 | Ga0307513_10000441 | Ga0307513_1000044135 | 263 |
| 169 | 3300053139 | Ga0500568_0029407 | Ga0500568_0029407_869_1744 | 263 |
| 170 | 3300048911 | Ga0496108_0513017 | Ga0496108_0513017_23_895 | 264 |
| 171 | 3300002774 | JGI25150J39212_1009044 | JGI25150J39212_10090442 | 265 |
| 172 | 3300003773 | Ga0055537_1007772 | Ga0055537_10077722 | 265 |
| 173 | 3300005339 | Ga0070660_100357912 | Ga0070660_1003579122 | 265 |
| 174 | 3300005355 | Ga0070671_100095936 | Ga0070671_1000959362 | 265 |
| 175 | 3300005456 | Ga0070678_100181835 | Ga0070678_1001818351 | 265 |
| 176 | 3300005578 | Ga0068854_100135268 | Ga0068854_1001352681 | 265 |
| 177 | 3300005616 | Ga0068852_100020133 | Ga0068852_1000201332 | 265 |
| 178 | 3300005618 | Ga0068864_100100387 | Ga0068864_1001003872 | 265 |
| 179 | 3300006048 | Ga0075363_100070325 | Ga0075363_1000703253 | 265 |
| 180 | 3300006051 | Ga0075364_10086749 | Ga0075364_100867491 | 265 |
| 181 | 3300013296 | Ga0157374_10619658 | Ga0157374_106196581 | 265 |
| 182 | 3300013308 | Ga0157375_10145574 | Ga0157375_101455743 | 265 |
| 183 | 3300025245 | Ga0207425_1004526 | Ga0207425_10045263 | 265 |
| 184 | 3300025263 | Ga0209565_1000559 | Ga0209565_100055918 | 265 |
| 185 | 3300025291 | Ga0209675_1002213 | Ga0209675_10022139 | 265 |
| 186 | 3300025294 | Ga0209025_1007558 | Ga0209025_10075582 | 265 |
| 187 | 3300025297 | Ga0209758_1005804 | Ga0209758_10058047 | 265 |
| 188 | 3300025960 | Ga0207651_10239931 | Ga0207651_102399312 | 265 |
| 189 | 3300025981 | Ga0207640_10098185 | Ga0207640_100981853 | 265 |
| 190 | 3300044694 | Ga0466963_0048757 | Ga0466963_0048757_984_1925 | 265 |
| 191 | 3300048912 | Ga0496109_0438352 | Ga0496109_0438352_227_1090 | 265 |
| 192 | 3300050489 | nmdc:mga03683_214266_c1 | nmdc:mga03683_214266_c1_15_863 | 265 |
| 193 | 3300050491 | nmdc:mga00v17_27021_c1 | nmdc:mga00v17_27021_c1_1206_2054 | 265 |
| 194 | 3300053088 | Ga0500644_0013299 | Ga0500644_0013299_769_1617 | 265 |
| 195 | 3300053117 | Ga0500593_005834 | Ga0500593_005834_1433_2281 | 265 |
| 196 | 3300053151 | Ga0500604_0036077 | Ga0500604_0036077_464_1312 | 265 |
| 197 | 3300055283 | Ga0500661_007912 | Ga0500661_007912_716_1564 | 265 |
| 198 | 3300003320 | rootH2_10039549 | rootH2_100395493 | 266 |
| 199 | 3300005564 | Ga0070664_100142743 | Ga0070664_1001427432 | 266 |
| 200 | 3300025920 | Ga0207649_10115382 | Ga0207649_101153822 | 266 |
| 201 | 3300025931 | Ga0207644_10074570 | Ga0207644_100745703 | 266 |
| 202 | 3300037466 | Ga0395898_0085060 | Ga0395898_0085060_1866_2792 | 266 |
| 203 | 3300038443 | Ga0395901_0001180 | Ga0395901_0001180_20781_21707 | 266 |
| 204 | 3300046660 | Ga0495625_0018673 | Ga0495625_0018673_3093_4025 | 266 |
| 205 | 3300048907 | Ga0496104_0287748 | Ga0496104_0287748_94_957 | 266 |
| 206 | 3300053138 | Ga0500564_074163 | Ga0500564_074163_206_1138 | 266 |
| 207 | 3300053177 | Ga0500636_0073357 | Ga0500636_0073357_438_1370 | 266 |
| 208 | 3300002704 | JGI25155J39150_1000029 | JGI25155J39150_100002949 | 267 |
| 209 | 3300002705 | JGI25156J39149_1000062 | JGI25156J39149_100006220 | 267 |
| 210 | 3300002738 | JGI25154J39366_1000053 | JGI25154J39366_100005360 | 267 |
| 211 | 3300002741 | JGI25157J39369_1000046 | JGI25157J39369_100004649 | 267 |
| 212 | 3300005333 | Ga0070677_10026888 | Ga0070677_100268881 | 267 |
| 213 | 3300006948 | Ga0099826_10063663 | Ga0099826_100636633 | 267 |
| 214 | 3300025206 | Ga0209435_100003 | Ga0209435_100003231 | 267 |
| 215 | 3300025246 | Ga0209646_1000008 | Ga0209646_1000008231 | 267 |
| 216 | 3300025250 | Ga0209026_1000007 | Ga0209026_1000007231 | 267 |
| 217 | 3300025256 | Ga0209759_1000026 | Ga0209759_100002649 | 267 |
| 218 | 3300028794 | Ga0307515_10237819 | Ga0307515_102378192 | 267 |
| 219 | 3300048925 | Ga0496122_0042267 | Ga0496122_0042267_60_920 | 267 |
| 220 | 3300048926 | Ga0496123_0178107 | Ga0496123_0178107_59_919 | 267 |
| 221 | 3300048928 | Ga0496125_0000319 | Ga0496125_0000319_15544_16404 | 267 |
| 222 | 3300048929 | Ga0496126_0019070 | Ga0496126_0019070_1851_2711 | 267 |
| 223 | 3300025938 | Ga0207704_10223500 | Ga0207704_102235002 | 268 |
| 224 | 3300053122 | Ga0500608_072733 | Ga0500608_072733_309_1241 | 268 |
| 225 | 3300046615 | Ga0495656_0014709 | Ga0495656_0014709_268_1122 | 269 |
| 226 | 3300048090 | Ga0495615_0015407 | Ga0495615_0015407_544_1398 | 269 |
| 227 | 3300049579 | Ga0501043_0000057 | Ga0501043_0000057_97461_98318 | 269 |
| 228 | 3300049580 | Ga0501046_0000075 | Ga0501046_0000075_97461_98318 | 269 |
| 229 | 3300049581 | Ga0501047_0000081 | Ga0501047_0000081_97461_98318 | 269 |
| 230 | 3300049582 | Ga0501048_0002921 | Ga0501048_0002921_2926_3783 | 269 |
| 231 | 3300049824 | Ga0501045_0002738 | Ga0501045_0002738_1038_1895 | 269 |
| 232 | 3300009177 | Ga0105248_10152034 | Ga0105248_101520342 | 270 |
| 233 | 3300014325 | Ga0163163_10289892 | Ga0163163_102898922 | 270 |
| 234 | 3300025256 | Ga0209759_1016144 | Ga0209759_10161442 | 270 |
| 235 | 3300025908 | Ga0207643_10064311 | Ga0207643_100643112 | 270 |
| 236 | 3300025926 | Ga0207659_10012868 | Ga0207659_100128683 | 270 |
| 237 | 3300025941 | Ga0207711_10330692 | Ga0207711_103306922 | 270 |
| 238 | 3300003794 | Ga0055531_10000181 | Ga0055531_100001818 | 271 |
| 239 | 3300005367 | Ga0070667_100319537 | Ga0070667_1003195372 | 271 |
| 240 | 3300005543 | Ga0070672_100007343 | Ga0070672_1000073437 | 271 |
| 241 | 3300005616 | Ga0068852_100035670 | Ga0068852_1000356702 | 271 |
| 242 | 3300005617 | Ga0068859_100152233 | Ga0068859_1001522332 | 271 |
| 243 | 3300005842 | Ga0068858_100011373 | Ga0068858_1000113732 | 271 |
| 244 | 3300005843 | Ga0068860_100016235 | Ga0068860_1000162356 | 271 |
| 245 | 3300006931 | Ga0097620_100152226 | Ga0097620_1001522262 | 271 |
| 246 | 3300013308 | Ga0157375_10128587 | Ga0157375_101285873 | 271 |
| 247 | 3300025298 | Ga0209050_1004206 | Ga0209050_10042062 | 271 |
| 248 | 3300025303 | Ga0209051_1028775 | Ga0209051_10287752 | 271 |
| 249 | 3300025304 | Ga0209257_1000053 | Ga0209257_100005312 | 271 |
| 250 | 3300025940 | Ga0207691_10008676 | Ga0207691_100086768 | 271 |
| 251 | 3300025941 | Ga0207711_10087883 | Ga0207711_100878833 | 271 |
| 252 | 3300026035 | Ga0207703_10003521 | Ga0207703_1000352112 | 271 |
| 253 | 3300026041 | Ga0207639_10090898 | Ga0207639_100908981 | 271 |
| 254 | 3300028381 | Ga0268264_10004863 | Ga0268264_100048639 | 271 |
| 255 | 3300045051 | Ga0451576_0089891 | Ga0451576_0089891_1100_1966 | 271 |
| 256 | 3300046522 | Ga0495643_0049136 | Ga0495643_0049136_52_909 | 271 |
| 257 | 3300053136 | Ga0500559_0012113 | Ga0500559_0012113_499_1443 | 271 |
| 258 | 3300053138 | Ga0500564_015387 | Ga0500564_015387_1918_2862 | 271 |
| 259 | 3300005356 | Ga0070674_100081578 | Ga0070674_1000815781 | 272 |
| 260 | 3300042876 | Ga0451577_0001915 | Ga0451577_0001915_20947_21801 | 272 |
| 261 | 3300044656 | Ga0466969_0001965 | Ga0466969_0001965_2397_3338 | 272 |
| 262 | 3300044683 | Ga0466965_0065288 | Ga0466965_0065288_849_1790 | 272 |
| 263 | 3300044693 | Ga0466961_0116422 | Ga0466961_0116422_597_1538 | 272 |
| 264 | 3300044719 | Ga0466971_0012864 | Ga0466971_0012864_2397_3338 | 272 |
| 265 | 3300044765 | Ga0466970_0034940 | Ga0466970_0034940_1025_1966 | 272 |
| 266 | 3300044842 | Ga0466957_0015737 | Ga0466957_0015737_2675_3616 | 272 |
| 267 | 3300045049 | Ga0466959_0024270 | Ga0466959_0024270_3386_4327 | 272 |
| 268 | 3300045836 | Ga0466958_0062369 | Ga0466958_0062369_402_1343 | 272 |
| 269 | 3300045976 | Ga0466967_0214421 | Ga0466967_0214421_558_1499 | 272 |
| 270 | 3300061719 | Ga0466962_0035189 | Ga0466962_0035189_735_1676 | 272 |
| 271 | 3300002987 | JGI25159J45721_1000769 | JGI25159J45721_10007696 | 273 |
| 272 | 3300003354 | JGI25160J50197_1000253 | JGI25160J50197_100025318 | 273 |
| 273 | 3300003374 | JGI25161J50226_1000046 | JGI25161J50226_100004670 | 273 |
| 274 | 3300004625 | Ga0055543_1000957 | Ga0055543_100095713 | 273 |
| 275 | 3300005336 | Ga0070680_100002568 | Ga0070680_10000256813 | 273 |
| 276 | 3300005458 | Ga0070681_10097499 | Ga0070681_100974992 | 273 |
| 277 | 3300025284 | Ga0209130_1000064 | Ga0209130_100006470 | 273 |
| 278 | 3300025298 | Ga0209050_1005557 | Ga0209050_10055574 | 273 |
| 279 | 3300025302 | Ga0207426_1000116 | Ga0207426_100011647 | 273 |
| 280 | 3300025912 | Ga0207707_10023353 | Ga0207707_100233535 | 273 |
| 281 | 3300025917 | Ga0207660_10184898 | Ga0207660_101848982 | 273 |
| 282 | 3300003322 | rootL2_10133502 | rootL2_101335022 | 274 |
| 283 | 3300003323 | rootH1_10079535 | rootH1_100795353 | 274 |
| 284 | 3300028794 | Ga0307515_10056643 | Ga0307515_100566431 | 274 |
| 285 | 3300031649 | Ga0307514_10084638 | Ga0307514_100846382 | 274 |
| 286 | 3300031730 | Ga0307516_10005507 | Ga0307516_100055079 | 274 |
| 287 | 3300041443 | Ga0451789_0866159 | Ga0451789_0866159_468_1334 | 274 |
| 288 | 3300041509 | Ga0451843_0782854 | Ga0451843_0782854_170_1036 | 274 |
| 289 | 3300041512 | Ga0451853_2355776 | Ga0451853_2355776_90_956 | 274 |
| 290 | 3300046512 | Ga0495610_0041050 | Ga0495610_0041050_535_1401 | 274 |
| 291 | 3300046519 | Ga0495632_0014952 | Ga0495632_0014952_631_1497 | 274 |
| 292 | 3300046660 | Ga0495625_0014961 | Ga0495625_0014961_4320_5186 | 274 |
| 293 | 3300047472 | Ga0495686_0076034 | Ga0495686_0076034_591_1457 | 274 |
| 294 | 3300050493 | nmdc:mga0k408_58692_c1 | nmdc:mga0k408_58692_c1_73_939 | 274 |
| 295 | 3300050496 | nmdc:mga07m45_35343_c1 | nmdc:mga07m45_35343_c1_840_1706 | 274 |
| 296 | 3300005840 | Ga0068870_10092748 | Ga0068870_100927482 | 275 |
| 297 | 3300012502 | Ga0157347_1000790 | Ga0157347_10007902 | 275 |
| 298 | 3300013104 | Ga0157370_10010716 | Ga0157370_100107167 | 275 |
| 299 | 3300014497 | Ga0182008_10005465 | Ga0182008_100054652 | 275 |
| 300 | 3300017792 | Ga0163161_10000564 | Ga0163161_1000056419 | 275 |
| 301 | 3300025908 | Ga0207643_10049564 | Ga0207643_100495643 | 275 |
| 302 | 3300028666 | Ga0265336_10000040 | Ga0265336_1000004075 | 275 |
| 303 | 3300028794 | Ga0307515_10001613 | Ga0307515_1000161337 | 275 |
| 304 | 3300028794 | Ga0307515_10003475 | Ga0307515_1000347518 | 275 |
| 305 | 3300029957 | Ga0265324_10001969 | Ga0265324_100019693 | 275 |
| 306 | 3300031616 | Ga0307508_10000043 | Ga0307508_10000043109 | 275 |
| 307 | 3300031911 | Ga0307412_10001244 | Ga0307412_100012445 | 275 |
| 308 | 3300046674 | Ga0495588_0011839 | Ga0495588_0011839_610_1461 | 275 |
| 309 | 3300014497 | Ga0182008_10001156 | Ga0182008_100011562 | 276 |
| 310 | 3300035089 | Ga0373944_0058267 | Ga0373944_0058267_303_1166 | 276 |
| 311 | 3300035171 | Ga0373946_0059806 | Ga0373946_0059806_736_1599 | 276 |
| 312 | 3300035410 | Ga0373924_0047133 | Ga0373924_0047133_444_1307 | 276 |
| 313 | 3300037068 | Ga0373925_0194322 | Ga0373925_0194322_88_951 | 276 |
| 314 | 3300044901 | Ga0466960_0016896 | Ga0466960_0016896_2170_3027 | 276 |
| 315 | 3300046683 | Ga0495658_0217190 | Ga0495658_0217190_194_1057 | 276 |
| 316 | 3300053085 | Ga0495619_0341975 | Ga0495619_0341975_103_966 | 276 |
| 317 | 3300005329 | Ga0070683_100278424 | Ga0070683_1002784242 | 277 |
| 318 | 3300005344 | Ga0070661_100033654 | Ga0070661_1000336542 | 277 |
| 319 | 3300005366 | Ga0070659_100011368 | Ga0070659_1000113682 | 277 |
| 320 | 3300005367 | Ga0070667_100019496 | Ga0070667_1000194962 | 277 |
| 321 | 3300005535 | Ga0070684_100009956 | Ga0070684_1000099563 | 277 |
| 322 | 3300005548 | Ga0070665_100684470 | Ga0070665_1006844701 | 277 |
| 323 | 3300005563 | Ga0068855_100095395 | Ga0068855_1000953953 | 277 |
| 324 | 3300005564 | Ga0070664_100017065 | Ga0070664_1000170652 | 277 |
| 325 | 3300005616 | Ga0068852_100050103 | Ga0068852_1000501032 | 277 |
| 326 | 3300009551 | Ga0105238_10176341 | Ga0105238_101763412 | 277 |
| 327 | 3300013104 | Ga0157370_10284216 | Ga0157370_102842162 | 277 |
| 328 | 3300025919 | Ga0207657_10017103 | Ga0207657_100171037 | 277 |
| 329 | 3300025920 | Ga0207649_10010331 | Ga0207649_100103312 | 277 |
| 330 | 3300025944 | Ga0207661_10054807 | Ga0207661_100548072 | 277 |
| 331 | 3300026078 | Ga0207702_10014290 | Ga0207702_100142907 | 277 |
| 332 | 3300028379 | Ga0268266_10087364 | Ga0268266_100873642 | 277 |
| 333 | 3300031731 | Ga0307405_10004482 | Ga0307405_100044825 | 277 |
| 334 | 3300031911 | Ga0307412_10034980 | Ga0307412_100349802 | 277 |
| 335 | 3300031995 | Ga0307409_100001001 | Ga0307409_10000100112 | 277 |
| 336 | 3300032002 | Ga0307416_100010461 | Ga0307416_1000104612 | 277 |
| 337 | 3300032126 | Ga0307415_100002908 | Ga0307415_1000029086 | 277 |
| 338 | 3300039447 | Ga0436361_0178218 | Ga0436361_0178218_79_930 | 277 |
| 339 | iso_pu_bacteria | 2511231002 | 2511243581 | 277 |
| 340 | 3300005367 | Ga0070667_100039064 | Ga0070667_1000390642 | 278 |
| 341 | 3300025986 | Ga0207658_10020803 | Ga0207658_100208032 | 278 |
| 342 | 3300037068 | Ga0373925_0458646 | Ga0373925_0458646_66_926 | 278 |
| 343 | 3300027876 | Ga0209974_10008157 | Ga0209974_100081572 | 279 |
| 344 | iso_pu_bacteria | 2643221544 | 2643742993 | 279 |
| 345 | iso_pu_bacteria | 2643221585 | 2643932989 | 279 |
| 346 | iso_pu_bacteria | 2643221639 | 2644217137 | 279 |
| 347 | iso_pu_bacteria | 2643221646 | 2644260490 | 279 |
| 348 | iso_pu_bacteria | 2738541337 | 2739055843 | 279 |
| 349 | iso_pu_bacteria | 2881101125 | 2881103089 | 279 |
| 350 | 3300026116 | Ga0207674_10015017 | Ga0207674_100150172 | 280 |
| 351 | 3300028794 | Ga0307515_10115937 | Ga0307515_101159372 | 280 |
| 352 | 3300032004 | Ga0307414_10177699 | Ga0307414_101776992 | 280 |
| 353 | 3300032005 | Ga0307411_10298609 | Ga0307411_102986092 | 280 |
| 354 | 3300003187 | JGI25151J46595_10002974 | JGI25151J46595_100029746 | 281 |
| 355 | 3300025291 | Ga0209675_1015397 | Ga0209675_10153972 | 281 |
| 356 | 3300025292 | Ga0209676_1004766 | Ga0209676_10047663 | 281 |
| 357 | 3300025294 | Ga0209025_1008226 | Ga0209025_10082265 | 281 |
| 358 | 3300025295 | Ga0209564_1004673 | Ga0209564_10046736 | 281 |
| 359 | 3300025298 | Ga0209050_1010422 | Ga0209050_10104225 | 281 |
| 360 | 3300025304 | Ga0209257_1004718 | Ga0209257_100471810 | 281 |
| 361 | 3300046542 | Ga0495597_0000375 | Ga0495597_0000375_24297_25157 | 281 |
| 362 | iso_pu_bacteria | 2547132374 | 2548501517 | 281 |
| 363 | iso_pu_bacteria | 2643221570 | 2643867284 | 281 |
| 364 | iso_pu_bacteria | 2643221596 | 2643990201 | 281 |
| 365 | iso_pu_bacteria | 2643221609 | 2644059256 | 281 |
| 366 | iso_pu_bacteria | 2643221611 | 2644075706 | 281 |
| 367 | iso_pu_bacteria | 2643221652 | 2644295692 | 281 |
| 368 | iso_pu_bacteria | 2643221654 | 2644301343 | 281 |
| 369 | iso_pu_bacteria | 2643221717 | 2644645236 | 281 |
| 370 | iso_pu_bacteria | 2738543012 | 2739240751 | 281 |
| 371 | iso_pu_bacteria | 2816332133 | 2816472170 | 281 |
| 372 | iso_pu_bacteria | 2894023352 | 2894027368 | 281 |
| 373 | iso_pu_bacteria | 2928115317 | 2928117236 | 281 |
| 374 | iso_pu_bacteria | 2974320154 | 2974320663 | 281 |
| 375 | iso_pu_bacteria | 2990710928 | 2990711080 | 281 |
| 376 | 3300003792 | Ga0055540_1007525 | Ga0055540_10075254 | 282 |
| 377 | 3300003794 | Ga0055531_10001570 | Ga0055531_100015709 | 282 |
| 378 | 3300005327 | Ga0070658_10208714 | Ga0070658_102087142 | 282 |
| 379 | 3300005329 | Ga0070683_100228511 | Ga0070683_1002285112 | 282 |
| 380 | 3300005331 | Ga0070670_100063695 | Ga0070670_1000636952 | 282 |
| 381 | 3300005355 | Ga0070671_100196592 | Ga0070671_1001965921 | 282 |
| 382 | 3300005366 | Ga0070659_100276764 | Ga0070659_1002767641 | 282 |
| 383 | 3300005539 | Ga0068853_100232610 | Ga0068853_1002326102 | 282 |
| 384 | 3300005563 | Ga0068855_100006754 | Ga0068855_10000675411 | 282 |
| 385 | 3300005564 | Ga0070664_100136616 | Ga0070664_1001366162 | 282 |
| 386 | 3300005614 | Ga0068856_100150851 | Ga0068856_1001508512 | 282 |
| 387 | 3300005614 | Ga0068856_100558853 | Ga0068856_1005588532 | 282 |
| 388 | 3300005616 | Ga0068852_100025591 | Ga0068852_1000255916 | 282 |
| 389 | 3300009093 | Ga0105240_10049322 | Ga0105240_100493227 | 282 |
| 390 | 3300013104 | Ga0157370_10413031 | Ga0157370_104130312 | 282 |
| 391 | 3300025273 | Ga0209673_1023111 | Ga0209673_10231112 | 282 |
| 392 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025297 | 282 |
| 393 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039311 | 282 |
| 394 | 3300025913 | Ga0207695_10102107 | Ga0207695_101021071 | 282 |
| 395 | 3300025919 | Ga0207657_10195011 | Ga0207657_101950111 | 282 |
| 396 | 3300025931 | Ga0207644_10238484 | Ga0207644_102384842 | 282 |
| 397 | 3300025940 | Ga0207691_10077575 | Ga0207691_100775751 | 282 |
| 398 | 3300025944 | Ga0207661_10446005 | Ga0207661_104460051 | 282 |
| 399 | 3300025949 | Ga0207667_10126281 | Ga0207667_101262814 | 282 |
| 400 | 3300026041 | Ga0207639_10133886 | Ga0207639_101338862 | 282 |
| 401 | 3300026121 | Ga0207683_10253289 | Ga0207683_102532892 | 282 |
| 402 | 3300026121 | Ga0207683_10408333 | Ga0207683_104083331 | 282 |
| 403 | 3300026142 | Ga0207698_10011200 | Ga0207698_100112004 | 282 |
| 404 | 3300037418 | Ga0395900_0036742 | Ga0395900_0036742_853_1707 | 282 |
| 405 | 3300037466 | Ga0395898_0061066 | Ga0395898_0061066_2246_3100 | 282 |
| 406 | 3300037471 | Ga0395905_0017590 | Ga0395905_0017590_1773_2624 | 282 |
| 407 | 3300037471 | Ga0395905_0029251 | Ga0395905_0029251_2455_3309 | 282 |
| 408 | 3300037471 | Ga0395905_0030931 | Ga0395905_0030931_2922_3776 | 282 |
| 409 | 3300041512 | Ga0451853_3936200 | Ga0451853_3936200_248_1111 | 282 |
| 410 | 3300044673 | Ga0453683_0012856 | Ga0453683_0012856_2842_3696 | 282 |
| 411 | 3300044712 | Ga0453684_0016471 | Ga0453684_0016471_6587_7453 | 282 |
| 412 | 3300045051 | Ga0451576_0012538 | Ga0451576_0012538_4504_5358 | 282 |
| 413 | 3300045976 | Ga0466967_0171989 | Ga0466967_0171989_137_991 | 282 |
| 414 | 3300046472 | Ga0495580_0061350 | Ga0495580_0061350_724_1590 | 282 |
| 415 | 3300046558 | Ga0495633_0001773 | Ga0495633_0001773_9891_10763 | 282 |
| 416 | 3300047322 | Ga0495680_0196936 | Ga0495680_0196936_447_1310 | 282 |
| 417 | 3300048917 | Ga0496114_0041467 | Ga0496114_0041467_141_1004 | 282 |
| 418 | 3300048925 | Ga0496122_0086310 | Ga0496122_0086310_687_1559 | 282 |
| 419 | 3300048926 | Ga0496123_0101812 | Ga0496123_0101812_347_1219 | 282 |
| 420 | 3300048928 | Ga0496125_0066725 | Ga0496125_0066725_1318_2190 | 282 |
| 421 | 3300050492 | nmdc:mga0yw44_155736_c1 | nmdc:mga0yw44_155736_c1_142_996 | 282 |
| 422 | iso_pu_bacteria | 2585428057 | 2587725683 | 282 |
| 423 | iso_pu_bacteria | 2585428058 | 2587735118 | 282 |
| 424 | iso_pu_bacteria | 2588253510 | 2588290614 | 282 |
| 425 | iso_pu_bacteria | 2643221592 | 2643968328 | 282 |
| 426 | iso_pu_bacteria | 2643221625 | 2644143519 | 282 |
| 427 | iso_pu_bacteria | 2643221648 | 2644272106 | 282 |
| 428 | iso_pu_bacteria | 2932422444 | 2932425465 | 282 |
| 429 | 3300002705 | JGI25156J39149_1000972 | JGI25156J39149_100097216 | 283 |
| 430 | 3300002705 | JGI25156J39149_1002726 | JGI25156J39149_10027262 | 283 |
| 431 | 3300002738 | JGI25154J39366_1009191 | JGI25154J39366_10091911 | 283 |
| 432 | 3300002741 | JGI25157J39369_1000566 | JGI25157J39369_100056611 | 283 |
| 433 | 3300002772 | JGI25164J39214_1008120 | JGI25164J39214_10081201 | 283 |
| 434 | 3300003752 | Ga0055539_1000858 | Ga0055539_10008587 | 283 |
| 435 | 3300003752 | Ga0055539_1000894 | Ga0055539_10008942 | 283 |
| 436 | 3300003756 | Ga0055533_1000033 | Ga0055533_1000033188 | 283 |
| 437 | 3300003759 | Ga0055525_1001219 | Ga0055525_10012194 | 283 |
| 438 | 3300005330 | Ga0070690_100033317 | Ga0070690_1000333173 | 283 |
| 439 | 3300005334 | Ga0068869_100034989 | Ga0068869_1000349893 | 283 |
| 440 | 3300005353 | Ga0070669_100159050 | Ga0070669_1001590502 | 283 |
| 441 | 3300005355 | Ga0070671_100005899 | Ga0070671_1000058999 | 283 |
| 442 | 3300005539 | Ga0068853_100212017 | Ga0068853_1002120172 | 283 |
| 443 | 3300005563 | Ga0068855_100011358 | Ga0068855_1000113587 | 283 |
| 444 | 3300005577 | Ga0068857_100021590 | Ga0068857_1000215902 | 283 |
| 445 | 3300005578 | Ga0068854_100040764 | Ga0068854_1000407642 | 283 |
| 446 | 3300005614 | Ga0068856_100006477 | Ga0068856_10000647712 | 283 |
| 447 | 3300005616 | Ga0068852_100211832 | Ga0068852_1002118322 | 283 |
| 448 | 3300005719 | Ga0068861_100017625 | Ga0068861_1000176253 | 283 |
| 449 | 3300005843 | Ga0068860_100259063 | Ga0068860_1002590632 | 283 |
| 450 | 3300006195 | Ga0075366_10009515 | Ga0075366_100095155 | 283 |
| 451 | 3300006195 | Ga0075366_10012697 | Ga0075366_100126972 | 283 |
| 452 | 3300009093 | Ga0105240_10007963 | Ga0105240_1000796313 | 283 |
| 453 | 3300009545 | Ga0105237_10041466 | Ga0105237_100414663 | 283 |
| 454 | 3300009551 | Ga0105238_10020120 | Ga0105238_100201205 | 283 |
| 455 | 3300010375 | Ga0105239_10024247 | Ga0105239_100242472 | 283 |
| 456 | 3300011119 | Ga0105246_10060985 | Ga0105246_100609852 | 283 |
| 457 | 3300013105 | Ga0157369_10147163 | Ga0157369_101471632 | 283 |
| 458 | 3300013297 | Ga0157378_10179747 | Ga0157378_101797472 | 283 |
| 459 | 3300013307 | Ga0157372_10713454 | Ga0157372_107134542 | 283 |
| 460 | 3300025226 | Ga0209674_100064 | Ga0209674_10006460 | 283 |
| 461 | 3300025230 | Ga0209563_100099 | Ga0209563_10009960 | 283 |
| 462 | 3300025231 | Ga0207427_102578 | Ga0207427_1025783 | 283 |
| 463 | 3300025242 | Ga0209258_100759 | Ga0209258_10075911 | 283 |
| 464 | 3300025246 | Ga0209646_1000060 | Ga0209646_1000060183 | 283 |
| 465 | 3300025250 | Ga0209026_1000049 | Ga0209026_1000049181 | 283 |
| 466 | 3300025253 | Ga0209677_100331 | Ga0209677_10033115 | 283 |
| 467 | 3300025253 | Ga0209677_100823 | Ga0209677_1008237 | 283 |
| 468 | 3300025256 | Ga0209759_1000272 | Ga0209759_100027212 | 283 |
| 469 | 3300025909 | Ga0207705_10218367 | Ga0207705_102183672 | 283 |
| 470 | 3300025913 | Ga0207695_10011317 | Ga0207695_100113176 | 283 |
| 471 | 3300025914 | Ga0207671_10014611 | Ga0207671_100146112 | 283 |
| 472 | 3300025918 | Ga0207662_10047176 | Ga0207662_100471762 | 283 |
| 473 | 3300025924 | Ga0207694_10033859 | Ga0207694_100338592 | 283 |
| 474 | 3300025942 | Ga0207689_10055686 | Ga0207689_100556863 | 283 |
| 475 | 3300025944 | Ga0207661_10024950 | Ga0207661_100249505 | 283 |
| 476 | 3300025949 | Ga0207667_10058113 | Ga0207667_100581132 | 283 |
| 477 | 3300025949 | Ga0207667_10083721 | Ga0207667_100837212 | 283 |
| 478 | 3300025981 | Ga0207640_10010011 | Ga0207640_100100112 | 283 |
| 479 | 3300026041 | Ga0207639_10070410 | Ga0207639_100704102 | 283 |
| 480 | 3300026078 | Ga0207702_10000395 | Ga0207702_1000039548 | 283 |
| 481 | 3300026095 | Ga0207676_10400617 | Ga0207676_104006172 | 283 |
| 482 | 3300026116 | Ga0207674_10003791 | Ga0207674_100037917 | 283 |
| 483 | 3300026142 | Ga0207698_10258495 | Ga0207698_102584952 | 283 |
| 484 | 3300032004 | Ga0307414_10215121 | Ga0307414_102151212 | 283 |
| 485 | 3300035692 | Ga0373935_0249640 | Ga0373935_0249640_189_1064 | 283 |
| 486 | 3300036401 | Ga0373937_0151180 | Ga0373937_0151180_59_913 | 283 |
| 487 | 3300046543 | Ga0495645_0054269 | Ga0495645_0054269_1227_2096 | 283 |
| 488 | 3300048907 | Ga0496104_0305658 | Ga0496104_0305658_229_1089 | 283 |
| 489 | 3300048911 | Ga0496108_0072339 | Ga0496108_0072339_712_1572 | 283 |
| 490 | 3300048912 | Ga0496109_0370478 | Ga0496109_0370478_443_1303 | 283 |
| 491 | 3300048916 | Ga0496113_0004477 | Ga0496113_0004477_2381_3241 | 283 |
| 492 | 3300049568 | Ga0501031_0001318 | Ga0501031_0001318_7310_8173 | 283 |
| 493 | 3300050493 | nmdc:mga0k408_3641_c1 | nmdc:mga0k408_3641_c1_1312_2181 | 283 |
| 494 | 3300050493 | nmdc:mga0k408_8906_c1 | nmdc:mga0k408_8906_c1_4368_5243 | 283 |
| 495 | 3300006195 | Ga0075366_10006389 | Ga0075366_100063896 | 284 |
| 496 | 3300006353 | Ga0075370_10006473 | Ga0075370_100064732 | 284 |
| 497 | 3300006353 | Ga0075370_10024535 | Ga0075370_100245352 | 284 |
| 498 | 3300028794 | Ga0307515_10021372 | Ga0307515_100213727 | 284 |
| 499 | 3300050493 | nmdc:mga0k408_1901_c1 | nmdc:mga0k408_1901_c1_8215_9072 | 284 |
| 500 | 3300050496 | nmdc:mga07m45_260_c1 | nmdc:mga07m45_260_c1_4192_5049 | 284 |
| 501 | 3300050496 | nmdc:mga07m45_26703_c1 | nmdc:mga07m45_26703_c1_987_1868 | 284 |
| 502 | iso_pu_bacteria | 2585428062 | 2587754108 | 284 |
| 503 | 3300005328 | Ga0070676_10100387 | Ga0070676_101003872 | 285 |
| 504 | 3300005334 | Ga0068869_100016765 | Ga0068869_1000167652 | 285 |
| 505 | 3300005334 | Ga0068869_100096507 | Ga0068869_1000965072 | 285 |
| 506 | 3300005338 | Ga0068868_100009022 | Ga0068868_1000090227 | 285 |
| 507 | 3300005339 | Ga0070660_100139789 | Ga0070660_1001397892 | 285 |
| 508 | 3300005354 | Ga0070675_100005231 | Ga0070675_1000052315 | 285 |
| 509 | 3300005355 | Ga0070671_100162616 | Ga0070671_1001626162 | 285 |
| 510 | 3300005364 | Ga0070673_100009689 | Ga0070673_1000096898 | 285 |
| 511 | 3300005367 | Ga0070667_100208636 | Ga0070667_1002086362 | 285 |
| 512 | 3300005445 | Ga0070708_100064215 | Ga0070708_1000642153 | 285 |
| 513 | 3300005455 | Ga0070663_100000198 | Ga0070663_10000019824 | 285 |
| 514 | 3300005457 | Ga0070662_100081218 | Ga0070662_1000812182 | 285 |
| 515 | 3300005457 | Ga0070662_100439760 | Ga0070662_1004397601 | 285 |
| 516 | 3300005459 | Ga0068867_100005705 | Ga0068867_1000057055 | 285 |
| 517 | 3300005459 | Ga0068867_100564593 | Ga0068867_1005645931 | 285 |
| 518 | 3300005467 | Ga0070706_100001272 | Ga0070706_10000127213 | 285 |
| 519 | 3300005468 | Ga0070707_100172792 | Ga0070707_1001727921 | 285 |
| 520 | 3300005518 | Ga0070699_100108923 | Ga0070699_1001089232 | 285 |
| 521 | 3300005539 | Ga0068853_100348651 | Ga0068853_1003486512 | 285 |
| 522 | 3300005543 | Ga0070672_100003578 | Ga0070672_1000035786 | 285 |
| 523 | 3300005564 | Ga0070664_100212997 | Ga0070664_1002129972 | 285 |
| 524 | 3300005577 | Ga0068857_100008700 | Ga0068857_1000087008 | 285 |
| 525 | 3300005578 | Ga0068854_100066543 | Ga0068854_1000665432 | 285 |
| 526 | 3300005616 | Ga0068852_100099104 | Ga0068852_1000991042 | 285 |
| 527 | 3300005617 | Ga0068859_100324239 | Ga0068859_1003242392 | 285 |
| 528 | 3300005617 | Ga0068859_100414573 | Ga0068859_1004145732 | 285 |
| 529 | 3300005719 | Ga0068861_100574453 | Ga0068861_1005744531 | 285 |
| 530 | 3300005840 | Ga0068870_10039137 | Ga0068870_100391373 | 285 |
| 531 | 3300006038 | Ga0075365_10042544 | Ga0075365_100425443 | 285 |
| 532 | 3300006042 | Ga0075368_10011203 | Ga0075368_100112032 | 285 |
| 533 | 3300006042 | Ga0075368_10016929 | Ga0075368_100169292 | 285 |
| 534 | 3300006042 | Ga0075368_10027570 | Ga0075368_100275702 | 285 |
| 535 | 3300006048 | Ga0075363_100034513 | Ga0075363_1000345134 | 285 |
| 536 | 3300006048 | Ga0075363_100083888 | Ga0075363_1000838882 | 285 |
| 537 | 3300006051 | Ga0075364_10010377 | Ga0075364_100103773 | 285 |
| 538 | 3300006177 | Ga0075362_10024741 | Ga0075362_100247412 | 285 |
| 539 | 3300006177 | Ga0075362_10048743 | Ga0075362_100487431 | 285 |
| 540 | 3300006178 | Ga0075367_10009505 | Ga0075367_100095052 | 285 |
| 541 | 3300006178 | Ga0075367_10034083 | Ga0075367_100340832 | 285 |
| 542 | 3300006186 | Ga0075369_10002060 | Ga0075369_100020609 | 285 |
| 543 | 3300006186 | Ga0075369_10015885 | Ga0075369_100158852 | 285 |
| 544 | 3300006195 | Ga0075366_10005597 | Ga0075366_100055972 | 285 |
| 545 | 3300006195 | Ga0075366_10014216 | Ga0075366_100142166 | 285 |
| 546 | 3300006195 | Ga0075366_10047676 | Ga0075366_100476763 | 285 |
| 547 | 3300006195 | Ga0075366_10244316 | Ga0075366_102443162 | 285 |
| 548 | 3300006353 | Ga0075370_10000655 | Ga0075370_1000065510 | 285 |
| 549 | 3300006353 | Ga0075370_10009074 | Ga0075370_100090743 | 285 |
| 550 | 3300006353 | Ga0075370_10011334 | Ga0075370_100113342 | 285 |
| 551 | 3300006353 | Ga0075370_10051300 | Ga0075370_100513003 | 285 |
| 552 | 3300006353 | Ga0075370_10218939 | Ga0075370_102189392 | 285 |
| 553 | 3300006353 | Ga0075370_10261746 | Ga0075370_102617462 | 285 |
| 554 | 3300006931 | Ga0097620_100324274 | Ga0097620_1003242742 | 285 |
| 555 | 3300006931 | Ga0097620_100414503 | Ga0097620_1004145032 | 285 |
| 556 | 3300009093 | Ga0105240_10242553 | Ga0105240_102425532 | 285 |
| 557 | 3300009098 | Ga0105245_10534768 | Ga0105245_105347681 | 285 |
| 558 | 3300009148 | Ga0105243_10053189 | Ga0105243_100531892 | 285 |
| 559 | 3300009148 | Ga0105243_10353677 | Ga0105243_103536772 | 285 |
| 560 | 3300009545 | Ga0105237_10023375 | Ga0105237_100233752 | 285 |
| 561 | 3300010375 | Ga0105239_10040868 | Ga0105239_100408685 | 285 |
| 562 | 3300011119 | Ga0105246_10331703 | Ga0105246_103317032 | 285 |
| 563 | 3300013308 | Ga0157375_10006468 | Ga0157375_100064686 | 285 |
| 564 | 3300014968 | Ga0157379_10142805 | Ga0157379_101428052 | 285 |
| 565 | 3300025907 | Ga0207645_10004178 | Ga0207645_100041784 | 285 |
| 566 | 3300025908 | Ga0207643_10026718 | Ga0207643_100267182 | 285 |
| 567 | 3300025910 | Ga0207684_10003606 | Ga0207684_1000360615 | 285 |
| 568 | 3300025913 | Ga0207695_10242856 | Ga0207695_102428562 | 285 |
| 569 | 3300025914 | Ga0207671_10031203 | Ga0207671_100312032 | 285 |
| 570 | 3300025919 | Ga0207657_10148954 | Ga0207657_101489542 | 285 |
| 571 | 3300025925 | Ga0207650_10205841 | Ga0207650_102058412 | 285 |
| 572 | 3300025931 | Ga0207644_10026852 | Ga0207644_100268523 | 285 |
| 573 | 3300025933 | Ga0207706_10035099 | Ga0207706_100350995 | 285 |
| 574 | 3300025933 | Ga0207706_10165269 | Ga0207706_101652692 | 285 |
| 575 | 3300025935 | Ga0207709_10355769 | Ga0207709_103557691 | 285 |
| 576 | 3300025940 | Ga0207691_10008114 | Ga0207691_100081146 | 285 |
| 577 | 3300025942 | Ga0207689_10012076 | Ga0207689_100120765 | 285 |
| 578 | 3300025942 | Ga0207689_10028540 | Ga0207689_100285402 | 285 |
| 579 | 3300025942 | Ga0207689_10127806 | Ga0207689_101278062 | 285 |
| 580 | 3300025945 | Ga0207679_10176253 | Ga0207679_101762532 | 285 |
| 581 | 3300025960 | Ga0207651_10082429 | Ga0207651_100824292 | 285 |
| 582 | 3300025986 | Ga0207658_10027903 | Ga0207658_100279035 | 285 |
| 583 | 3300025986 | Ga0207658_10247812 | Ga0207658_102478122 | 285 |
| 584 | 3300026023 | Ga0207677_10008876 | Ga0207677_100088765 | 285 |
| 585 | 3300026041 | Ga0207639_10338382 | Ga0207639_103383822 | 285 |
| 586 | 3300026067 | Ga0207678_10000684 | Ga0207678_100006846 | 285 |
| 587 | 3300026089 | Ga0207648_10003979 | Ga0207648_1000397910 | 285 |
| 588 | 3300026089 | Ga0207648_10055216 | Ga0207648_100552163 | 285 |
| 589 | 3300026095 | Ga0207676_10446029 | Ga0207676_104460292 | 285 |
| 590 | 3300026118 | Ga0207675_100583168 | Ga0207675_1005831681 | 285 |
| 591 | 3300027866 | Ga0209813_10041789 | Ga0209813_100417892 | 285 |
| 592 | 3300030522 | Ga0307512_10036130 | Ga0307512_100361304 | 285 |
| 593 | 3300031456 | Ga0307513_10415004 | Ga0307513_104150041 | 285 |
| 594 | 3300031507 | Ga0307509_10000991 | Ga0307509_1000099145 | 285 |
| 595 | 3300031507 | Ga0307509_10052470 | Ga0307509_100524703 | 285 |
| 596 | 3300031507 | Ga0307509_10059174 | Ga0307509_100591742 | 285 |
| 597 | 3300031616 | Ga0307508_10003877 | Ga0307508_1000387710 | 285 |
| 598 | 3300031649 | Ga0307514_10101224 | Ga0307514_101012242 | 285 |
| 599 | 3300031730 | Ga0307516_10118594 | Ga0307516_101185943 | 285 |
| 600 | 3300033180 | Ga0307510_10000294 | Ga0307510_1000029412 | 285 |
| 601 | 3300033180 | Ga0307510_10102687 | Ga0307510_101026872 | 285 |
| 602 | 3300035691 | Ga0373931_0016307 | Ga0373931_0016307_179_1039 | 285 |
| 603 | 3300042157 | Ga0439458_0027546 | Ga0439458_0027546_332_1189 | 285 |
| 604 | 3300044656 | Ga0466969_0041892 | Ga0466969_0041892_948_1805 | 285 |
| 605 | 3300044683 | Ga0466965_0039041 | Ga0466965_0039041_634_1491 | 285 |
| 606 | 3300044693 | Ga0466961_0006094 | Ga0466961_0006094_1724_2581 | 285 |
| 607 | 3300044706 | Ga0466964_0020809 | Ga0466964_0020809_831_1688 | 285 |
| 608 | 3300044719 | Ga0466971_0069733 | Ga0466971_0069733_223_1080 | 285 |
| 609 | 3300044765 | Ga0466970_0100098 | Ga0466970_0100098_454_1311 | 285 |
| 610 | 3300046454 | Ga0495592_0000083 | Ga0495592_0000083_24475_25332 | 285 |
| 611 | 3300046512 | Ga0495610_0047763 | Ga0495610_0047763_488_1345 | 285 |
| 612 | 3300046519 | Ga0495632_0054047 | Ga0495632_0054047_39_899 | 285 |
| 613 | 3300046524 | Ga0495648_0229094 | Ga0495648_0229094_13_873 | 285 |
| 614 | 3300046660 | Ga0495625_0021227 | Ga0495625_0021227_715_1572 | 285 |
| 615 | 3300046660 | Ga0495625_0139309 | Ga0495625_0139309_35_895 | 285 |
| 616 | 3300046680 | Ga0495646_0074550 | Ga0495646_0074550_703_1560 | 285 |
| 617 | 3300046690 | Ga0495624_0079091 | Ga0495624_0079091_414_1274 | 285 |
| 618 | 3300047321 | Ga0495676_0130461 | Ga0495676_0130461_131_991 | 285 |
| 619 | 3300047443 | Ga0495687_001691 | Ga0495687_001691_8156_9013 | 285 |
| 620 | 3300048089 | Ga0495614_0096387 | Ga0495614_0096387_392_1252 | 285 |
| 621 | 3300048091 | Ga0495626_0014929 | Ga0495626_0014929_1301_2158 | 285 |
| 622 | 3300048091 | Ga0495626_0035099 | Ga0495626_0035099_268_1125 | 285 |
| 623 | 3300050489 | nmdc:mga03683_13049_c1 | nmdc:mga03683_13049_c1_774_1631 | 285 |
| 624 | 3300050489 | nmdc:mga03683_7894_c1 | nmdc:mga03683_7894_c1_2204_3061 | 285 |
| 625 | 3300050489 | nmdc:mga03683_7924_c1 | nmdc:mga03683_7924_c1_2769_3626 | 285 |
| 626 | 3300050492 | nmdc:mga0yw44_277429_c1 | nmdc:mga0yw44_277429_c1_18_875 | 285 |
| 627 | 3300050493 | nmdc:mga0k408_161_c1 | nmdc:mga0k408_161_c1_30112_30969 | 285 |
| 628 | 3300050493 | nmdc:mga0k408_178873_c1 | nmdc:mga0k408_178873_c1_74_931 | 285 |
| 629 | 3300050493 | nmdc:mga0k408_180_c1 | nmdc:mga0k408_180_c1_22498_23355 | 285 |
| 630 | 3300050493 | nmdc:mga0k408_2769_c1 | nmdc:mga0k408_2769_c1_954_1811 | 285 |
| 631 | 3300050493 | nmdc:mga0k408_76182_c1 | nmdc:mga0k408_76182_c1_892_1752 | 285 |
| 632 | 3300050494 | nmdc:mga06z11_342090_c1 | nmdc:mga06z11_342090_c1_16_873 | 285 |
| 633 | 3300050494 | nmdc:mga06z11_97021_c1 | nmdc:mga06z11_97021_c1_464_1321 | 285 |
| 634 | 3300050495 | nmdc:mga04h51_50128_c1 | nmdc:mga04h51_50128_c1_117_974 | 285 |
| 635 | 3300050496 | nmdc:mga07m45_134411_c1 | nmdc:mga07m45_134411_c1_506_1366 | 285 |
| 636 | 3300050496 | nmdc:mga07m45_15789_c1 | nmdc:mga07m45_15789_c1_543_1400 | 285 |
| 637 | 3300050496 | nmdc:mga07m45_26675_c2 | nmdc:mga07m45_26675_c2_713_1582 | 285 |
| 638 | 3300050496 | nmdc:mga07m45_31900_c1 | nmdc:mga07m45_31900_c1_914_1771 | 285 |
| 639 | 3300050516 | nmdc:mga0sz30_1923_c2 | nmdc:mga0sz30_1923_c2_918_1775 | 285 |
| 640 | 3300050516 | nmdc:mga0sz30_55036_c1 | nmdc:mga0sz30_55036_c1_580_1437 | 285 |
| 641 | 3300053088 | Ga0500644_0042428 | Ga0500644_0042428_404_1261 | 285 |
| 642 | 3300053098 | Ga0500650_0143386 | Ga0500650_0143386_45_905 | 285 |
| 643 | 3300053118 | Ga0500594_0000825 | Ga0500594_0000825_5049_5906 | 285 |
| 644 | 3300053134 | Ga0500658_0001840 | Ga0500658_0001840_3654_4511 | 285 |
| 645 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_76651_77508 | 285 |
| 646 | 3300053156 | Ga0500622_0007525 | Ga0500622_0007525_4641_5498 | 285 |
| 647 | 3300053177 | Ga0500636_0069923 | Ga0500636_0069923_692_1549 | 285 |
| 648 | 3300061719 | Ga0466962_0027502 | Ga0466962_0027502_1157_2014 | 285 |
| 649 | 3300002773 | JGI25152J39213_1001870 | JGI25152J39213_10018705 | 286 |
| 650 | 3300002774 | JGI25150J39212_1011469 | JGI25150J39212_10114692 | 286 |
| 651 | 3300003215 | JGI25153J46596_10001512 | JGI25153J46596_100015127 | 286 |
| 652 | 3300003215 | JGI25153J46596_10006965 | JGI25153J46596_100069652 | 286 |
| 653 | 3300003771 | Ga0055526_1001924 | Ga0055526_10019242 | 286 |
| 654 | 3300003775 | Ga0055524_1000146 | Ga0055524_10001469 | 286 |
| 655 | 3300006195 | Ga0075366_10126329 | Ga0075366_101263292 | 286 |
| 656 | 3300006946 | Ga0079104_1000001 | Ga0079104_1000001304 | 286 |
| 657 | 3300025245 | Ga0207425_1001180 | Ga0207425_10011807 | 286 |
| 658 | 3300025258 | Ga0209129_1000342 | Ga0209129_100034235 | 286 |
| 659 | 3300025291 | Ga0209675_1007775 | Ga0209675_10077752 | 286 |
| 660 | 3300025295 | Ga0209564_1000136 | Ga0209564_100013646 | 286 |
| 661 | 3300025297 | Ga0209758_1000045 | Ga0209758_1000045335 | 286 |
| 662 | 3300025297 | Ga0209758_1000502 | Ga0209758_100050246 | 286 |
| 663 | 3300025298 | Ga0209050_1024043 | Ga0209050_10240432 | 286 |
| 664 | 3300025299 | Ga0209256_1000015 | Ga0209256_1000015396 | 286 |
| 665 | 3300025299 | Ga0209256_1013911 | Ga0209256_10139112 | 286 |
| 666 | 3300025304 | Ga0209257_1010588 | Ga0209257_10105885 | 286 |
| 667 | 3300025304 | Ga0209257_1025307 | Ga0209257_10253072 | 286 |
| 668 | 3300026041 | Ga0207639_10063225 | Ga0207639_100632252 | 286 |
| 669 | 3300027111 | Ga0209281_1000057 | Ga0209281_100005715 | 286 |
| 670 | 3300046519 | Ga0495632_0015142 | Ga0495632_0015142_2644_3504 | 286 |
| 671 | 3300048905 | Ga0496102_0009788 | Ga0496102_0009788_2835_3698 | 286 |
| 672 | 3300048905 | Ga0496102_0015544 | Ga0496102_0015544_2337_3200 | 286 |
| 673 | 3300048917 | Ga0496114_0010776 | Ga0496114_0010776_1672_2532 | 286 |
| 674 | 3300050491 | nmdc:mga00v17_387535_c1 | nmdc:mga00v17_387535_c1_21_881 | 286 |
| 675 | 3300050493 | nmdc:mga0k408_147497_c1 | nmdc:mga0k408_147497_c1_297_1157 | 286 |
| 676 | 3300050496 | nmdc:mga07m45_4971_c1 | nmdc:mga07m45_4971_c1_22_882 | 286 |
| 677 | 3300053117 | Ga0500593_036096 | Ga0500593_036096_370_1233 | 286 |
| 678 | 3300053129 | Ga0500628_019308 | Ga0500628_019308_112_972 | 286 |
| 679 | 3300053131 | Ga0500652_004319 | Ga0500652_004319_433_1293 | 286 |
| 680 | 3300053142 | Ga0500577_0001979 | Ga0500577_0001979_4044_4904 | 286 |
| 681 | 3300053151 | Ga0500604_0009570 | Ga0500604_0009570_1492_2352 | 286 |
| 682 | 3300053156 | Ga0500622_0012262 | Ga0500622_0012262_441_1301 | 286 |
| 683 | 3300053156 | Ga0500622_0078978 | Ga0500622_0078978_507_1367 | 286 |
| 684 | 3300001979 | JGI24740J21852_10011214 | JGI24740J21852_100112142 | 288 |
| 685 | 3300025934 | Ga0207686_10080915 | Ga0207686_100809152 | 288 |
| 686 | 3300025949 | Ga0207667_10050496 | Ga0207667_100504966 | 288 |
| 687 | 3300042007 | Ga0439449_0048916 | Ga0439449_0048916_581_1459 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lw8-assembly1.cif.gz_A | nmr solution structure of helicobacter pylori tonb-ctd (residues 194-285) | 0.7383 | 180 | 271 |
| 1y2o-assembly1.cif.gz_B | structure of n-terminal domain irsp53/baiap2 | 0.7005 | 94 | 152 |
| 1tol-assembly1.cif.gz_A | fusion of n-terminal domain of the minor coat protein from gene iii in phage m13, and c-terminal domain of e. coli protein-tola | 0.6992 | 179 | 282 |
| 2x9a-assembly1.cif.gz_D | crystal structure of g3p from phage if1 in complex with its coreceptor, the c-terminal domain of tola | 0.6952 | 178 | 265 |
| 6fip-assembly1.cif.gz_A | solution nmr structure of pseudomonas aeruginosa tonb ctd | 0.6855 | 204 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P38873_702_876_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7886 | 100 | 153 | 1.25.10.10 |
| 3d0tC00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7388 | 89 | 154 | 1.20.58.890 |
| 3d0tB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.7035 | 89 | 162 | 1.20.58.890 |
| af_A0A0R4ITC8_9_100_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.6861 | 93 | 163 | 1.20.58.80 |
| 3d0tB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.6551 | 89 | 162 | 1.20.58.890 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5WHL5-F1-model_v4 | deleted | 0.9827 | 104 | 283 |
|
| AF-A0A7V8BS15-F1-model_v4 | deleted | 0.9738 | 158 | 285 |
|
| AF-A0A4Q5WHL5-F1-model_v4 | deleted | 0.972 | 104 | 283 |
|
| AF-A0A259JV99-F1-model_v4 | deleted | 0.9606 | 180 | 283 |
|
| AF-A0A259JV99-F1-model_v4 | deleted | 0.9515 | 180 | 283 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar