F475221

General Info

Members Datasets Scaffolds Average Seq Length
686 274 1372 225

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0074555|Ga0501082_0074555_1983_2744
Length 253
Sequence MLDWWLPENVSTYGRDIDWLFHLIYWITGITAILVFATMVAFLVMYKDRPGRRARYTHGNTTLEIVWTVVPSLILVLLTVLSVPAWSRIKMAAPPPSDFALQVTAKQFNWQVTYPGADAKFGTADDKTLLDEMHVPVNKVVHVHLRSQDVIHSFFVPQFRMKQDAVPGREITQWFEASKPGKYELPCAELCGFGHSGMKGWIYVHTAEDYQKWAAENLTAGAAPAAPTPEDRKAETPATNATAAATTGGTATR

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
199 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.75
Rhizosphere 98.25
Stem 0
Stem Tuber 0
Unclassified 21.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0074555 3300060353 Bacteria 2923
2 2214625496 2209111006 Unclassified 1107
3 2214956316 2209111006 Bacteria 1268
4 ARcpr5yngRDRAFT_c006665 3300000043 Bacteria 1035
5 JGI24743J22301_10023367 3300001991 Unclassified 1190
6 JGI24751J29686_10034915 3300002459 Unclassified 1042
7 JGI25406J46586_10011491 3300003203 Bacteria 3883
8 Ga0058863_11363542 3300004799 Unclassified 1003
9 Ga0058861_11969546 3300004800 Bacteria 1591
10 Ga0065714_10126337 3300005288 Unclassified 1282
11 Ga0065704_10022574 3300005289 Unclassified 1588
12 Ga0065712_10014272 3300005290 Unclassified 1591
13 Ga0065715_10027466 3300005293 Bacteria 3680
14 Ga0065707_10116024 3300005295 Bacteria 2248
15 Ga0065707_10205921 3300005295 Unclassified 1288
16 Ga0065707_10372788 3300005295 Bacteria 868
17 Ga0070658_10083242 3300005327 Bacteria 2630
18 Ga0070676_10040281 3300005328 Unclassified 2705
19 Ga0070683_100344534 3300005329 Unclassified 1419
20 Ga0070690_100186867 3300005330 Unclassified 1434
21 Ga0070670_100007533 3300005331 Bacteria 9239
22 Ga0070677_10016331 3300005333 Unclassified 2642
23 Ga0068869_100145714 3300005334 Bacteria 1832
24 Ga0070666_10200903 3300005335 Unclassified 1402
25 Ga0070680_100175053 3300005336 Unclassified 1806
26 Ga0070682_100037705 3300005337 Unclassified 2961
27 Ga0068868_100016152 3300005338 Bacteria 5538
28 Ga0070689_100030623 3300005340 Bacteria 4085
29 Ga0070691_10017295 3300005341 Unclassified 3317
30 Ga0070687_100212818 3300005343 Unclassified 1179
31 Ga0070661_100034669 3300005344 Bacteria 3661
32 Ga0070692_10272409 3300005345 Unclassified 1023
33 Ga0070668_100064010 3300005347 Unclassified 2851
34 Ga0070668_100105022 3300005347 Bacteria 2243
35 Ga0070669_100006039 3300005353 Bacteria 8739
36 Ga0070669_100161464 3300005353 Bacteria 1741
37 Ga0070669_100307574 3300005353 Bacteria 1276
38 Ga0070669_100593130 3300005353 Bacteria 928
39 Ga0070675_100270015 3300005354 Bacteria 1492
40 Ga0070671_100071279 3300005355 Bacteria 2900
41 Ga0070671_100582974 3300005355 Bacteria 966
42 Ga0070674_100044865 3300005356 Bacteria 3017
43 Ga0070674_100110668 3300005356 Bacteria 2016
44 Ga0070673_100136167 3300005364 Bacteria 2067
45 Ga0070659_100163941 3300005366 Unclassified 1818
46 Ga0070667_100034519 3300005367 Unclassified 4232
47 Ga0070709_10298604 3300005434 Bacteria 1176
48 Ga0070710_10377014 3300005437 Unclassified 945
49 Ga0070701_10371153 3300005438 Bacteria 899
50 Ga0070711_100433780 3300005439 Unclassified 1073
51 Ga0070705_100005627 3300005440 Bacteria 6114
52 Ga0070705_100027460 3300005440 Unclassified 3108
53 Ga0070705_100137928 3300005440 Unclassified 1601
54 Ga0070700_100470117 3300005441 Bacteria 961
55 Ga0070700_100533489 3300005441 Bacteria 909
56 Ga0070694_100012458 3300005444 Bacteria 5287
57 Ga0070694_100100412 3300005444 Bacteria 2046
58 Ga0070708_100003289 3300005445 Bacteria 12625
59 Ga0070708_100107979 3300005445 Bacteria 2555
60 Ga0070708_100120580 3300005445 Bacteria 2419
61 Ga0070708_100196650 3300005445 Bacteria 1886
62 Ga0070708_100215314 3300005445 Bacteria 1800
63 Ga0070708_100324107 3300005445 Bacteria 1451
64 Ga0070708_100656202 3300005445 Bacteria 988
65 Ga0070663_100028022 3300005455 Bacteria 3830
66 Ga0070678_100049255 3300005456 Bacteria 3039
67 Ga0070662_100047748 3300005457 Unclassified 3081
68 Ga0070681_10025464 3300005458 Bacteria 5952
69 Ga0070681_10026061 3300005458 Bacteria 5878
70 Ga0068867_100049518 3300005459 Unclassified 3093
71 Ga0070706_100054009 3300005467 Bacteria 3709
72 Ga0070706_100083497 3300005467 Bacteria 2959
73 Ga0070706_100092834 3300005467 Bacteria 2800
74 Ga0070706_100191819 3300005467 Bacteria 1909
75 Ga0070706_100392348 3300005467 Bacteria 1292
76 Ga0070706_100539433 3300005467 Bacteria 1085
77 Ga0070707_100015246 3300005468 Bacteria 7212
78 Ga0070707_100060869 3300005468 Bacteria 3621
79 Ga0070707_100129743 3300005468 Bacteria 2451
80 Ga0070707_100398261 3300005468 Bacteria 1337
81 Ga0070698_100011134 3300005471 Bacteria 9555
82 Ga0070698_100059362 3300005471 Bacteria 3863
83 Ga0070698_100721204 3300005471 Bacteria 940
84 Ga0070699_100006523 3300005518 Bacteria 10160
85 Ga0070699_100114354 3300005518 Unclassified 2371
86 Ga0070699_100722360 3300005518 Bacteria 910
87 Ga0070679_100043618 3300005530 Bacteria 4466
88 Ga0070697_100024894 3300005536 Bacteria 4768
89 Ga0070697_100025817 3300005536 Bacteria 4685
90 Ga0070697_100050227 3300005536 Bacteria 3385
91 Ga0070697_100058167 3300005536 Bacteria 3146
92 Ga0070697_100584027 3300005536 Unclassified 981
93 Ga0068853_100192078 3300005539 Bacteria 1855
94 Ga0070672_100257923 3300005543 Bacteria 1470
95 Ga0070672_100318061 3300005543 Unclassified 1323
96 Ga0070686_100041830 3300005544 Unclassified 2866
97 Ga0070695_100012984 3300005545 Bacteria 5003
98 Ga0070695_100088284 3300005545 Bacteria 2064
99 Ga0070695_100274681 3300005545 Bacteria 1236
100 Ga0070696_100040769 3300005546 Bacteria 3207
101 Ga0070696_100112531 3300005546 Unclassified 1962
102 Ga0070696_100146430 3300005546 Bacteria 1730
103 Ga0070696_100353673 3300005546 Unclassified 1138
104 Ga0070665_100026460 3300005548 Bacteria 5840
105 Ga0070704_100009531 3300005549 Bacteria 5874
106 Ga0070704_100035537 3300005549 Bacteria 3388
107 Ga0070704_100144363 3300005549 Bacteria 1863
108 Ga0070704_100249002 3300005549 Unclassified 1458
109 Ga0070704_100253099 3300005549 Unclassified 1447
110 Ga0068855_100041556 3300005563 Bacteria 5449
111 Ga0070664_100127872 3300005564 Bacteria 2230
112 Ga0068854_100035206 3300005578 Unclassified 3503
113 Ga0068854_100309334 3300005578 Bacteria 1281
114 Ga0068856_100159029 3300005614 Unclassified 2269
115 Ga0070702_100127857 3300005615 Unclassified 1600
116 Ga0068859_100563417 3300005617 Bacteria 1233
117 Ga0068859_100570271 3300005617 Bacteria 1226
118 Ga0068859_100923907 3300005617 Bacteria 957
119 Ga0068864_100178582 3300005618 Bacteria 1940
120 Ga0068861_100631742 3300005719 Bacteria 987
121 Ga0068863_100254132 3300005841 Bacteria 1698
122 Ga0068863_100310845 3300005841 Bacteria 1530
123 Ga0068858_100108705 3300005842 Bacteria 2589
124 Ga0068860_100062865 3300005843 Bacteria 3528
125 Ga0068860_100124309 3300005843 Bacteria 2473
126 Ga0068862_100511242 3300005844 Unclassified 1141
127 Ga0068862_100538251 3300005844 Bacteria 1114
128 Ga0081455_10035271 3300005937 Bacteria 4473
129 Ga0081455_10155490 3300005937 Bacteria 1758
130 Ga0081538_10097673 3300005981 Bacteria 1491
131 Ga0081540_1048048 3300005983 Bacteria 2140
132 Ga0081539_10000702 3300005985 Bacteria 67205
133 Ga0081539_10073556 3300005985 Bacteria 1822
134 Ga0075432_10020660 3300006058 Bacteria 2252
135 Ga0075432_10037177 3300006058 Bacteria 1694
136 Ga0097621_100080501 3300006237 Bacteria 2710
137 Ga0097621_100586982 3300006237 Bacteria 1017
138 Ga0068871_100230148 3300006358 Unclassified 1609
139 Ga0075428_100000123 3300006844 Bacteria 66826
140 Ga0075428_100017412 3300006844 Bacteria 7941
141 Ga0075428_100032758 3300006844 Bacteria 5739
142 Ga0075428_100053335 3300006844 Bacteria 4430
143 Ga0075428_100085149 3300006844 Unclassified 3447
144 Ga0075428_100087462 3300006844 Bacteria 3399
145 Ga0075428_100105900 3300006844 Bacteria 3066
146 Ga0075428_100242505 3300006844 Unclassified 1944
147 Ga0075428_101182355 3300006844 Unclassified 806
148 Ga0075430_100001228 3300006846 Bacteria 20620
149 Ga0075430_100057147 3300006846 Bacteria 3282
150 Ga0075430_100114839 3300006846 Bacteria 2243
151 Ga0075430_100137625 3300006846 Unclassified 2034
152 Ga0075430_100270994 3300006846 Bacteria 1405
153 Ga0075430_100298409 3300006846 Unclassified 1333
154 Ga0075430_100394679 3300006846 Bacteria 1142
155 Ga0075431_100006732 3300006847 Bacteria 11413
156 Ga0075431_100007311 3300006847 Bacteria 10997
157 Ga0075431_100007721 3300006847 Bacteria 10713
158 Ga0075431_100022283 3300006847 Bacteria 6474
159 Ga0075431_100027148 3300006847 Bacteria 5872
160 Ga0075431_100030116 3300006847 Bacteria 5588
161 Ga0075431_100036618 3300006847 Bacteria 5053
162 Ga0075431_100131283 3300006847 Bacteria 2583
163 Ga0075431_100145962 3300006847 Bacteria 2438
164 Ga0075431_100181009 3300006847 Bacteria 2163
165 Ga0075431_100225161 3300006847 Unclassified 1912
166 Ga0075431_100269884 3300006847 Bacteria 1724
167 Ga0075431_100528334 3300006847 Bacteria 1169
168 Ga0075433_10001044 3300006852 Bacteria 19805
169 Ga0075433_10004252 3300006852 Bacteria 11122
170 Ga0075433_10008044 3300006852 Bacteria 8395
171 Ga0075433_10068288 3300006852 Bacteria 3120
172 Ga0075433_10126093 3300006852 Bacteria 2273
173 Ga0075433_10130274 3300006852 Bacteria 2235
174 Ga0075433_10161498 3300006852 Bacteria 1994
175 Ga0075433_10201039 3300006852 Bacteria 1771
176 Ga0075433_10201942 3300006852 Bacteria 1767
177 Ga0075433_10237182 3300006852 Bacteria 1619
178 Ga0075433_10379930 3300006852 Bacteria 1247
179 Ga0075433_10583888 3300006852 Unclassified 981
180 Ga0075433_10758708 3300006852 Unclassified 848
181 Ga0075434_100005031 3300006871 Bacteria 12002
182 Ga0075434_100006853 3300006871 Bacteria 10492
183 Ga0075434_100016235 3300006871 Bacteria 7156
184 Ga0075434_100027311 3300006871 Bacteria 5603
185 Ga0075434_100038242 3300006871 Bacteria 4753
186 Ga0075434_100079599 3300006871 Bacteria 3273
187 Ga0075434_100095786 3300006871 Bacteria 2973
188 Ga0075434_100225773 3300006871 Bacteria 1892
189 Ga0075434_100487642 3300006871 Bacteria 1253
190 Ga0075434_100512122 3300006871 Unclassified 1220
191 Ga0075434_101042675 3300006871 Unclassified 831
192 Ga0075429_100000222 3300006880 Bacteria 38478
193 Ga0075429_100002747 3300006880 Bacteria 14866
194 Ga0075429_100005935 3300006880 Bacteria 10543
195 Ga0075429_100014852 3300006880 Bacteria 6752
196 Ga0075429_100015970 3300006880 Bacteria 6504
197 Ga0075429_100041109 3300006880 Bacteria 4026
198 Ga0075429_100121775 3300006880 Bacteria 2280
199 Ga0075429_100517618 3300006880 Unclassified 1045
200 Ga0075429_100545988 3300006880 Bacteria 1016
201 Ga0075429_100760887 3300006880 Unclassified 848
202 Ga0075429_100811900 3300006880 Unclassified 819
203 Ga0068865_100035785 3300006881 Unclassified 3342
204 Ga0068865_100330906 3300006881 Unclassified 1228
205 Ga0075436_100005948 3300006914 Bacteria 8380
206 Ga0075436_100055283 3300006914 Bacteria 2741
207 Ga0075436_100082988 3300006914 Bacteria 2224
208 Ga0075436_100124996 3300006914 Unclassified 1802
209 Ga0075436_100173045 3300006914 Unclassified 1524
210 Ga0075436_100223165 3300006914 Unclassified 1337
211 Ga0097620_100563421 3300006931 Bacteria 1233
212 Ga0097620_100570320 3300006931 Bacteria 1226
213 Ga0097620_100923947 3300006931 Bacteria 957
214 Ga0075435_100027950 3300007076 Bacteria 4418
215 Ga0075435_100069724 3300007076 Bacteria 2868
216 Ga0075435_100071343 3300007076 Bacteria 2836
217 Ga0075435_100103650 3300007076 Bacteria 2360
218 Ga0075435_100203185 3300007076 Bacteria 1679
219 Ga0075435_100225266 3300007076 Bacteria 1592
220 Ga0075435_100248404 3300007076 Unclassified 1514
221 Ga0099794_10009197 3300007265 Bacteria 4140
222 Ga0099794_10017090 3300007265 Bacteria 3228
223 Ga0099794_10042441 3300007265 Bacteria 2168
224 Ga0105240_10441341 3300009093 Unclassified 1458
225 Ga0111539_10003984 3300009094 Bacteria 19400
226 Ga0111539_10004366 3300009094 Bacteria 18526
227 Ga0111539_10115403 3300009094 Bacteria 3149
228 Ga0111539_10182050 3300009094 Bacteria 2454
229 Ga0111539_10282995 3300009094 Bacteria 1930
230 Ga0111539_10298841 3300009094 Bacteria 1874
231 Ga0111539_10504749 3300009094 Bacteria 1409
232 Ga0111539_11800959 3300009094 Bacteria 710
233 Ga0105245_10487638 3300009098 Bacteria 1247
234 Ga0114129_10000003 3300009147 Bacteria 183186
235 Ga0114129_10002850 3300009147 Bacteria 24174
236 Ga0114129_10003687 3300009147 Bacteria 21565
237 Ga0114129_10017728 3300009147 Bacteria 10139
238 Ga0114129_10026521 3300009147 Bacteria 8205
239 Ga0114129_10038484 3300009147 Bacteria 6746
240 Ga0114129_10115964 3300009147 Bacteria 3691
241 Ga0114129_10122493 3300009147 Bacteria 3578
242 Ga0114129_10133554 3300009147 Bacteria 3407
243 Ga0114129_10190679 3300009147 Bacteria 2784
244 Ga0114129_10262380 3300009147 Bacteria 2314
245 Ga0114129_10318205 3300009147 Bacteria 2069
246 Ga0114129_10354353 3300009147 Bacteria 1943
247 Ga0114129_10368501 3300009147 Bacteria 1899
248 Ga0114129_10518991 3300009147 Bacteria 1553
249 Ga0114129_10589090 3300009147 Bacteria 1442
250 Ga0114129_10775364 3300009147 Bacteria 1225
251 Ga0114129_10867997 3300009147 Bacteria 1146
252 Ga0105243_10291041 3300009148 Unclassified 1475
253 Ga0105243_10510730 3300009148 Bacteria 1141
254 Ga0105241_10033594 3300009174 Unclassified 3851
255 Ga0105242_10048244 3300009176 Unclassified 3461
256 Ga0105242_10197220 3300009176 Bacteria 1786
257 Ga0105242_10243566 3300009176 Bacteria 1617
258 Ga0105242_10390480 3300009176 Bacteria 1296
259 Ga0105248_10704083 3300009177 Bacteria 1140
260 Ga0105237_10574245 3300009545 Unclassified 1134
261 Ga0105249_10258020 3300009553 Bacteria 1731
262 Ga0105249_10260907 3300009553 Unclassified 1722
263 Ga0105239_10176258 3300010375 Bacteria 2391
264 Ga0105246_10015300 3300011119 Bacteria 4842
265 Ga0157337_1003173 3300012483 Unclassified 979
266 Ga0157373_10097125 3300013100 Unclassified 2074
267 Ga0157370_10224642 3300013104 Bacteria 1738
268 Ga0157369_10300778 3300013105 Unclassified 1669
269 Ga0157374_10357887 3300013296 Unclassified 1451
270 Ga0157378_10028152 3300013297 Bacteria 4956
271 Ga0157378_10040858 3300013297 Bacteria 4114
272 Ga0157378_10061715 3300013297 Bacteria 3347
273 Ga0163162_10021952 3300013306 Bacteria 6288
274 Ga0163162_10046026 3300013306 Bacteria 4373
275 Ga0163162_10398729 3300013306 Bacteria 1508
276 Ga0163162_10576213 3300013306 Unclassified 1253
277 Ga0157372_10107796 3300013307 Bacteria 3188
278 Ga0157375_10071935 3300013308 Bacteria 3473
279 Ga0157375_10342011 3300013308 Bacteria 1661
280 Ga0157375_10964439 3300013308 Unclassified 994
281 Ga0163163_10276209 3300014325 Unclassified 1731
282 Ga0157379_10381510 3300014968 Unclassified 1293
283 Ga0157376_10179068 3300014969 Bacteria 1936
284 Ga0182007_10047899 3300015262 Unclassified 1413
285 Ga0163161_10050097 3300017792 Bacteria 3021
286 Ga0163161_10146837 3300017792 Bacteria 1789
287 Ga0163161_10321471 3300017792 Bacteria 1223
288 Ga0207673_1015380 3300025290 Unclassified 1012
289 Ga0207697_10026549 3300025315 Bacteria 2368
290 Ga0207642_10371947 3300025899 Unclassified 848
291 Ga0207688_10063742 3300025901 Bacteria 2079
292 Ga0207680_10284645 3300025903 Unclassified 1149
293 Ga0207645_10001193 3300025907 Bacteria 21438
294 Ga0207645_10050241 3300025907 Bacteria 2662
295 Ga0207705_10066290 3300025909 Bacteria 2611
296 Ga0207684_10000888 3300025910 Bacteria 33994
297 Ga0207684_10011837 3300025910 Bacteria 7605
298 Ga0207684_10012601 3300025910 Bacteria 7349
299 Ga0207684_10067467 3300025910 Unclassified 3040
300 Ga0207684_10093153 3300025910 Bacteria 2569
301 Ga0207654_10066786 3300025911 Unclassified 2123
302 Ga0207707_10039802 3300025912 Bacteria 4108
303 Ga0207707_10146762 3300025912 Bacteria 2062
304 Ga0207695_10489177 3300025913 Unclassified 1112
305 Ga0207671_10521485 3300025914 Unclassified 947
306 Ga0207663_10073908 3300025916 Unclassified 2207
307 Ga0207660_10057470 3300025917 Bacteria 2786
308 Ga0207662_10089499 3300025918 Unclassified 1891
309 Ga0207657_10071100 3300025919 Unclassified 2947
310 Ga0207649_10637965 3300025920 Unclassified 822
311 Ga0207652_10449346 3300025921 Bacteria 1162
312 Ga0207652_10833788 3300025921 Unclassified 817
313 Ga0207646_10026379 3300025922 Bacteria 5302
314 Ga0207646_10029470 3300025922 Bacteria 4988
315 Ga0207646_10035231 3300025922 Bacteria 4521
316 Ga0207646_10110713 3300025922 Bacteria 2464
317 Ga0207646_10223623 3300025922 Bacteria 1701
318 Ga0207646_10333864 3300025922 Bacteria 1369
319 Ga0207681_10078735 3300025923 Unclassified 2320
320 Ga0207681_10366972 3300025923 Unclassified 1156
321 Ga0207681_10628853 3300025923 Bacteria 889
322 Ga0207681_10663073 3300025923 Bacteria 865
323 Ga0207650_10005231 3300025925 Bacteria 8845
324 Ga0207687_10341688 3300025927 Unclassified 1217
325 Ga0207690_10065495 3300025932 Bacteria 2485
326 Ga0207706_10022883 3300025933 Bacteria 5608
327 Ga0207706_10131825 3300025933 Unclassified 2198
328 Ga0207686_10246602 3300025934 Bacteria 1303
329 Ga0207686_10323363 3300025934 Unclassified 1153
330 Ga0207670_10067224 3300025936 Unclassified 2465
331 Ga0207669_10058400 3300025937 Bacteria 2353
332 Ga0207704_10013327 3300025938 Bacteria 4110
333 Ga0207704_10606525 3300025938 Unclassified 897
334 Ga0207665_10248396 3300025939 Unclassified 1314
335 Ga0207691_10079794 3300025940 Bacteria 2944
336 Ga0207711_10780606 3300025941 Bacteria 890
337 Ga0207689_10009822 3300025942 Bacteria 8247
338 Ga0207661_10372820 3300025944 Unclassified 1291
339 Ga0207679_10021544 3300025945 Bacteria 4372
340 Ga0207651_10081508 3300025960 Unclassified 2332
341 Ga0207712_10225474 3300025961 Bacteria 1501
342 Ga0207712_10781512 3300025961 Unclassified 838
343 Ga0207668_10154774 3300025972 Bacteria 1780
344 Ga0207668_10188534 3300025972 Unclassified 1632
345 Ga0207668_10648174 3300025972 Bacteria 924
346 Ga0207640_10119301 3300025981 Unclassified 1886
347 Ga0207658_10323423 3300025986 Bacteria 1336
348 Ga0207658_10363996 3300025986 Unclassified 1262
349 Ga0207658_10784021 3300025986 Bacteria 865
350 Ga0207677_10070942 3300026023 Unclassified 2457
351 Ga0207703_10718957 3300026035 Unclassified 950
352 Ga0207639_10079124 3300026041 Bacteria 2597
353 Ga0207678_10006621 3300026067 Bacteria 10270
354 Ga0207702_10093116 3300026078 Bacteria 2642
355 Ga0207641_10268195 3300026088 Bacteria 1601
356 Ga0207641_10270364 3300026088 Bacteria 1595
357 Ga0207641_10397082 3300026088 Bacteria 1323
358 Ga0207648_10024541 3300026089 Bacteria 5380
359 Ga0207648_10085593 3300026089 Bacteria 2750
360 Ga0207648_10151055 3300026089 Bacteria 2049
361 Ga0207648_10176211 3300026089 Bacteria 1891
362 Ga0207676_10053297 3300026095 Unclassified 3166
363 Ga0207676_10590554 3300026095 Bacteria 1066
364 Ga0207675_100089584 3300026118 Unclassified 2891
365 Ga0207675_100219750 3300026118 Bacteria 1830
366 Ga0207675_100353182 3300026118 Bacteria 1441
367 Ga0207675_100356549 3300026118 Bacteria 1434
368 Ga0207683_10003791 3300026121 Bacteria 13101
369 Ga0209969_1010472 3300027360 Bacteria 1327
370 Ga0209967_1007014 3300027364 Bacteria 1538
371 Ga0209984_1012380 3300027424 Bacteria 1112
372 Ga0210000_1017089 3300027462 Bacteria 1098
373 Ga0210000_1025314 3300027462 Unclassified 917
374 Ga0209995_1012231 3300027471 Bacteria 1399
375 Ga0209968_1021400 3300027526 Unclassified 1049
376 Ga0209970_1020506 3300027614 Bacteria 1117
377 Ga0209588_1079568 3300027671 Bacteria 1059
378 Ga0209971_1018267 3300027682 Bacteria 1663
379 Ga0209971_1024357 3300027682 Bacteria 1445
380 Ga0209971_1070501 3300027682 Unclassified 848
381 Ga0209966_1006066 3300027695 Bacteria 2090
382 Ga0209998_10014213 3300027717 Bacteria 1661
383 Ga0209974_10014664 3300027876 Bacteria 2606
384 Ga0209974_10014801 3300027876 Bacteria 2591
385 Ga0209974_10024371 3300027876 Unclassified 2002
386 Ga0207428_10000035 3300027907 Bacteria 229100
387 Ga0207428_10009951 3300027907 Bacteria 8514
388 Ga0207428_10022971 3300027907 Bacteria 5253
389 Ga0207428_10037832 3300027907 Bacteria 3925
390 Ga0207428_10156112 3300027907 Bacteria 1735
391 Ga0207428_10209670 3300027907 Bacteria 1464
392 Ga0207428_10242472 3300027907 Bacteria 1346
393 Ga0268265_10307509 3300028380 Unclassified 1430
394 Ga0268264_10278136 3300028381 Bacteria 1566
395 Ga0268264_10332861 3300028381 Bacteria 1439
396 Ga0307408_100009310 3300031548 Bacteria 6476
397 Ga0307408_100080425 3300031548 Bacteria 2434
398 Ga0307408_100170776 3300031548 Bacteria 1736
399 Ga0307408_100337297 3300031548 Bacteria 1275
400 Ga0307408_100514658 3300031548 Bacteria 1050
401 Ga0307405_10021074 3300031731 Bacteria 3658
402 Ga0307413_10423674 3300031824 Unclassified 1049
403 Ga0307410_10069662 3300031852 Bacteria 2434
404 Ga0307410_10091309 3300031852 Bacteria 2162
405 Ga0307407_10098898 3300031903 Bacteria 1806
406 Ga0307407_10282632 3300031903 Bacteria 1150
407 Ga0307412_10026699 3300031911 Bacteria 3593
408 Ga0307412_10408927 3300031911 Bacteria 1107
409 Ga0307416_100058405 3300032002 Bacteria 3127
410 Ga0307414_10285994 3300032004 Unclassified 1388
411 Ga0307411_10090175 3300032005 Bacteria 2138
412 Ga0307411_10330370 3300032005 Bacteria 1235
413 Ga0307415_100375583 3300032126 Unclassified 1205
414 Ga0373930_0039401 3300034816 Unclassified 1002
415 Ga0373938_0017599 3300034957 Bacteria 1409
416 Ga0373928_0022579 3300035084 Unclassified 1336
417 Ga0373929_0025406 3300035085 Bacteria 1230
418 Ga0373929_0030582 3300035085 Unclassified 1149
419 Ga0373940_0008968 3300035088 Bacteria 2312
420 Ga0373940_0013093 3300035088 Bacteria 1998
421 Ga0373940_0084569 3300035088 Bacteria 943
422 Ga0373949_0066319 3300035090 Unclassified 938
423 Ga0373932_0023460 3300035112 Bacteria 1650
424 Ga0373941_0037085 3300035115 Bacteria 1486
425 Ga0373945_0122784 3300035116 Bacteria 1034
426 Ga0373946_0017015 3300035171 Bacteria 2777
427 Ga0373946_0175575 3300035171 Bacteria 1014
428 Ga0373962_0061436 3300035242 Bacteria 1104
429 Ga0373931_0006710 3300035691 Bacteria 5400
430 Ga0373931_0039955 3300035691 Bacteria 2459
431 Ga0373931_0042652 3300035691 Bacteria 2386
432 Ga0373931_0121131 3300035691 Bacteria 1495
433 Ga0373935_0097577 3300035692 Bacteria 1933
434 Ga0373935_0312838 3300035692 Unclassified 1113
435 Ga0373935_0340660 3300035692 Unclassified 1067
436 Ga0373947_0056150 3300035725 Bacteria 2379
437 Ga0395899_0016473 3300037312 Bacteria 5636
438 Ga0395900_0146275 3300037418 Bacteria 2416
439 Ga0395900_0569437 3300037418 Bacteria 1076
440 Ga0395898_0027152 3300037466 Bacteria 5750
441 Ga0395905_0048481 3300037471 Bacteria 3981
442 Ga0395901_0026657 3300038443 Bacteria 5934
443 Ga0439444_0034939 3300042437 Unclassified 962
444 Ga0451577_0080981 3300042876 Bacteria 2895
445 Ga0451577_0220766 3300042876 Bacteria 1713
446 Ga0451577_0413594 3300042876 Bacteria 1224
447 Ga0453683_0050566 3300044673 Bacteria 2604
448 Ga0453683_0081901 3300044673 Bacteria 2022
449 Ga0453684_0075242 3300044712 Bacteria 4245
450 Ga0451576_0193654 3300045051 Bacteria 2123
451 Ga0451576_0237288 3300045051 Unclassified 1904
452 Ga0495580_0017821 3300046472 Bacteria 5298
453 Ga0495580_0099313 3300046472 Bacteria 2025
454 Ga0495598_0110068 3300046537 Unclassified 922
455 Ga0495669_0031853 3300046684 Bacteria 2316
456 Ga0496101_0259582 3300048904 Bacteria 1355
457 Ga0496102_0052298 3300048905 Bacteria 3721
458 Ga0496102_0284201 3300048905 Unclassified 1559
459 Ga0496102_0965972 3300048905 Bacteria 773
460 Ga0496103_0459663 3300048906 Unclassified 816
461 Ga0496106_0145044 3300048909 Bacteria 1869
462 Ga0496106_0249525 3300048909 Bacteria 1419
463 Ga0496108_0474201 3300048911 Unclassified 1093
464 Ga0496109_0851860 3300048912 Unclassified 849
465 Ga0496110_0372777 3300048913 Unclassified 1301
466 Ga0496111_0370951 3300048914 Unclassified 1059
467 Ga0496113_0188855 3300048916 Bacteria 1635
468 Ga0501309_021307 3300049129 Bacteria 911
469 Ga0501292_013721 3300049515 Bacteria 1249
470 Ga0501031_0025124 3300049568 Bacteria 3885
471 Ga0501032_0110153 3300049569 Bacteria 1822
472 Ga0501036_0046084 3300049572 Bacteria 3692
473 Ga0501037_0024049 3300049573 Bacteria 4504
474 Ga0501037_0184416 3300049573 Bacteria 1480
475 Ga0501038_0029555 3300049574 Bacteria 4854
476 Ga0501038_0030418 3300049574 Bacteria 4779
477 Ga0501039_0124605 3300049575 Bacteria 2021
478 Ga0501039_0221556 3300049575 Bacteria 1487
479 Ga0501039_0375556 3300049575 Bacteria 1117
480 Ga0501040_0015154 3300049576 Bacteria 5094
481 Ga0501040_0021893 3300049576 Bacteria 4274
482 Ga0501040_0044372 3300049576 Bacteria 3030
483 Ga0501040_0134654 3300049576 Bacteria 1739
484 Ga0501040_0265311 3300049576 Bacteria 1226
485 Ga0501040_0302042 3300049576 Bacteria 1144
486 Ga0501041_0105406 3300049577 Bacteria 1747
487 Ga0501041_0119462 3300049577 Unclassified 1637
488 Ga0501041_0299758 3300049577 Unclassified 1013
489 Ga0501041_0345933 3300049577 Bacteria 939
490 Ga0501042_0028807 3300049578 Bacteria 3917
491 Ga0501042_0070417 3300049578 Bacteria 2502
492 Ga0501042_0137462 3300049578 Unclassified 1761
493 Ga0501042_0145256 3300049578 Bacteria 1710
494 Ga0501042_0161423 3300049578 Bacteria 1617
495 Ga0501043_0024978 3300049579 Bacteria 4688
496 Ga0501046_0023156 3300049580 Bacteria 5113
497 Ga0501046_0028097 3300049580 Bacteria 4583
498 Ga0501046_0028156 3300049580 Bacteria 4579
499 Ga0501046_0415495 3300049580 Bacteria 970
500 Ga0501048_0015753 3300049582 Bacteria 5578
501 Ga0501048_0019922 3300049582 Bacteria 4918
502 Ga0501048_0221277 3300049582 Bacteria 1343
503 Ga0501067_0019073 3300049583 Bacteria 3796
504 Ga0501067_0213755 3300049583 Unclassified 1074
505 Ga0501068_0019788 3300049584 Bacteria 3913
506 Ga0501069_0216682 3300049585 Bacteria 1112
507 Ga0501069_0568906 3300049585 Unclassified 679
508 Ga0501071_0013217 3300049587 Bacteria 5623
509 Ga0501071_0085184 3300049587 Unclassified 2317
510 Ga0501071_0284561 3300049587 Bacteria 1251
511 Ga0501071_0420833 3300049587 Bacteria 1021
512 Ga0501071_0440410 3300049587 Unclassified 997
513 Ga0501072_0004100 3300049588 Bacteria 11029
514 Ga0501072_0012251 3300049588 Bacteria 6554
515 Ga0501072_0016902 3300049588 Bacteria 5605
516 Ga0501072_0203236 3300049588 Unclassified 1579
517 Ga0501072_0444012 3300049588 Bacteria 1028
518 Ga0501073_0028317 3300049589 Bacteria 4003
519 Ga0501073_0085276 3300049589 Bacteria 2198
520 Ga0501074_0010734 3300049590 Bacteria 6654
521 Ga0501074_0122116 3300049590 Bacteria 1863
522 Ga0501074_0155430 3300049590 Bacteria 1634
523 Ga0501074_0351075 3300049590 Bacteria 1047
524 Ga0501075_0012719 3300049591 Bacteria 5988
525 Ga0501075_0060057 3300049591 Bacteria 2865
526 Ga0501075_0149936 3300049591 Bacteria 1778
527 Ga0501075_0357795 3300049591 Unclassified 1112
528 Ga0501076_0041268 3300049592 Bacteria 3629
529 Ga0501076_0046948 3300049592 Bacteria 3413
530 Ga0501076_0140554 3300049592 Bacteria 1961
531 Ga0501076_0285214 3300049592 Bacteria 1353
532 Ga0501076_0542901 3300049592 Bacteria 958
533 Ga0501076_0673371 3300049592 Bacteria 854
534 Ga0501077_0002319 3300049593 Bacteria 11460
535 Ga0501077_0006817 3300049593 Bacteria 7028
536 Ga0501077_0009253 3300049593 Bacteria 6118
537 Ga0501077_0038165 3300049593 Unclassified 3058
538 Ga0501077_0064548 3300049593 Unclassified 2322
539 Ga0501077_0071315 3300049593 Bacteria 2202
540 Ga0501077_0236626 3300049593 Unclassified 1161
541 Ga0501077_0321799 3300049593 Bacteria 986
542 Ga0501079_0007951 3300049741 Bacteria 8041
543 Ga0501079_0020077 3300049741 Bacteria 5105
544 Ga0501079_0065488 3300049741 Bacteria 2803
545 Ga0501080_0014862 3300049742 Bacteria 7169
546 Ga0501080_0193823 3300049742 Bacteria 1867
547 Ga0501080_0349414 3300049742 Unclassified 1335
548 Ga0501080_0369563 3300049742 Bacteria 1293
549 Ga0501081_0022012 3300049743 Bacteria 4261
550 Ga0501081_0037318 3300049743 Bacteria 3315
551 Ga0501081_0038041 3300049743 Bacteria 3285
552 Ga0501081_0038437 3300049743 Bacteria 3269
553 Ga0501081_0137784 3300049743 Bacteria 1748
554 Ga0501083_0023898 3300049744 Bacteria 4238
555 Ga0501083_0031163 3300049744 Bacteria 3660
556 Ga0501083_0040572 3300049744 Bacteria 3159
557 Ga0501083_0217554 3300049744 Bacteria 1245
558 Ga0501035_0078677 3300049822 Bacteria 2912
559 Ga0501044_0503005 3300049823 Unclassified 1113
560 Ga0501045_0050486 3300049824 Bacteria 3035
561 Ga0501045_0145169 3300049824 Bacteria 1765
562 Ga0501045_0183208 3300049824 Bacteria 1560
563 nmdc:mga05p37_104342_c1 3300050507 Bacteria 3488
564 nmdc:mga05p37_115044_c1 3300050507 Bacteria 3307
565 nmdc:mga05p37_11767_c1 3300050507 Bacteria 10430
566 nmdc:mga05p37_118779_c1 3300050507 Bacteria 3249
567 nmdc:mga05p37_12275_c1 3300050507 Bacteria 10230
568 nmdc:mga05p37_1260_c1 3300050507 Bacteria 29358
569 nmdc:mga05p37_131949_c1 3300050507 Bacteria 3065
570 nmdc:mga05p37_183568_c1 3300050507 Bacteria 2544
571 nmdc:mga05p37_30612_c1 3300050507 Bacteria 6567
572 nmdc:mga05p37_311152_c1 3300050507 Bacteria 1867
573 nmdc:mga05p37_3525_c1 3300050507 Bacteria 18277
574 nmdc:mga05p37_414662_c1 3300050507 Bacteria 1569
575 nmdc:mga05p37_4304_c1 3300050507 Bacteria 16620
576 nmdc:mga05p37_442651_c1 3300050507 Bacteria 1506
577 nmdc:mga05p37_5284_c1 3300050507 Bacteria 15158
578 nmdc:mga05p37_53248_c1 3300050507 Bacteria 4976
579 nmdc:mga05p37_541746_c1 3300050507 Bacteria 1327
580 nmdc:mga05p37_61331_c1 3300050507 Bacteria 4630
581 nmdc:mga05p37_62134_c1 3300050507 Bacteria 4597
582 nmdc:mga05p37_66863_c1 3300050507 Bacteria 4421
583 nmdc:mga05p37_67669_c1 3300050507 Unclassified 4394
584 nmdc:mga05p37_748548_c1 3300050507 Bacteria 1077
585 nmdc:mga05p37_84866_c1 3300050507 Bacteria 3901
586 nmdc:mga05p37_857_c1 3300050507 Bacteria 34239
587 nmdc:mga05p37_933115_c1 3300050507 Bacteria 931
588 nmdc:mga09592_148052_c1 3300050508 Bacteria 2025
589 nmdc:mga09592_1634_c1 3300050508 Bacteria 10939
590 nmdc:mga09592_198562_c1 3300050508 Bacteria 1737
591 nmdc:mga09592_2243_c1 3300050508 Bacteria 15566
592 nmdc:mga09592_246646_c1 3300050508 Bacteria 1548
593 nmdc:mga09592_46682_c1 3300050508 Bacteria 3649
594 nmdc:mga09592_560121_c1 3300050508 Unclassified 981
595 nmdc:mga09592_662803_c1 3300050508 Unclassified 890
596 nmdc:mga09592_67027_c1 3300050508 Bacteria 3044
597 nmdc:mga09592_68174_c1 3300050508 Bacteria 3018
598 nmdc:mga09592_7567_c1 3300050508 Bacteria 8836
599 nmdc:mga09592_8275_c1 3300050508 Bacteria 8462
600 nmdc:mga09592_9047_c1 3300050508 Bacteria 8096
601 nmdc:mga0qj67_115812_c1 3300050509 Bacteria 2166
602 nmdc:mga0qj67_118_c1 3300050509 Bacteria 52561
603 nmdc:mga0qj67_126662_c1 3300050509 Bacteria 2066
604 nmdc:mga0qj67_136463_c1 3300050509 Bacteria 1988
605 nmdc:mga0qj67_19071_c1 3300050509 Bacteria 5237
606 nmdc:mga0qj67_2147_c1 3300050509 Bacteria 14022
607 nmdc:mga0qj67_257046_c1 3300050509 Bacteria 1417
608 nmdc:mga0qj67_379101_c1 3300050509 Bacteria 1142
609 nmdc:mga0qj67_74882_c1 3300050509 Bacteria 2705
610 nmdc:mga06r32_106494_c1 3300050510 Bacteria 2755
611 nmdc:mga06r32_122405_c1 3300050510 Bacteria 2567
612 nmdc:mga06r32_1432_c1 3300050510 Bacteria 21539
613 nmdc:mga06r32_148519_c1 3300050510 Bacteria 2322
614 nmdc:mga06r32_403093_c1 3300050510 Bacteria 1350
615 nmdc:mga06r32_43501_c1 3300050510 Bacteria 4274
616 nmdc:mga06r32_45836_c1 3300050510 Bacteria 4170
617 nmdc:mga06r32_485_c1 3300050510 Bacteria 34276
618 nmdc:mga06r32_48941_c1 3300050510 Bacteria 4043
619 nmdc:mga06r32_59859_c1 3300050510 Bacteria 3664
620 nmdc:mga06r32_75296_c1 3300050510 Bacteria 3275
621 nmdc:mga06r32_792502_c1 3300050510 Unclassified 909
622 nmdc:mga06r32_92174_c1 3300050510 Bacteria 2962
623 nmdc:mga08y16_125323_c1 3300050511 Bacteria 2672
624 nmdc:mga08y16_145954_c1 3300050511 Bacteria 2460
625 nmdc:mga08y16_164589_c1 3300050511 Bacteria 2304
626 nmdc:mga08y16_455755_c1 3300050511 Bacteria 1304
627 nmdc:mga08y16_727_c1 3300050511 Bacteria 31229
628 nmdc:mga08y16_7620_c1 3300050511 Bacteria 11329
629 nmdc:mga0n895_105273_c1 3300050512 Bacteria 2834
630 nmdc:mga0n895_110987_c1 3300050512 Bacteria 2758
631 nmdc:mga0n895_15721_c1 3300050512 Bacteria 6916
632 nmdc:mga0n895_1823_c1 3300050512 Bacteria 16233
633 nmdc:mga0n895_18877_c1 3300050512 Bacteria 6394
634 nmdc:mga0n895_238782_c1 3300050512 Bacteria 1844
635 nmdc:mga0n895_255554_c1 3300050512 Bacteria 1778
636 nmdc:mga0n895_35655_c1 3300050512 Bacteria 4798
637 nmdc:mga0n895_380_c1 3300050512 Bacteria 30032
638 nmdc:mga0n895_419009_c1 3300050512 Unclassified 1354
639 nmdc:mga0n895_54007_c2 3300050512 Bacteria 3031
640 nmdc:mga0n895_94480_c1 3300050512 Bacteria 2994
641 nmdc:mga0rr50_125391_c1 3300050513 Unclassified 2050
642 nmdc:mga0rr50_1303_c1 3300050513 Bacteria 13613
643 nmdc:mga0rr50_153754_c1 3300050513 Bacteria 1862
644 nmdc:mga0rr50_25822_c1 3300050513 Bacteria 4090
645 nmdc:mga0rr50_31922_c1 3300050513 Bacteria 3746
646 nmdc:mga0rr50_355471_c1 3300050513 Bacteria 1233
647 nmdc:mga0rr50_357072_c1 3300050513 Bacteria 1230
648 nmdc:mga0rr50_53111_c1 3300050513 Bacteria 3014
649 nmdc:mga0rr50_80129_c1 3300050513 Bacteria 2517
650 nmdc:mga0rr50_95313_c1 3300050513 Bacteria 2326
651 nmdc:mga08x19_13744_c1 3300050514 Bacteria 4901
652 nmdc:mga08x19_141996_c1 3300050514 Bacteria 1622
653 nmdc:mga08x19_143015_c1 3300050514 Unclassified 1616
654 nmdc:mga08x19_253550_c1 3300050514 Bacteria 1215
655 nmdc:mga08x19_66127_c1 3300050514 Bacteria 2349
656 nmdc:mga0a205_12967_c1 3300050515 Bacteria 7736
657 nmdc:mga0a205_148748_c1 3300050515 Bacteria 2242
658 nmdc:mga0a205_17796_c1 3300050515 Bacteria 6669
659 nmdc:mga0a205_19087_c1 3300050515 Bacteria 6462
660 nmdc:mga0a205_20583_c1 3300050515 Bacteria 6228
661 nmdc:mga0a205_277093_c1 3300050515 Bacteria 1553
662 nmdc:mga0a205_296743_c1 3300050515 Bacteria 1490
663 nmdc:mga0a205_313703_c1 3300050515 Bacteria 1440
664 nmdc:mga0a205_38923_c1 3300050515 Bacteria 4576
665 nmdc:mga0a205_406766_c1 3300050515 Bacteria 1224
666 nmdc:mga0a205_49764_c1 3300050515 Bacteria 4046
667 nmdc:mga0a205_619379_c1 3300050515 Unclassified 935
668 nmdc:mga0a205_71964_c1 3300050515 Bacteria 3340
669 nmdc:mga0a205_88097_c1 3300050515 Bacteria 3000
670 nmdc:mga0a205_92518_c1 3300050515 Bacteria 2922
671 Ga0501084_0011809 3300054114 Bacteria 7229
672 Ga0501084_0061679 3300054114 Bacteria 3139
673 Ga0501084_0106717 3300054114 Unclassified 2353
674 Ga0501084_0387999 3300054114 Bacteria 1180
675 Ga0590071_006043 3300059421 Bacteria 2892
676 Ga0590075_012624 3300059424 Bacteria 2053
677 Ga0590077_012293 3300059426 Bacteria 1773
678 Ga0590077_015221 3300059426 Bacteria 1606
679 Ga0501082_0010365 3300060353 Bacteria 8026
680 Ga0501082_0029606 3300060353 Bacteria 4717
681 Ga0501082_0146043 3300060353 Bacteria 2053
682 Ga0501082_0251456 3300060353 Bacteria 1538
683 Ga0530510_0000785 3300061734 Bacteria 20630
684 Ga0530510_0003255 3300061734 Bacteria 11164
685 Ga0530510_0013074 3300061734 Bacteria 5837
686 Ga0530510_0363393 3300061734 Bacteria 1088
687 Ga0501082_0074555
688 2214625496
689 2214956316
690 ARcpr5yngRDRAFT_c006665
691 JGI24743J22301_10023367
692 JGI24751J29686_10034915
693 JGI25406J46586_10011491
694 Ga0058863_11363542
695 Ga0058861_11969546
696 Ga0065714_10126337
697 Ga0065704_10022574
698 Ga0065712_10014272
699 Ga0065715_10027466
700 Ga0065707_10116024
701 Ga0065707_10205921
702 Ga0065707_10372788
703 Ga0070658_10083242
704 Ga0070676_10040281
705 Ga0070683_100344534
706 Ga0070690_100186867
707 Ga0070670_100007533
708 Ga0070677_10016331
709 Ga0068869_100145714
710 Ga0070666_10200903
711 Ga0070680_100175053
712 Ga0070682_100037705
713 Ga0068868_100016152
714 Ga0070689_100030623
715 Ga0070691_10017295
716 Ga0070687_100212818
717 Ga0070661_100034669
718 Ga0070692_10272409
719 Ga0070668_100064010
720 Ga0070668_100105022
721 Ga0070669_100006039
722 Ga0070669_100161464
723 Ga0070669_100307574
724 Ga0070669_100593130
725 Ga0070675_100270015
726 Ga0070671_100071279
727 Ga0070671_100582974
728 Ga0070674_100044865
729 Ga0070674_100110668
730 Ga0070673_100136167
731 Ga0070659_100163941
732 Ga0070667_100034519
733 Ga0070709_10298604
734 Ga0070710_10377014
735 Ga0070701_10371153
736 Ga0070711_100433780
737 Ga0070705_100005627
738 Ga0070705_100027460
739 Ga0070705_100137928
740 Ga0070700_100470117
741 Ga0070700_100533489
742 Ga0070694_100012458
743 Ga0070694_100100412
744 Ga0070708_100003289
745 Ga0070708_100107979
746 Ga0070708_100120580
747 Ga0070708_100196650
748 Ga0070708_100215314
749 Ga0070708_100324107
750 Ga0070708_100656202
751 Ga0070663_100028022
752 Ga0070678_100049255
753 Ga0070662_100047748
754 Ga0070681_10025464
755 Ga0070681_10026061
756 Ga0068867_100049518
757 Ga0070706_100054009
758 Ga0070706_100083497
759 Ga0070706_100092834
760 Ga0070706_100191819
761 Ga0070706_100392348
762 Ga0070706_100539433
763 Ga0070707_100015246
764 Ga0070707_100060869
765 Ga0070707_100129743
766 Ga0070707_100398261
767 Ga0070698_100011134
768 Ga0070698_100059362
769 Ga0070698_100721204
770 Ga0070699_100006523
771 Ga0070699_100114354
772 Ga0070699_100722360
773 Ga0070679_100043618
774 Ga0070697_100024894
775 Ga0070697_100025817
776 Ga0070697_100050227
777 Ga0070697_100058167
778 Ga0070697_100584027
779 Ga0068853_100192078
780 Ga0070672_100257923
781 Ga0070672_100318061
782 Ga0070686_100041830
783 Ga0070695_100012984
784 Ga0070695_100088284
785 Ga0070695_100274681
786 Ga0070696_100040769
787 Ga0070696_100112531
788 Ga0070696_100146430
789 Ga0070696_100353673
790 Ga0070665_100026460
791 Ga0070704_100009531
792 Ga0070704_100035537
793 Ga0070704_100144363
794 Ga0070704_100249002
795 Ga0070704_100253099
796 Ga0068855_100041556
797 Ga0070664_100127872
798 Ga0068854_100035206
799 Ga0068854_100309334
800 Ga0068856_100159029
801 Ga0070702_100127857
802 Ga0068859_100563417
803 Ga0068859_100570271
804 Ga0068859_100923907
805 Ga0068864_100178582
806 Ga0068861_100631742
807 Ga0068863_100254132
808 Ga0068863_100310845
809 Ga0068858_100108705
810 Ga0068860_100062865
811 Ga0068860_100124309
812 Ga0068862_100511242
813 Ga0068862_100538251
814 Ga0081455_10035271
815 Ga0081455_10155490
816 Ga0081538_10097673
817 Ga0081540_1048048
818 Ga0081539_10000702
819 Ga0081539_10073556
820 Ga0075432_10020660
821 Ga0075432_10037177
822 Ga0097621_100080501
823 Ga0097621_100586982
824 Ga0068871_100230148
825 Ga0075428_100000123
826 Ga0075428_100017412
827 Ga0075428_100032758
828 Ga0075428_100053335
829 Ga0075428_100085149
830 Ga0075428_100087462
831 Ga0075428_100105900
832 Ga0075428_100242505
833 Ga0075428_101182355
834 Ga0075430_100001228
835 Ga0075430_100057147
836 Ga0075430_100114839
837 Ga0075430_100137625
838 Ga0075430_100270994
839 Ga0075430_100298409
840 Ga0075430_100394679
841 Ga0075431_100006732
842 Ga0075431_100007311
843 Ga0075431_100007721
844 Ga0075431_100022283
845 Ga0075431_100027148
846 Ga0075431_100030116
847 Ga0075431_100036618
848 Ga0075431_100131283
849 Ga0075431_100145962
850 Ga0075431_100181009
851 Ga0075431_100225161
852 Ga0075431_100269884
853 Ga0075431_100528334
854 Ga0075433_10001044
855 Ga0075433_10004252
856 Ga0075433_10008044
857 Ga0075433_10068288
858 Ga0075433_10126093
859 Ga0075433_10130274
860 Ga0075433_10161498
861 Ga0075433_10201039
862 Ga0075433_10201942
863 Ga0075433_10237182
864 Ga0075433_10379930
865 Ga0075433_10583888
866 Ga0075433_10758708
867 Ga0075434_100005031
868 Ga0075434_100006853
869 Ga0075434_100016235
870 Ga0075434_100027311
871 Ga0075434_100038242
872 Ga0075434_100079599
873 Ga0075434_100095786
874 Ga0075434_100225773
875 Ga0075434_100487642
876 Ga0075434_100512122
877 Ga0075434_101042675
878 Ga0075429_100000222
879 Ga0075429_100002747
880 Ga0075429_100005935
881 Ga0075429_100014852
882 Ga0075429_100015970
883 Ga0075429_100041109
884 Ga0075429_100121775
885 Ga0075429_100517618
886 Ga0075429_100545988
887 Ga0075429_100760887
888 Ga0075429_100811900
889 Ga0068865_100035785
890 Ga0068865_100330906
891 Ga0075436_100005948
892 Ga0075436_100055283
893 Ga0075436_100082988
894 Ga0075436_100124996
895 Ga0075436_100173045
896 Ga0075436_100223165
897 Ga0097620_100563421
898 Ga0097620_100570320
899 Ga0097620_100923947
900 Ga0075435_100027950
901 Ga0075435_100069724
902 Ga0075435_100071343
903 Ga0075435_100103650
904 Ga0075435_100203185
905 Ga0075435_100225266
906 Ga0075435_100248404
907 Ga0099794_10009197
908 Ga0099794_10017090
909 Ga0099794_10042441
910 Ga0105240_10441341
911 Ga0111539_10003984
912 Ga0111539_10004366
913 Ga0111539_10115403
914 Ga0111539_10182050
915 Ga0111539_10282995
916 Ga0111539_10298841
917 Ga0111539_10504749
918 Ga0111539_11800959
919 Ga0105245_10487638
920 Ga0114129_10000003
921 Ga0114129_10002850
922 Ga0114129_10003687
923 Ga0114129_10017728
924 Ga0114129_10026521
925 Ga0114129_10038484
926 Ga0114129_10115964
927 Ga0114129_10122493
928 Ga0114129_10133554
929 Ga0114129_10190679
930 Ga0114129_10262380
931 Ga0114129_10318205
932 Ga0114129_10354353
933 Ga0114129_10368501
934 Ga0114129_10518991
935 Ga0114129_10589090
936 Ga0114129_10775364
937 Ga0114129_10867997
938 Ga0105243_10291041
939 Ga0105243_10510730
940 Ga0105241_10033594
941 Ga0105242_10048244
942 Ga0105242_10197220
943 Ga0105242_10243566
944 Ga0105242_10390480
945 Ga0105248_10704083
946 Ga0105237_10574245
947 Ga0105249_10258020
948 Ga0105249_10260907
949 Ga0105239_10176258
950 Ga0105246_10015300
951 Ga0157337_1003173
952 Ga0157373_10097125
953 Ga0157370_10224642
954 Ga0157369_10300778
955 Ga0157374_10357887
956 Ga0157378_10028152
957 Ga0157378_10040858
958 Ga0157378_10061715
959 Ga0163162_10021952
960 Ga0163162_10046026
961 Ga0163162_10398729
962 Ga0163162_10576213
963 Ga0157372_10107796
964 Ga0157375_10071935
965 Ga0157375_10342011
966 Ga0157375_10964439
967 Ga0163163_10276209
968 Ga0157379_10381510
969 Ga0157376_10179068
970 Ga0182007_10047899
971 Ga0163161_10050097
972 Ga0163161_10146837
973 Ga0163161_10321471
974 Ga0207673_1015380
975 Ga0207697_10026549
976 Ga0207642_10371947
977 Ga0207688_10063742
978 Ga0207680_10284645
979 Ga0207645_10001193
980 Ga0207645_10050241
981 Ga0207705_10066290
982 Ga0207684_10000888
983 Ga0207684_10011837
984 Ga0207684_10012601
985 Ga0207684_10067467
986 Ga0207684_10093153
987 Ga0207654_10066786
988 Ga0207707_10039802
989 Ga0207707_10146762
990 Ga0207695_10489177
991 Ga0207671_10521485
992 Ga0207663_10073908
993 Ga0207660_10057470
994 Ga0207662_10089499
995 Ga0207657_10071100
996 Ga0207649_10637965
997 Ga0207652_10449346
998 Ga0207652_10833788
999 Ga0207646_10026379
1000 Ga0207646_10029470
1001 Ga0207646_10035231
1002 Ga0207646_10110713
1003 Ga0207646_10223623
1004 Ga0207646_10333864
1005 Ga0207681_10078735
1006 Ga0207681_10366972
1007 Ga0207681_10628853
1008 Ga0207681_10663073
1009 Ga0207650_10005231
1010 Ga0207687_10341688
1011 Ga0207690_10065495
1012 Ga0207706_10022883
1013 Ga0207706_10131825
1014 Ga0207686_10246602
1015 Ga0207686_10323363
1016 Ga0207670_10067224
1017 Ga0207669_10058400
1018 Ga0207704_10013327
1019 Ga0207704_10606525
1020 Ga0207665_10248396
1021 Ga0207691_10079794
1022 Ga0207711_10780606
1023 Ga0207689_10009822
1024 Ga0207661_10372820
1025 Ga0207679_10021544
1026 Ga0207651_10081508
1027 Ga0207712_10225474
1028 Ga0207712_10781512
1029 Ga0207668_10154774
1030 Ga0207668_10188534
1031 Ga0207668_10648174
1032 Ga0207640_10119301
1033 Ga0207658_10323423
1034 Ga0207658_10363996
1035 Ga0207658_10784021
1036 Ga0207677_10070942
1037 Ga0207703_10718957
1038 Ga0207639_10079124
1039 Ga0207678_10006621
1040 Ga0207702_10093116
1041 Ga0207641_10268195
1042 Ga0207641_10270364
1043 Ga0207641_10397082
1044 Ga0207648_10024541
1045 Ga0207648_10085593
1046 Ga0207648_10151055
1047 Ga0207648_10176211
1048 Ga0207676_10053297
1049 Ga0207676_10590554
1050 Ga0207675_100089584
1051 Ga0207675_100219750
1052 Ga0207675_100353182
1053 Ga0207675_100356549
1054 Ga0207683_10003791
1055 Ga0209969_1010472
1056 Ga0209967_1007014
1057 Ga0209984_1012380
1058 Ga0210000_1017089
1059 Ga0210000_1025314
1060 Ga0209995_1012231
1061 Ga0209968_1021400
1062 Ga0209970_1020506
1063 Ga0209588_1079568
1064 Ga0209971_1018267
1065 Ga0209971_1024357
1066 Ga0209971_1070501
1067 Ga0209966_1006066
1068 Ga0209998_10014213
1069 Ga0209974_10014664
1070 Ga0209974_10014801
1071 Ga0209974_10024371
1072 Ga0207428_10000035
1073 Ga0207428_10009951
1074 Ga0207428_10022971
1075 Ga0207428_10037832
1076 Ga0207428_10156112
1077 Ga0207428_10209670
1078 Ga0207428_10242472
1079 Ga0268265_10307509
1080 Ga0268264_10278136
1081 Ga0268264_10332861
1082 Ga0307408_100009310
1083 Ga0307408_100080425
1084 Ga0307408_100170776
1085 Ga0307408_100337297
1086 Ga0307408_100514658
1087 Ga0307405_10021074
1088 Ga0307413_10423674
1089 Ga0307410_10069662
1090 Ga0307410_10091309
1091 Ga0307407_10098898
1092 Ga0307407_10282632
1093 Ga0307412_10026699
1094 Ga0307412_10408927
1095 Ga0307416_100058405
1096 Ga0307414_10285994
1097 Ga0307411_10090175
1098 Ga0307411_10330370
1099 Ga0307415_100375583
1100 Ga0373930_0039401
1101 Ga0373938_0017599
1102 Ga0373928_0022579
1103 Ga0373929_0025406
1104 Ga0373929_0030582
1105 Ga0373940_0008968
1106 Ga0373940_0013093
1107 Ga0373940_0084569
1108 Ga0373949_0066319
1109 Ga0373932_0023460
1110 Ga0373941_0037085
1111 Ga0373945_0122784
1112 Ga0373946_0017015
1113 Ga0373946_0175575
1114 Ga0373962_0061436
1115 Ga0373931_0006710
1116 Ga0373931_0039955
1117 Ga0373931_0042652
1118 Ga0373931_0121131
1119 Ga0373935_0097577
1120 Ga0373935_0312838
1121 Ga0373935_0340660
1122 Ga0373947_0056150
1123 Ga0395899_0016473
1124 Ga0395900_0146275
1125 Ga0395900_0569437
1126 Ga0395898_0027152
1127 Ga0395905_0048481
1128 Ga0395901_0026657
1129 Ga0439444_0034939
1130 Ga0451577_0080981
1131 Ga0451577_0220766
1132 Ga0451577_0413594
1133 Ga0453683_0050566
1134 Ga0453683_0081901
1135 Ga0453684_0075242
1136 Ga0451576_0193654
1137 Ga0451576_0237288
1138 Ga0495580_0017821
1139 Ga0495580_0099313
1140 Ga0495598_0110068
1141 Ga0495669_0031853
1142 Ga0496101_0259582
1143 Ga0496102_0052298
1144 Ga0496102_0284201
1145 Ga0496102_0965972
1146 Ga0496103_0459663
1147 Ga0496106_0145044
1148 Ga0496106_0249525
1149 Ga0496108_0474201
1150 Ga0496109_0851860
1151 Ga0496110_0372777
1152 Ga0496111_0370951
1153 Ga0496113_0188855
1154 Ga0501309_021307
1155 Ga0501292_013721
1156 Ga0501031_0025124
1157 Ga0501032_0110153
1158 Ga0501036_0046084
1159 Ga0501037_0024049
1160 Ga0501037_0184416
1161 Ga0501038_0029555
1162 Ga0501038_0030418
1163 Ga0501039_0124605
1164 Ga0501039_0221556
1165 Ga0501039_0375556
1166 Ga0501040_0015154
1167 Ga0501040_0021893
1168 Ga0501040_0044372
1169 Ga0501040_0134654
1170 Ga0501040_0265311
1171 Ga0501040_0302042
1172 Ga0501041_0105406
1173 Ga0501041_0119462
1174 Ga0501041_0299758
1175 Ga0501041_0345933
1176 Ga0501042_0028807
1177 Ga0501042_0070417
1178 Ga0501042_0137462
1179 Ga0501042_0145256
1180 Ga0501042_0161423
1181 Ga0501043_0024978
1182 Ga0501046_0023156
1183 Ga0501046_0028097
1184 Ga0501046_0028156
1185 Ga0501046_0415495
1186 Ga0501048_0015753
1187 Ga0501048_0019922
1188 Ga0501048_0221277
1189 Ga0501067_0019073
1190 Ga0501067_0213755
1191 Ga0501068_0019788
1192 Ga0501069_0216682
1193 Ga0501069_0568906
1194 Ga0501071_0013217
1195 Ga0501071_0085184
1196 Ga0501071_0284561
1197 Ga0501071_0420833
1198 Ga0501071_0440410
1199 Ga0501072_0004100
1200 Ga0501072_0012251
1201 Ga0501072_0016902
1202 Ga0501072_0203236
1203 Ga0501072_0444012
1204 Ga0501073_0028317
1205 Ga0501073_0085276
1206 Ga0501074_0010734
1207 Ga0501074_0122116
1208 Ga0501074_0155430
1209 Ga0501074_0351075
1210 Ga0501075_0012719
1211 Ga0501075_0060057
1212 Ga0501075_0149936
1213 Ga0501075_0357795
1214 Ga0501076_0041268
1215 Ga0501076_0046948
1216 Ga0501076_0140554
1217 Ga0501076_0285214
1218 Ga0501076_0542901
1219 Ga0501076_0673371
1220 Ga0501077_0002319
1221 Ga0501077_0006817
1222 Ga0501077_0009253
1223 Ga0501077_0038165
1224 Ga0501077_0064548
1225 Ga0501077_0071315
1226 Ga0501077_0236626
1227 Ga0501077_0321799
1228 Ga0501079_0007951
1229 Ga0501079_0020077
1230 Ga0501079_0065488
1231 Ga0501080_0014862
1232 Ga0501080_0193823
1233 Ga0501080_0349414
1234 Ga0501080_0369563
1235 Ga0501081_0022012
1236 Ga0501081_0037318
1237 Ga0501081_0038041
1238 Ga0501081_0038437
1239 Ga0501081_0137784
1240 Ga0501083_0023898
1241 Ga0501083_0031163
1242 Ga0501083_0040572
1243 Ga0501083_0217554
1244 Ga0501035_0078677
1245 Ga0501044_0503005
1246 Ga0501045_0050486
1247 Ga0501045_0145169
1248 Ga0501045_0183208
1249 nmdc:mga05p37_104342_c1
1250 nmdc:mga05p37_115044_c1
1251 nmdc:mga05p37_11767_c1
1252 nmdc:mga05p37_118779_c1
1253 nmdc:mga05p37_12275_c1
1254 nmdc:mga05p37_1260_c1
1255 nmdc:mga05p37_131949_c1
1256 nmdc:mga05p37_183568_c1
1257 nmdc:mga05p37_30612_c1
1258 nmdc:mga05p37_311152_c1
1259 nmdc:mga05p37_3525_c1
1260 nmdc:mga05p37_414662_c1
1261 nmdc:mga05p37_4304_c1
1262 nmdc:mga05p37_442651_c1
1263 nmdc:mga05p37_5284_c1
1264 nmdc:mga05p37_53248_c1
1265 nmdc:mga05p37_541746_c1
1266 nmdc:mga05p37_61331_c1
1267 nmdc:mga05p37_62134_c1
1268 nmdc:mga05p37_66863_c1
1269 nmdc:mga05p37_67669_c1
1270 nmdc:mga05p37_748548_c1
1271 nmdc:mga05p37_84866_c1
1272 nmdc:mga05p37_857_c1
1273 nmdc:mga05p37_933115_c1
1274 nmdc:mga09592_148052_c1
1275 nmdc:mga09592_1634_c1
1276 nmdc:mga09592_198562_c1
1277 nmdc:mga09592_2243_c1
1278 nmdc:mga09592_246646_c1
1279 nmdc:mga09592_46682_c1
1280 nmdc:mga09592_560121_c1
1281 nmdc:mga09592_662803_c1
1282 nmdc:mga09592_67027_c1
1283 nmdc:mga09592_68174_c1
1284 nmdc:mga09592_7567_c1
1285 nmdc:mga09592_8275_c1
1286 nmdc:mga09592_9047_c1
1287 nmdc:mga0qj67_115812_c1
1288 nmdc:mga0qj67_118_c1
1289 nmdc:mga0qj67_126662_c1
1290 nmdc:mga0qj67_136463_c1
1291 nmdc:mga0qj67_19071_c1
1292 nmdc:mga0qj67_2147_c1
1293 nmdc:mga0qj67_257046_c1
1294 nmdc:mga0qj67_379101_c1
1295 nmdc:mga0qj67_74882_c1
1296 nmdc:mga06r32_106494_c1
1297 nmdc:mga06r32_122405_c1
1298 nmdc:mga06r32_1432_c1
1299 nmdc:mga06r32_148519_c1
1300 nmdc:mga06r32_403093_c1
1301 nmdc:mga06r32_43501_c1
1302 nmdc:mga06r32_45836_c1
1303 nmdc:mga06r32_485_c1
1304 nmdc:mga06r32_48941_c1
1305 nmdc:mga06r32_59859_c1
1306 nmdc:mga06r32_75296_c1
1307 nmdc:mga06r32_792502_c1
1308 nmdc:mga06r32_92174_c1
1309 nmdc:mga08y16_125323_c1
1310 nmdc:mga08y16_145954_c1
1311 nmdc:mga08y16_164589_c1
1312 nmdc:mga08y16_455755_c1
1313 nmdc:mga08y16_727_c1
1314 nmdc:mga08y16_7620_c1
1315 nmdc:mga0n895_105273_c1
1316 nmdc:mga0n895_110987_c1
1317 nmdc:mga0n895_15721_c1
1318 nmdc:mga0n895_1823_c1
1319 nmdc:mga0n895_18877_c1
1320 nmdc:mga0n895_238782_c1
1321 nmdc:mga0n895_255554_c1
1322 nmdc:mga0n895_35655_c1
1323 nmdc:mga0n895_380_c1
1324 nmdc:mga0n895_419009_c1
1325 nmdc:mga0n895_54007_c2
1326 nmdc:mga0n895_94480_c1
1327 nmdc:mga0rr50_125391_c1
1328 nmdc:mga0rr50_1303_c1
1329 nmdc:mga0rr50_153754_c1
1330 nmdc:mga0rr50_25822_c1
1331 nmdc:mga0rr50_31922_c1
1332 nmdc:mga0rr50_355471_c1
1333 nmdc:mga0rr50_357072_c1
1334 nmdc:mga0rr50_53111_c1
1335 nmdc:mga0rr50_80129_c1
1336 nmdc:mga0rr50_95313_c1
1337 nmdc:mga08x19_13744_c1
1338 nmdc:mga08x19_141996_c1
1339 nmdc:mga08x19_143015_c1
1340 nmdc:mga08x19_253550_c1
1341 nmdc:mga08x19_66127_c1
1342 nmdc:mga0a205_12967_c1
1343 nmdc:mga0a205_148748_c1
1344 nmdc:mga0a205_17796_c1
1345 nmdc:mga0a205_19087_c1
1346 nmdc:mga0a205_20583_c1
1347 nmdc:mga0a205_277093_c1
1348 nmdc:mga0a205_296743_c1
1349 nmdc:mga0a205_313703_c1
1350 nmdc:mga0a205_38923_c1
1351 nmdc:mga0a205_406766_c1
1352 nmdc:mga0a205_49764_c1
1353 nmdc:mga0a205_619379_c1
1354 nmdc:mga0a205_71964_c1
1355 nmdc:mga0a205_88097_c1
1356 nmdc:mga0a205_92518_c1
1357 Ga0501084_0011809
1358 Ga0501084_0061679
1359 Ga0501084_0106717
1360 Ga0501084_0387999
1361 Ga0590071_006043
1362 Ga0590075_012624
1363 Ga0590077_012293
1364 Ga0590077_015221
1365 Ga0501082_0010365
1366 Ga0501082_0029606
1367 Ga0501082_0146043
1368 Ga0501082_0251456
1369 Ga0530510_0000785
1370 Ga0530510_0003255
1371 Ga0530510_0013074
1372 Ga0530510_0363393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

101

205

0.91

PF02790

COX2_TM

Cytochrome C oxidase subunit II, transmembrane domain

2

85

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.9231 79 184
6pty-assembly2.cif.gz_B soluble model of human cua (tt3lh) 0.8902 79 183
1cyw-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii) (cyoa) 0.8878 78 195
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.8873 79 184
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.8866 78 195
ID Description Score Start End Superfamily
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9217 79 184 2.60.40.420
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8946 74 194 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8812 72 195 2.60.40.420
af_A0A2P2CLF0_113_253_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8768 75 197 2.60.40.420
af_P0ABJ1_113_282_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.875 72 195 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A535J8V9-F1-model_v4 C-type cytochrome 0.9224 80 196 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042773
AF-A0A382ZLR2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9196 78 202 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A7C2EVG6-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9147 74 188 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A3C1R1R4-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9087 72 199 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A2S5GK22-F1-model_v4 Cytochrome c oxidase subunit II 0.9064 74 197 GO:0004129
GO:0005507
GO:0016020
GO:0020037
GO:0042597
GO:0042773

Map