F475200

General Info

Members Datasets Scaffolds Average Seq Length
686 372 1372 398

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0006058|Ga0466961_0006058_3150_4472
Length 440
Sequence MVWTRRGASRRDRAVRCPEPGAPGLAGHPPADARRRPEPWECPMQLIESILADAASIAALRRDIHQHPELCFEERRTADLIAKALTDWGIPVHRGLGTTGVVGIVKNGSSNRAVGLRADIDALPITETNRFPHASVHAGKMHACGHDGHTAMLLAAAKHLARHRNFDGTVYLVFQPAEEGGGGAREMIKDGLFDRFPMEAIFGAHNWPGLKVGQFAVKTGPVFASSNEFKITIRGKGAHGAMPHLGIDPVPVACQMVQAFQSIISRNKRPIDTGVISVTMIHAGEATNVIPEACVLEGTVRTFTTEVLDMIEQRMKTVAEATCAAFEAQCEFEFDRNYPPTVNHDAETRFVERVLGEVVGRENVIEFEPTMGAEDFSYFLQARPGCYFLIGNGDGAHRHGGHGLGPCMLHNPSYDFNDDLIPLGATAWVRLAEAWLAQPR

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
97 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
165 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
166 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
188 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
270 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
293 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
294 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
304 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
305 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
306 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
307 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
308 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
309 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
312 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
313 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
314 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
315 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
316 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
317 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
318 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
319 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
324 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
325 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
326 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
327 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
328 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
329 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
330 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
331 2643221594 Achromobacter sp. Root170 Isolate Unclassified
332 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
333 2643221660 Methylibium sp. Root1272 Isolate Unclassified
334 2643221672 Variovorax sp. Root434 Isolate Unclassified
335 2643221683 Variovorax sp. Root473 Isolate Unclassified
336 2643221733 Bosea sp. Root381 Isolate Unclassified
337 2643221734 Bosea sp. Root670 Isolate Unclassified
338 2738541277 Variovorax sp. GV051 Isolate Unclassified
339 2738543019 Variovorax sp. GV040 Isolate Unclassified
340 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
341 2818991446 Variovorax sp. 1180 Isolate Unclassified
342 2818991467 Bosea vestrisii 3192 Isolate Unclassified
343 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
344 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
345 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
346 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
347 2842677519 Variovorax sp. R-72495 Isolate Unclassified
348 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
349 2885198086 Variovorax sp. 679 Isolate Unclassified
350 2885211737 Variovorax sp. 553 Isolate Unclassified
351 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
352 2899924645 Variovorax sp. 369 Isolate Unclassified
353 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
354 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
355 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
356 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
357 2928037797 Variovorax sp. 1126 Isolate Unclassified
358 2928044640 Variovorax sp. 1128 Isolate Unclassified
359 2928051484 Variovorax sp. 1133 Isolate Unclassified
360 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
361 2928070936 Variovorax gossypii 1167 Isolate Unclassified
362 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
363 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
364 2929520902 Variovorax beijingensis 502 Isolate Unclassified
365 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
366 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
367 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
368 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
369 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
370 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
371 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
372 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.42
Metatranscriptomes 0.15
Isolates 7.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 28.72
Nodule 1.46
Rhizoplane 3.06
Rhizosphere 52.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0006058 3300044693 Bacteria 7666
2 SwRhRL2b_contig_1715871 2162886007 Bacteria 17946
3 JGI25156J39149_1000283 3300002705 Bacteria 34253
4 JGI25156J39149_1006728 3300002705 Bacteria 3101
5 JGI25154J39366_1000252 3300002738 Bacteria 34253
6 JGI25154J39366_1000261 3300002738 Bacteria 33723
7 JGI25158J39367_1001524 3300002739 Bacteria 4033
8 JGI25157J39369_1000319 3300002741 Bacteria 34439
9 JGI25152J39213_1000174 3300002773 Bacteria 43598
10 JGI25150J39212_1000584 3300002774 Bacteria 14401
11 JGI25150J39212_1001325 3300002774 Bacteria 7044
12 JGI25150J39212_1003346 3300002774 Bacteria 3768
13 JGI25150J39212_1005005 3300002774 Bacteria 2873
14 JGI25150J39212_1005550 3300002774 Bacteria 2683
15 JGI25159J45721_1000882 3300002987 Bacteria 13046
16 JGI25159J45721_1002895 3300002987 Bacteria 6269
17 JGI25159J45721_1004954 3300002987 Bacteria 4268
18 JGI25159J45721_1008748 3300002987 Bacteria 2748
19 JGI25159J45721_1015228 3300002987 Bacteria 1696
20 JGI25151J46595_10000051 3300003187 Bacteria 160361
21 JGI25151J46595_10003683 3300003187 Bacteria 8343
22 JGI25151J46595_10012852 3300003187 Bacteria 3791
23 JGI26128J50194_1000974 3300003347 Bacteria 1748
24 JGI25160J50197_1000158 3300003354 Bacteria 58363
25 JGI25160J50197_1001879 3300003354 Bacteria 10079
26 JGI25161J50226_1000040 3300003374 Bacteria 124804
27 JGI25161J50226_1001065 3300003374 Bacteria 9328
28 JGI25161J50226_1002128 3300003374 Bacteria 5322
29 JGI25161J50226_1004840 3300003374 Bacteria 2748
30 Ga0055539_1000125 3300003752 Bacteria 81835
31 Ga0055533_1000132 3300003756 Bacteria 81835
32 Ga0055532_1000136 3300003758 Bacteria 72117
33 Ga0055525_1000171 3300003759 Bacteria 81835
34 Ga0055535_1000067 3300003761 Bacteria 115376
35 Ga0055542_1000013 3300003762 Bacteria 387560
36 Ga0055529_1000669 3300003763 Bacteria 24011
37 Ga0055526_1000378 3300003771 Bacteria 36064
38 Ga0055526_1001010 3300003771 Bacteria 20663
39 Ga0055526_1002896 3300003771 Bacteria 11308
40 Ga0055526_1009235 3300003771 Bacteria 4783
41 Ga0055537_1000892 3300003773 Bacteria 14136
42 Ga0055537_1002287 3300003773 Bacteria 6561
43 Ga0055524_1000077 3300003775 Bacteria 121584
44 Ga0055524_1000294 3300003775 Bacteria 48038
45 Ga0055524_1000394 3300003775 Bacteria 37595
46 Ga0055524_1000723 3300003775 Bacteria 22629
47 Ga0055524_1003277 3300003775 Bacteria 7923
48 Ga0055524_1004757 3300003775 Bacteria 6200
49 Ga0055524_1012042 3300003775 Bacteria 3342
50 Ga0055536_1002480 3300003781 Bacteria 10355
51 Ga0055534_1001512 3300003784 Bacteria 9128
52 Ga0055534_1002538 3300003784 Bacteria 6266
53 Ga0055534_1003011 3300003784 Bacteria 5540
54 Ga0055534_1005238 3300003784 Bacteria 3527
55 Ga0055534_1006557 3300003784 Bacteria 2912
56 Ga0055534_1007029 3300003784 Bacteria 2746
57 Ga0055528_1002142 3300003790 Bacteria 10858
58 Ga0055528_1017317 3300003790 Bacteria 2504
59 Ga0055530_10000963 3300003791 Bacteria 23351
60 Ga0055530_10002603 3300003791 Bacteria 11377
61 Ga0055530_10002897 3300003791 Bacteria 10424
62 Ga0055540_1000010 3300003792 Bacteria 290865
63 Ga0055540_1000028 3300003792 Bacteria 184864
64 Ga0055531_10002158 3300003794 Bacteria 13446
65 Ga0055531_10003148 3300003794 Bacteria 10624
66 Ga0055531_10003289 3300003794 Bacteria 10355
67 Ga0055541_1000083 3300003841 Bacteria 81835
68 Ga0055543_1001322 3300004625 Bacteria 10136
69 Ga0055543_1002352 3300004625 Bacteria 6323
70 Ga0055543_1005190 3300004625 Bacteria 3371
71 Ga0065165_1004112 3300005262 Bacteria 9366
72 Ga0065165_1004142 3300005262 Bacteria 9305
73 Ga0065165_1017038 3300005262 Bacteria 2693
74 Ga0065707_10085963 3300005295 Bacteria 5758
75 Ga0070670_100139348 3300005331 Bacteria 2097
76 Ga0070670_100200028 3300005331 Bacteria 1736
77 Ga0070661_100011007 3300005344 Bacteria 6304
78 Ga0070661_100139710 3300005344 Bacteria 1825
79 Ga0070668_100018973 3300005347 Bacteria 5168
80 Ga0070669_100000081 3300005353 Bacteria 91877
81 Ga0070669_100017033 3300005353 Bacteria 5187
82 Ga0070671_100076840 3300005355 Bacteria 2790
83 Ga0070659_100001902 3300005366 Bacteria 14939
84 Ga0070659_100058772 3300005366 Bacteria 3036
85 Ga0070667_100012556 3300005367 Bacteria 7006
86 Ga0070711_100227882 3300005439 Bacteria 1452
87 Ga0070663_100120656 3300005455 Bacteria 1980
88 Ga0070678_100008125 3300005456 Bacteria 6270
89 Ga0070662_100002322 3300005457 Bacteria 11686
90 Ga0070662_100125143 3300005457 Bacteria 1975
91 Ga0068867_100005330 3300005459 Bacteria 9088
92 Ga0068853_100020634 3300005539 Bacteria 5479
93 Ga0068853_100053357 3300005539 Bacteria 3482
94 Ga0070672_100033107 3300005543 Bacteria 3911
95 Ga0070665_100001852 3300005548 Bacteria 24030
96 Ga0070665_100005848 3300005548 Bacteria 12615
97 Ga0070664_100001882 3300005564 Bacteria 16842
98 Ga0070664_100005404 3300005564 Bacteria 10256
99 Ga0070664_100051041 3300005564 Bacteria 3502
100 Ga0068857_100087942 3300005577 Bacteria 2779
101 Ga0068854_100033008 3300005578 Bacteria 3606
102 Ga0068854_100051829 3300005578 Bacteria 2941
103 Ga0068856_100120657 3300005614 Bacteria 2623
104 Ga0068852_100020918 3300005616 Bacteria 5210
105 Ga0068852_100069274 3300005616 Bacteria 3091
106 Ga0068859_100090415 3300005617 Bacteria 3112
107 Ga0068864_100178703 3300005618 Bacteria 1939
108 Ga0068866_10047559 3300005718 Bacteria 2164
109 Ga0068858_100075601 3300005842 Bacteria 3129
110 Ga0068860_100002168 3300005843 Bacteria 20685
111 Ga0068860_100078506 3300005843 Bacteria 3139
112 Ga0068860_100117381 3300005843 Bacteria 2546
113 Ga0068862_100002584 3300005844 Bacteria 15989
114 Ga0068862_100037921 3300005844 Bacteria 4086
115 Ga0075364_10014010 3300006051 Bacteria 4944
116 Ga0075366_10005044 3300006195 Bacteria 7135
117 Ga0097621_100075214 3300006237 Bacteria 2799
118 Ga0075370_10000877 3300006353 Bacteria 12273
119 Ga0075370_10000919 3300006353 Bacteria 12094
120 Ga0075370_10007180 3300006353 Bacteria 5660
121 Ga0068871_100025580 3300006358 Bacteria 4595
122 Ga0097620_100090423 3300006931 Bacteria 3112
123 Ga0079104_1000194 3300006946 Bacteria 85426
124 Ga0079104_1002709 3300006946 Bacteria 9095
125 Ga0099826_10000057 3300006948 Bacteria 66174
126 Ga0099795_10000816 3300007788 Bacteria 6164
127 Ga0105251_10041692 3300009011 Bacteria 2233
128 Ga0105244_10014853 3300009036 Bacteria 4485
129 Ga0105250_10007603 3300009092 Bacteria 4645
130 Ga0105240_10001823 3300009093 Bacteria 35764
131 Ga0105240_10004767 3300009093 Bacteria 20470
132 Ga0105240_10013542 3300009093 Bacteria 11194
133 Ga0105240_10113347 3300009093 Bacteria 3277
134 Ga0105245_10202807 3300009098 Bacteria 1905
135 Ga0114129_10083224 3300009147 Bacteria 4446
136 Ga0105243_10002576 3300009148 Bacteria 15141
137 Ga0105243_10097597 3300009148 Bacteria 2432
138 Ga0105242_10075403 3300009176 Bacteria 2808
139 Ga0105248_10002938 3300009177 Bacteria 18914
140 Ga0105248_10185143 3300009177 Bacteria 2347
141 Ga0105237_10012437 3300009545 Bacteria 8969
142 Ga0105237_10026284 3300009545 Bacteria 5950
143 Ga0105237_10087658 3300009545 Bacteria 3102
144 Ga0105237_10194772 3300009545 Bacteria 2026
145 Ga0105238_10002244 3300009551 Bacteria 19505
146 Ga0105238_10003500 3300009551 Bacteria 15631
147 Ga0099796_10007875 3300010159 Bacteria 2809
148 Ga0105239_10000954 3300010375 Bacteria 40769
149 Ga0157347_1000469 3300012502 Bacteria 2643
150 Ga0157370_10016616 3300013104 Bacteria 7446
151 Ga0157369_10052318 3300013105 Bacteria 4419
152 Ga0163162_10017199 3300013306 Bacteria 7075
153 Ga0157372_10024904 3300013307 Bacteria 6504
154 Ga0182008_10001152 3300014497 Bacteria 18239
155 Ga0182008_10002962 3300014497 Bacteria 10449
156 Ga0182008_10007562 3300014497 Bacteria 5992
157 Ga0157379_10041978 3300014968 Bacteria 4082
158 Ga0157376_10253393 3300014969 Bacteria 1645
159 Ga0182006_1000010 3300015261 Bacteria 413414
160 Ga0182006_1001273 3300015261 Bacteria 15541
161 Ga0182006_1002706 3300015261 Bacteria 9511
162 Ga0182006_1015341 3300015261 Bacteria 3285
163 Ga0182007_10000021 3300015262 Bacteria 193408
164 Ga0182007_10000443 3300015262 Bacteria 25091
165 Ga0182007_10005868 3300015262 Bacteria 5335
166 Ga0182005_1000009 3300015265 Bacteria 455334
167 Ga0163161_10000304 3300017792 Bacteria 42860
168 Ga0163161_10005646 3300017792 Bacteria 8676
169 Ga0163161_10056169 3300017792 Bacteria 2859
170 Ga0206353_10748616 3300020082 Bacteria 1605
171 Ga0213872_10000031 3300021361 Bacteria 139321
172 Ga0213872_10000561 3300021361 Bacteria 28726
173 Ga0213872_10000643 3300021361 Bacteria 26412
174 Ga0213872_10003753 3300021361 Bacteria 8292
175 Ga0209435_100018 3300025206 Bacteria 274625
176 Ga0209435_100106 3300025206 Bacteria 32841
177 Ga0209436_100171 3300025208 Bacteria 31081
178 Ga0209436_100435 3300025208 Bacteria 18694
179 Ga0209784_100009 3300025224 Bacteria 688031
180 Ga0209566_100007 3300025225 Bacteria 688031
181 Ga0209674_100018 3300025226 Bacteria 688031
182 Ga0209672_102789 3300025228 Bacteria 4000
183 Ga0209147_100051 3300025229 Bacteria 274605
184 Ga0209147_100437 3300025229 Bacteria 26659
185 Ga0209563_100020 3300025230 Bacteria 688031
186 Ga0209437_100611 3300025233 Bacteria 21911
187 Ga0209258_100020 3300025242 Bacteria 565241
188 Ga0209258_100324 3300025242 Bacteria 72141
189 Ga0207425_1000006 3300025245 Bacteria 808854
190 Ga0207425_1000201 3300025245 Bacteria 47830
191 Ga0207425_1000354 3300025245 Bacteria 31834
192 Ga0207425_1003415 3300025245 Bacteria 5090
193 Ga0207425_1003871 3300025245 Bacteria 4648
194 Ga0209646_1000172 3300025246 Bacteria 84840
195 Ga0209646_1000186 3300025246 Bacteria 77615
196 Ga0209026_1000042 3300025250 Bacteria 273111
197 Ga0209026_1001244 3300025250 Bacteria 11663
198 Ga0209677_100010 3300025253 Bacteria 688031
199 Ga0209148_1000031 3300025254 Bacteria 564601
200 Ga0209759_1000273 3300025256 Bacteria 73308
201 Ga0209759_1000765 3300025256 Bacteria 27365
202 Ga0209129_1000009 3300025258 Bacteria 633100
203 Ga0209129_1000055 3300025258 Bacteria 261708
204 Ga0209129_1004556 3300025258 Bacteria 5345
205 Ga0209565_1000036 3300025263 Bacteria 293334
206 Ga0209565_1000226 3300025263 Bacteria 63161
207 Ga0209565_1000459 3300025263 Bacteria 31365
208 Ga0209565_1000488 3300025263 Bacteria 29101
209 Ga0209565_1000795 3300025263 Bacteria 18204
210 Ga0209565_1010203 3300025263 Bacteria 2339
211 Ga0209455_1000345 3300025272 Bacteria 43825
212 Ga0209673_1000282 3300025273 Bacteria 95013
213 Ga0209673_1001892 3300025273 Bacteria 16807
214 Ga0209673_1017751 3300025273 Bacteria 2614
215 Ga0209130_1000042 3300025284 Bacteria 257581
216 Ga0209130_1000214 3300025284 Bacteria 76202
217 Ga0209130_1000255 3300025284 Bacteria 67166
218 Ga0209130_1000493 3300025284 Bacteria 40544
219 Ga0209130_1001371 3300025284 Bacteria 16431
220 Ga0209130_1002656 3300025284 Bacteria 8541
221 Ga0209130_1003075 3300025284 Bacteria 7466
222 Ga0209675_1000106 3300025291 Bacteria 120459
223 Ga0209675_1000876 3300025291 Bacteria 19395
224 Ga0209675_1001043 3300025291 Bacteria 17247
225 Ga0209675_1001953 3300025291 Bacteria 11125
226 Ga0209675_1003028 3300025291 Bacteria 8249
227 Ga0209675_1007045 3300025291 Bacteria 4383
228 Ga0209676_1000007 3300025292 Bacteria 1029371
229 Ga0209676_1000346 3300025292 Bacteria 87684
230 Ga0209676_1000508 3300025292 Bacteria 61404
231 Ga0209676_1028193 3300025292 Bacteria 1753
232 Ga0209025_1000017 3300025294 Bacteria 768983
233 Ga0209025_1000027 3300025294 Bacteria 505882
234 Ga0209025_1000145 3300025294 Bacteria 181436
235 Ga0209025_1000510 3300025294 Bacteria 74231
236 Ga0209025_1005886 3300025294 Bacteria 9802
237 Ga0209025_1009929 3300025294 Bacteria 6540
238 Ga0209025_1038322 3300025294 Bacteria 2110
239 Ga0209025_1042043 3300025294 Bacteria 1948
240 Ga0209564_1000054 3300025295 Bacteria 350653
241 Ga0209564_1000098 3300025295 Bacteria 228906
242 Ga0209564_1000177 3300025295 Bacteria 152313
243 Ga0209564_1000254 3300025295 Bacteria 113032
244 Ga0209564_1000410 3300025295 Bacteria 76208
245 Ga0209564_1001702 3300025295 Bacteria 20812
246 Ga0209564_1001743 3300025295 Bacteria 20401
247 Ga0209564_1022586 3300025295 Bacteria 2217
248 Ga0209758_1000042 3300025297 Bacteria 407145
249 Ga0209758_1000071 3300025297 Bacteria 283749
250 Ga0209758_1019144 3300025297 Bacteria 3317
251 Ga0209758_1020986 3300025297 Bacteria 3064
252 Ga0209050_1000003 3300025298 Bacteria 1609245
253 Ga0209050_1000183 3300025298 Bacteria 142357
254 Ga0209050_1001372 3300025298 Bacteria 26579
255 Ga0209050_1001781 3300025298 Bacteria 21203
256 Ga0209050_1002607 3300025298 Bacteria 14930
257 Ga0209050_1003521 3300025298 Bacteria 11441
258 Ga0209050_1020043 3300025298 Bacteria 2507
259 Ga0209256_1000001 3300025299 Bacteria 2166974
260 Ga0209256_1000013 3300025299 Bacteria 689442
261 Ga0209256_1000015 3300025299 Bacteria 622953
262 Ga0209256_1000032 3300025299 Bacteria 395041
263 Ga0209256_1000056 3300025299 Bacteria 283044
264 Ga0209256_1000148 3300025299 Bacteria 147639
265 Ga0209256_1000330 3300025299 Bacteria 79958
266 Ga0209256_1000498 3300025299 Bacteria 57607
267 Ga0209256_1001642 3300025299 Bacteria 21763
268 Ga0209256_1008619 3300025299 Bacteria 4678
269 Ga0207426_1000055 3300025302 Bacteria 374450
270 Ga0207426_1000079 3300025302 Bacteria 314709
271 Ga0207426_1000097 3300025302 Bacteria 265930
272 Ga0207426_1001049 3300025302 Bacteria 26249
273 Ga0209051_1000003 3300025303 Bacteria 1609245
274 Ga0209051_1000022 3300025303 Bacteria 474879
275 Ga0209051_1000126 3300025303 Bacteria 142582
276 Ga0209051_1000358 3300025303 Bacteria 67255
277 Ga0209257_1000010 3300025304 Bacteria 1158682
278 Ga0209257_1000020 3300025304 Bacteria 773356
279 Ga0209257_1000030 3300025304 Bacteria 689812
280 Ga0209257_1000214 3300025304 Bacteria 136547
281 Ga0209257_1033335 3300025304 Bacteria 1620
282 Ga0207656_10012292 3300025321 Bacteria 3253
283 Ga0207696_1003048 3300025711 Bacteria 7822
284 Ga0207655_1003314 3300025728 Bacteria 12068
285 Ga0207713_1007308 3300025735 Bacteria 6543
286 Ga0207688_10033400 3300025901 Bacteria 2846
287 Ga0207705_10194538 3300025909 Bacteria 1535
288 Ga0207695_10000564 3300025913 Bacteria 75954
289 Ga0207695_10001901 3300025913 Bacteria 32585
290 Ga0207695_10017142 3300025913 Bacteria 8443
291 Ga0207695_10024057 3300025913 Bacteria 6865
292 Ga0207695_10115296 3300025913 Bacteria 2661
293 Ga0207652_10252431 3300025921 Bacteria 1591
294 Ga0207681_10000620 3300025923 Bacteria 23726
295 Ga0207681_10036722 3300025923 Bacteria 3234
296 Ga0207681_10115092 3300025923 Bacteria 1963
297 Ga0207694_10000736 3300025924 Bacteria 29425
298 Ga0207694_10009874 3300025924 Bacteria 7204
299 Ga0207690_10001730 3300025932 Bacteria 13418
300 Ga0207706_10003912 3300025933 Bacteria 14137
301 Ga0207709_10000808 3300025935 Bacteria 24310
302 Ga0207709_10003613 3300025935 Bacteria 9142
303 Ga0207704_10024064 3300025938 Bacteria 3295
304 Ga0207711_10015630 3300025941 Bacteria 6296
305 Ga0207711_10119995 3300025941 Bacteria 2347
306 Ga0207679_10000587 3300025945 Bacteria 24340
307 Ga0207679_10025234 3300025945 Bacteria 4085
308 Ga0207679_10038155 3300025945 Bacteria 3421
309 Ga0207667_10024840 3300025949 Bacteria 6571
310 Ga0207667_10344873 3300025949 Bacteria 1519
311 Ga0207668_10001115 3300025972 Bacteria 15994
312 Ga0207668_10003493 3300025972 Bacteria 9228
313 Ga0207658_10002807 3300025986 Bacteria 12523
314 Ga0207658_10138711 3300025986 Bacteria 1965
315 Ga0207703_10097209 3300026035 Bacteria 2488
316 Ga0207639_10010659 3300026041 Bacteria 6365
317 Ga0207678_10169637 3300026067 Bacteria 1863
318 Ga0207702_10093063 3300026078 Bacteria 2643
319 Ga0207648_10000133 3300026089 Bacteria 73580
320 Ga0207675_100002269 3300026118 Bacteria 19116
321 Ga0207683_10102809 3300026121 Bacteria 2552
322 Ga0207698_10091380 3300026142 Bacteria 2492
323 Ga0207698_10113732 3300026142 Bacteria 2275
324 Ga0207698_10348906 3300026142 Bacteria 1397
325 Ga0209281_1000083 3300027111 Bacteria 255034
326 Ga0209281_1002597 3300027111 Bacteria 6983
327 Ga0209996_1001357 3300027395 Bacteria 2929
328 Ga0209968_1000055 3300027526 Bacteria 20254
329 Ga0209970_1002958 3300027614 Bacteria 2864
330 Ga0209282_1000087 3300027666 Bacteria 66192
331 Ga0209966_1000136 3300027695 Bacteria 30875
332 Ga0268266_10002768 3300028379 Bacteria 18322
333 Ga0268266_10007697 3300028379 Bacteria 9673
334 Ga0268265_10029375 3300028380 Bacteria 3945
335 Ga0268265_10158042 3300028380 Bacteria 1921
336 Ga0268265_10226596 3300028380 Bacteria 1639
337 Ga0268264_10008150 3300028381 Bacteria 8709
338 Ga0268264_10073620 3300028381 Bacteria 2900
339 Ga0307512_10101233 3300030522 Bacteria 1950
340 Ga0316177_1015726 3300030731 Bacteria 6132
341 Ga0314311_1002227 3300030733 Bacteria 2049
342 Ga0316178_1072432 3300030735 Bacteria 1712
343 Ga0307513_10000011 3300031456 Bacteria 354929
344 Ga0307513_10020065 3300031456 Bacteria 7936
345 Ga0307408_100001673 3300031548 Bacteria 16326
346 Ga0307408_100002531 3300031548 Bacteria 12786
347 Ga0307408_100005828 3300031548 Bacteria 8194
348 Ga0307408_100017174 3300031548 Bacteria 4841
349 Ga0307408_100020243 3300031548 Bacteria 4488
350 Ga0307514_10001392 3300031649 Bacteria 30115
351 Ga0307514_10028862 3300031649 Bacteria 4470
352 Ga0307516_10000236 3300031730 Bacteria 71013
353 Ga0307516_10172918 3300031730 Bacteria 1899
354 Ga0307405_10090092 3300031731 Bacteria 2028
355 Ga0307416_100054694 3300032002 Bacteria 3209
356 Ga0307414_10045879 3300032004 Bacteria 2995
357 Ga0307414_10244881 3300032004 Bacteria 1486
358 Ga0307411_10098104 3300032005 Bacteria 2064
359 Ga0373927_0009919 3300035695 Bacteria 6384
360 Ga0373925_0007332 3300037068 Bacteria 8052
361 Ga0395899_0001398 3300037312 Bacteria 20679
362 Ga0395900_0000183 3300037418 Bacteria 100749
363 Ga0395900_0024399 3300037418 Bacteria 6193
364 Ga0395900_0133230 3300037418 Bacteria 2546
365 Ga0395898_0001293 3300037466 Bacteria 36684
366 Ga0395905_0000544 3300037471 Bacteria 51411
367 Ga0395905_0009714 3300037471 Bacteria 9387
368 Ga0395905_0016905 3300037471 Bacteria 6930
369 Ga0395905_0329225 3300037471 Bacteria 1418
370 Ga0395901_0033688 3300038443 Bacteria 5289
371 Ga0436361_0223353 3300039447 Bacteria 23910
372 Ga0436361_0287785 3300039447 Bacteria 9327
373 Ga0436361_0314120 3300039447 Bacteria 27131
374 Ga0436361_0683159 3300039447 Bacteria 2923
375 Ga0436361_0913791 3300039447 Bacteria 99691
376 Ga0439465_0004902 3300041413 Bacteria 4302
377 Ga0439442_004344 3300042002 Bacteria 2812
378 Ga0439449_0001042 3300042007 Bacteria 10918
379 Ga0439457_011471 3300042014 Bacteria 2016
380 Ga0450906_000679 3300042145 Bacteria 7285
381 Ga0450907_006037 3300042146 Bacteria 2032
382 Ga0450908_001090 3300042184 Bacteria 5271
383 Ga0439434_0000981 3300042435 Bacteria 8230
384 Ga0451577_0031266 3300042876 Bacteria 4804
385 Ga0451577_0032857 3300042876 Bacteria 4677
386 Ga0451577_0090871 3300042876 Bacteria 2725
387 Ga0451577_0136064 3300042876 Bacteria 2206
388 Ga0451577_0142773 3300042876 Bacteria 2152
389 Ga0451577_0149093 3300042876 Bacteria 2104
390 Ga0451577_0341806 3300042876 Bacteria 1357
391 Ga0466969_0000020 3300044656 Bacteria 101861
392 Ga0466972_0000594 3300044658 Bacteria 17607
393 Ga0466972_0003601 3300044658 Bacteria 7700
394 Ga0466966_0024759 3300044684 Bacteria 3926
395 Ga0466961_0045638 3300044693 Bacteria 2803
396 Ga0453684_0076853 3300044712 Bacteria 4189
397 Ga0453684_0118632 3300044712 Bacteria 3200
398 Ga0466971_0047891 3300044719 Bacteria 1921
399 Ga0466970_0017380 3300044765 Bacteria 3717
400 Ga0466957_0009426 3300044842 Bacteria 5575
401 Ga0466957_0063909 3300044842 Bacteria 2263
402 Ga0466959_0000210 3300045049 Bacteria 37745
403 Ga0466959_0027190 3300045049 Bacteria 4243
404 Ga0466959_0087364 3300045049 Bacteria 2243
405 Ga0451576_0001676 3300045051 Bacteria 36735
406 Ga0451576_0004667 3300045051 Bacteria 17660
407 Ga0451576_0289200 3300045051 Bacteria 1713
408 Ga0495617_000700 3300046452 Bacteria 16719
409 Ga0495603_0061901 3300046455 Bacteria 2210
410 Ga0495650_0003613 3300046471 Bacteria 11145
411 Ga0495605_0009463 3300046474 Bacteria 5475
412 Ga0495584_0000116 3300046491 Bacteria 54741
413 Ga0495584_0000670 3300046491 Bacteria 22757
414 Ga0495584_0005762 3300046491 Bacteria 6535
415 Ga0495584_0006923 3300046491 Bacteria 5925
416 Ga0495584_0035646 3300046491 Bacteria 2514
417 Ga0495585_0000186 3300046492 Bacteria 66357
418 Ga0495585_0000433 3300046492 Bacteria 40083
419 Ga0495585_0003928 3300046492 Bacteria 9834
420 Ga0495585_0032358 3300046492 Bacteria 2963
421 Ga0495585_0123292 3300046492 Bacteria 1369
422 Ga0495594_0004377 3300046499 Bacteria 7266
423 Ga0495596_0000775 3300046500 Bacteria 19480
424 Ga0495596_0001012 3300046500 Bacteria 16730
425 Ga0495596_0003535 3300046500 Bacteria 7875
426 Ga0495607_0122200 3300046501 Bacteria 1365
427 Ga0495606_0003426 3300046507 Bacteria 16832
428 Ga0495606_0003557 3300046507 Bacteria 16446
429 Ga0495606_0005928 3300046507 Bacteria 11479
430 Ga0495616_0001219 3300046513 Bacteria 18122
431 Ga0495616_0001425 3300046513 Bacteria 16636
432 Ga0495616_0010130 3300046513 Bacteria 5470
433 Ga0495616_0010703 3300046513 Bacteria 5294
434 Ga0495620_0007314 3300046515 Bacteria 6010
435 Ga0495630_0029037 3300046517 Bacteria 4111
436 Ga0495631_0000096 3300046518 Bacteria 58530
437 Ga0495631_0002784 3300046518 Bacteria 9698
438 Ga0495637_0010529 3300046520 Bacteria 4469
439 Ga0495643_0016003 3300046522 Bacteria 4415
440 Ga0495643_0064102 3300046522 Bacteria 1942
441 Ga0495644_0014253 3300046523 Bacteria 3046
442 Ga0495648_0001005 3300046524 Bacteria 28846
443 Ga0495648_0005201 3300046524 Bacteria 10885
444 Ga0495648_0023484 3300046524 Bacteria 4222
445 Ga0495648_0039731 3300046524 Bacteria 2991
446 Ga0495663_0014510 3300046525 Bacteria 2209
447 Ga0495666_0010042 3300046526 Bacteria 4725
448 Ga0495642_0006506 3300046528 Bacteria 4481
449 Ga0495654_0009804 3300046530 Bacteria 5235
450 Ga0495654_0020019 3300046530 Bacteria 3494
451 Ga0495665_0016384 3300046531 Bacteria 3994
452 Ga0495586_0003334 3300046535 Bacteria 8613
453 Ga0495587_0055599 3300046536 Bacteria 2330
454 Ga0495609_0002156 3300046538 Bacteria 12370
455 Ga0495621_0001408 3300046539 Bacteria 6230
456 Ga0495597_0022161 3300046542 Bacteria 2949
457 Ga0495622_0008301 3300046557 Bacteria 4810
458 Ga0495622_0091394 3300046557 Bacteria 1398
459 Ga0495633_0005259 3300046558 Bacteria 7973
460 Ga0495633_0007099 3300046558 Bacteria 6509
461 Ga0495633_0012973 3300046558 Bacteria 4409
462 Ga0495633_0028365 3300046558 Bacteria 2728
463 Ga0495633_0037893 3300046558 Bacteria 2305
464 Ga0495667_0021451 3300046559 Bacteria 4359
465 Ga0495656_0020547 3300046615 Bacteria 2563
466 Ga0495668_0004688 3300046616 Bacteria 9597
467 Ga0495668_0011903 3300046616 Bacteria 5182
468 Ga0495668_0024258 3300046616 Bacteria 3451
469 Ga0495611_0018718 3300046648 Bacteria 2971
470 Ga0495611_0056758 3300046648 Bacteria 1773
471 Ga0495625_0000085 3300046660 Bacteria 151877
472 Ga0495625_0000136 3300046660 Bacteria 114576
473 Ga0495625_0001669 3300046660 Bacteria 25981
474 Ga0495625_0032391 3300046660 Bacteria 3875
475 Ga0495625_0038416 3300046660 Bacteria 3505
476 Ga0495661_0013032 3300046665 Bacteria 5599
477 Ga0495661_0074838 3300046665 Bacteria 1969
478 Ga0495623_0054571 3300046679 Bacteria 2520
479 Ga0495646_0031608 3300046680 Bacteria 3298
480 Ga0495669_0000571 3300046684 Bacteria 16323
481 Ga0495624_0070658 3300046690 Bacteria 2173
482 Ga0495670_0013170 3300046691 Bacteria 4067
483 Ga0495670_0079849 3300046691 Bacteria 1665
484 Ga0495671_0007334 3300046692 Bacteria 6295
485 Ga0495671_0052450 3300046692 Bacteria 2027
486 Ga0495589_0008756 3300046794 Bacteria 5267
487 Ga0495589_0105179 3300046794 Bacteria 1364
488 Ga0495600_0013824 3300046809 Bacteria 5083
489 Ga0495581_0019648 3300047315 Bacteria 3921
490 Ga0495604_0037349 3300047317 Bacteria 3825
491 Ga0495604_0131814 3300047317 Bacteria 1795
492 Ga0495672_0000014 3300047320 Bacteria 505636
493 Ga0495672_0018828 3300047320 Bacteria 4573
494 Ga0495676_0122221 3300047321 Bacteria 1892
495 Ga0495683_0000112 3300047323 Bacteria 82903
496 Ga0495683_0005323 3300047323 Bacteria 7150
497 Ga0495687_028240 3300047443 Bacteria 2612
498 Ga0495677_0002013 3300047445 Bacteria 8114
499 Ga0495677_0031094 3300047445 Bacteria 1943
500 Ga0495673_0018896 3300047469 Bacteria 3465
501 Ga0495593_0009381 3300047673 Bacteria 5679
502 Ga0495593_0021901 3300047673 Bacteria 3565
503 Ga0495602_0050597 3300048088 Bacteria 3711
504 Ga0495626_0012603 3300048091 Bacteria 4423
505 Ga0495626_0050028 3300048091 Bacteria 1932
506 Ga0496100_0109380 3300048903 Bacteria 1917
507 Ga0496101_0279508 3300048904 Bacteria 1304
508 Ga0496102_0000141 3300048905 Bacteria 97499
509 Ga0496103_0000172 3300048906 Bacteria 67575
510 Ga0496104_0000114 3300048907 Bacteria 75253
511 Ga0496104_0034544 3300048907 Bacteria 4716
512 Ga0496104_0160430 3300048907 Bacteria 2157
513 Ga0496105_0000073 3300048908 Bacteria 76800
514 Ga0496105_0058039 3300048908 Bacteria 3195
515 Ga0496108_0026169 3300048911 Bacteria 4812
516 Ga0496109_0032888 3300048912 Bacteria 4665
517 Ga0496111_0070562 3300048914 Bacteria 2541
518 Ga0496112_0167333 3300048915 Bacteria 2164
519 Ga0496113_0006082 3300048916 Bacteria 7609
520 Ga0496114_0002834 3300048917 Bacteria 13293
521 Ga0496114_0029422 3300048917 Bacteria 4515
522 Ga0496114_0092669 3300048917 Bacteria 2567
523 Ga0496115_0121181 3300048918 Bacteria 2152
524 Ga0496116_0014455 3300048919 Bacteria 6302
525 Ga0496116_0027604 3300048919 Bacteria 4130
526 Ga0496117_0000010 3300048920 Bacteria 611954
527 Ga0496117_0005386 3300048920 Bacteria 13473
528 Ga0496117_0007249 3300048920 Bacteria 10901
529 Ga0496117_0010975 3300048920 Bacteria 8163
530 Ga0496117_0105296 3300048920 Bacteria 1773
531 Ga0496118_0000009 3300048921 Bacteria 611954
532 Ga0496118_0000122 3300048921 Bacteria 137396
533 Ga0496118_0002045 3300048921 Bacteria 28505
534 Ga0496118_0023039 3300048921 Bacteria 5423
535 Ga0496118_0036907 3300048921 Bacteria 3943
536 Ga0496119_0000040 3300048922 Bacteria 208180
537 Ga0496119_0005938 3300048922 Bacteria 11492
538 Ga0496119_0027560 3300048922 Bacteria 3901
539 Ga0496119_0125507 3300048922 Bacteria 1405
540 Ga0496120_0001789 3300048923 Bacteria 24155
541 Ga0496120_0003679 3300048923 Bacteria 13705
542 Ga0496121_0001289 3300048924 Bacteria 43185
543 Ga0496121_0005261 3300048924 Bacteria 16715
544 Ga0496121_0022211 3300048924 Bacteria 6170
545 Ga0496121_0035638 3300048924 Bacteria 4454
546 Ga0496121_0064651 3300048924 Bacteria 2982
547 Ga0496121_0191830 3300048924 Bacteria 1464
548 Ga0496122_0000046 3300048925 Bacteria 274640
549 Ga0496122_0000456 3300048925 Bacteria 84896
550 Ga0496122_0000757 3300048925 Bacteria 62588
551 Ga0496122_0013768 3300048925 Bacteria 7886
552 Ga0496122_0030343 3300048925 Bacteria 4532
553 Ga0496122_0065709 3300048925 Bacteria 2628
554 Ga0496123_0000523 3300048926 Bacteria 66280
555 Ga0496123_0000847 3300048926 Bacteria 48919
556 Ga0496123_0002033 3300048926 Bacteria 26132
557 Ga0496123_0015011 3300048926 Bacteria 6382
558 Ga0496124_0000007 3300048927 Bacteria 883534
559 Ga0496124_0000108 3300048927 Bacteria 167473
560 Ga0496124_0001770 3300048927 Bacteria 30051
561 Ga0496124_0022284 3300048927 Bacteria 5811
562 Ga0496124_0070141 3300048927 Bacteria 2908
563 Ga0496124_0143310 3300048927 Bacteria 1883
564 Ga0496125_0000028 3300048928 Bacteria 387222
565 Ga0496125_0000603 3300048928 Bacteria 61238
566 Ga0496125_0000735 3300048928 Bacteria 54271
567 Ga0496125_0003263 3300048928 Bacteria 19972
568 Ga0496125_0008606 3300048928 Bacteria 10652
569 Ga0496125_0014247 3300048928 Bacteria 7749
570 Ga0496125_0018169 3300048928 Bacteria 6683
571 Ga0496125_0038955 3300048928 Bacteria 4103
572 Ga0496126_0000044 3300048929 Bacteria 335904
573 Ga0496126_0005011 3300048929 Bacteria 15422
574 Ga0496126_0019578 3300048929 Bacteria 6662
575 Ga0496126_0077312 3300048929 Bacteria 2951
576 Ga0495682_0005001 3300049460 Bacteria 5571
577 Ga0501031_0001200 3300049568 Bacteria 15805
578 Ga0501031_0071155 3300049568 Bacteria 2265
579 Ga0501032_0008974 3300049569 Bacteria 7272
580 Ga0501033_0007472 3300049570 Bacteria 8508
581 Ga0501034_0093370 3300049571 Bacteria 3005
582 Ga0501034_0109738 3300049571 Bacteria 2750
583 Ga0501036_0000142 3300049572 Bacteria 46404
584 Ga0501036_0268191 3300049572 Bacteria 1430
585 Ga0501037_0031304 3300049573 Bacteria 3928
586 Ga0501038_0065287 3300049574 Bacteria 3101
587 Ga0501043_0000002 3300049579 Bacteria 351081
588 Ga0501043_0002495 3300049579 Bacteria 15564
589 Ga0501046_0000008 3300049580 Bacteria 351167
590 Ga0501046_0006939 3300049580 Bacteria 9980
591 Ga0501047_0000003 3300049581 Bacteria 508375
592 Ga0501047_0014818 3300049581 Bacteria 7421
593 Ga0501048_0001479 3300049582 Bacteria 17811
594 Ga0501227_001024 3300049665 Bacteria 6205
595 Ga0501227_013386 3300049665 Bacteria 1807
596 Ga0501262_000324 3300049759 Bacteria 5790
597 Ga0501279_000354 3300049775 Bacteria 6136
598 Ga0501035_0000880 3300049822 Bacteria 31849
599 Ga0501035_0021894 3300049822 Bacteria 5872
600 Ga0501035_0032696 3300049822 Bacteria 4732
601 Ga0501035_0038936 3300049822 Bacteria 4304
602 Ga0501044_0000825 3300049823 Bacteria 37302
603 Ga0501044_0030439 3300049823 Bacteria 5689
604 Ga0501045_0009769 3300049824 Bacteria 6710
605 nmdc:mga0k408_71899_c1 3300050493 Bacteria 2020
606 nmdc:mga07m45_47094_c1 3300050496 Bacteria 2423
607 nmdc:mga07m45_816_c1 3300050496 Bacteria 13445
608 nmdc:mga07m45_941_c1 3300050496 Bacteria 12746
609 nmdc:mga05p37_106967_c1 3300050507 Bacteria 3441
610 Ga0500643_013117 3300053087 Bacteria 2940
611 Ga0500556_0000869 3300053104 Bacteria 17077
612 Ga0500571_000144 3300053110 Bacteria 24451
613 Ga0500593_000371 3300053117 Bacteria 18072
614 Ga0500593_000531 3300053117 Bacteria 15018
615 Ga0500607_001041 3300053121 Bacteria 26175
616 Ga0500608_004107 3300053122 Bacteria 5582
617 Ga0500618_000688 3300053125 Bacteria 19912
618 Ga0500655_000695 3300053133 Bacteria 6686
619 Ga0500658_0002093 3300053134 Bacteria 7762
620 Ga0500568_0000552 3300053139 Bacteria 27568
621 Ga0500577_0000455 3300053142 Bacteria 10570
622 Ga0500590_006535 3300053148 Bacteria 5692
623 Ga0500616_0007237 3300053153 Bacteria 7088
624 Ga0500619_000054 3300053154 Bacteria 34866
625 Ga0500622_0004993 3300053156 Bacteria 8081
626 Ga0500627_0008899 3300053158 Bacteria 3590
627 Ga0500634_0032183 3300053161 Bacteria 2861
628 Ga0500638_048782 3300053162 Bacteria 2049
629 Ga0500636_0025419 3300053177 Bacteria 3499
630 Ga0500636_0035198 3300053177 Bacteria 2964
631 Ga0500645_000114 3300053730 Bacteria 64351
632 Ga0500645_001909 3300053730 Bacteria 9918
633 Ga0590071_009607 3300059421 Bacteria 2271
634 Ga0590075_010177 3300059424 Bacteria 2261
635 Ga0590075_014252 3300059424 Bacteria 1943
636 2511244756 2511231002 Bacteria 5042903
637 2513230152 2513020051 Bacteria 6053213
638 2513589818 2513237087 Bacteria 5817514
639 2585263115 2582581305 Bacteria 4895574
640 2599622368 2599185214 Bacteria 8209958
641 2599674540 2599185226 Bacteria 8233575
642 2599680225 2599185227 Bacteria 8246414
643 2599692241 2599185229 Bacteria 8216126
644 2643980225 2643221594 Bacteria 5811388
645 2644160910 2643221628 Bacteria 5745828
646 2644338707 2643221660 Bacteria 4208257
647 2644396834 2643221672 Bacteria 6322190
648 2644469475 2643221683 Bacteria 5749203
649 2644732713 2643221733 Bacteria 5690728
650 2644737250 2643221734 Bacteria 5365412
651 2738719398 2738541277 Bacteria 7458140
652 2739282871 2738543019 Bacteria 7459457
653 2809032557 2808606395 Bacteria 6020352
654 2819599056 2818991446 Bacteria 7757362
655 2819720238 2818991467 Bacteria 5893227
656 2831270845 2831265667 Bacteria 7184833
657 2838058892 2838054893 Bacteria 7451788
658 2841913917 2841911363 Bacteria 6173697
659 2841920482 2841917233 Bacteria 6173500
660 2842682208 2842677519 Bacteria 5615038
661 2857542105 2857537821 Bacteria 5248181
662 2885202335 2885198086 Bacteria 7212419
663 2885215988 2885211737 Bacteria 7212420
664 2887376964 2887375801 Bacteria 5334027
665 2887379820 2887375801 Bacteria 5334027
666 2899929883 2899924645 Bacteria 7487985
667 2904546557 2904541872 Bacteria 8915136
668 2917702181 2917699015 Bacteria 7043791
669 2919464547 2919462493 Bacteria 5817112
670 2928028213 2928027323 Bacteria 4382488
671 2928042186 2928037797 Bacteria 7273642
672 2928049955 2928044640 Bacteria 7271509
673 2928054520 2928051484 Bacteria 7773759
674 2928070113 2928064002 Bacteria 7419480
675 2928074273 2928070936 Bacteria 8062541
676 2928086498 2928084124 Bacteria 7159212
677 2929166011 2929160207 Bacteria 9075316
678 2929526606 2929520902 Bacteria 6765052
679 2945915577 2945909444 Bacteria 7065066
680 2945950395 2945945610 Bacteria 5951079
681 2945974961 2945972063 Bacteria 6086495
682 2954770153 2954767861 Bacteria 5535784
683 2984558553 2984555340 Bacteria 4247089
684 2984567038 2984564862 Bacteria 4339992
685 2993358129 2993356040 Bacteria 4247105
686 8055228617 8055225921 Bacteria 3341787
687 Ga0466961_0006058
688 SwRhRL2b_contig_1715871
689 JGI25156J39149_1000283
690 JGI25156J39149_1006728
691 JGI25154J39366_1000252
692 JGI25154J39366_1000261
693 JGI25158J39367_1001524
694 JGI25157J39369_1000319
695 JGI25152J39213_1000174
696 JGI25150J39212_1000584
697 JGI25150J39212_1001325
698 JGI25150J39212_1003346
699 JGI25150J39212_1005005
700 JGI25150J39212_1005550
701 JGI25159J45721_1000882
702 JGI25159J45721_1002895
703 JGI25159J45721_1004954
704 JGI25159J45721_1008748
705 JGI25159J45721_1015228
706 JGI25151J46595_10000051
707 JGI25151J46595_10003683
708 JGI25151J46595_10012852
709 JGI26128J50194_1000974
710 JGI25160J50197_1000158
711 JGI25160J50197_1001879
712 JGI25161J50226_1000040
713 JGI25161J50226_1001065
714 JGI25161J50226_1002128
715 JGI25161J50226_1004840
716 Ga0055539_1000125
717 Ga0055533_1000132
718 Ga0055532_1000136
719 Ga0055525_1000171
720 Ga0055535_1000067
721 Ga0055542_1000013
722 Ga0055529_1000669
723 Ga0055526_1000378
724 Ga0055526_1001010
725 Ga0055526_1002896
726 Ga0055526_1009235
727 Ga0055537_1000892
728 Ga0055537_1002287
729 Ga0055524_1000077
730 Ga0055524_1000294
731 Ga0055524_1000394
732 Ga0055524_1000723
733 Ga0055524_1003277
734 Ga0055524_1004757
735 Ga0055524_1012042
736 Ga0055536_1002480
737 Ga0055534_1001512
738 Ga0055534_1002538
739 Ga0055534_1003011
740 Ga0055534_1005238
741 Ga0055534_1006557
742 Ga0055534_1007029
743 Ga0055528_1002142
744 Ga0055528_1017317
745 Ga0055530_10000963
746 Ga0055530_10002603
747 Ga0055530_10002897
748 Ga0055540_1000010
749 Ga0055540_1000028
750 Ga0055531_10002158
751 Ga0055531_10003148
752 Ga0055531_10003289
753 Ga0055541_1000083
754 Ga0055543_1001322
755 Ga0055543_1002352
756 Ga0055543_1005190
757 Ga0065165_1004112
758 Ga0065165_1004142
759 Ga0065165_1017038
760 Ga0065707_10085963
761 Ga0070670_100139348
762 Ga0070670_100200028
763 Ga0070661_100011007
764 Ga0070661_100139710
765 Ga0070668_100018973
766 Ga0070669_100000081
767 Ga0070669_100017033
768 Ga0070671_100076840
769 Ga0070659_100001902
770 Ga0070659_100058772
771 Ga0070667_100012556
772 Ga0070711_100227882
773 Ga0070663_100120656
774 Ga0070678_100008125
775 Ga0070662_100002322
776 Ga0070662_100125143
777 Ga0068867_100005330
778 Ga0068853_100020634
779 Ga0068853_100053357
780 Ga0070672_100033107
781 Ga0070665_100001852
782 Ga0070665_100005848
783 Ga0070664_100001882
784 Ga0070664_100005404
785 Ga0070664_100051041
786 Ga0068857_100087942
787 Ga0068854_100033008
788 Ga0068854_100051829
789 Ga0068856_100120657
790 Ga0068852_100020918
791 Ga0068852_100069274
792 Ga0068859_100090415
793 Ga0068864_100178703
794 Ga0068866_10047559
795 Ga0068858_100075601
796 Ga0068860_100002168
797 Ga0068860_100078506
798 Ga0068860_100117381
799 Ga0068862_100002584
800 Ga0068862_100037921
801 Ga0075364_10014010
802 Ga0075366_10005044
803 Ga0097621_100075214
804 Ga0075370_10000877
805 Ga0075370_10000919
806 Ga0075370_10007180
807 Ga0068871_100025580
808 Ga0097620_100090423
809 Ga0079104_1000194
810 Ga0079104_1002709
811 Ga0099826_10000057
812 Ga0099795_10000816
813 Ga0105251_10041692
814 Ga0105244_10014853
815 Ga0105250_10007603
816 Ga0105240_10001823
817 Ga0105240_10004767
818 Ga0105240_10013542
819 Ga0105240_10113347
820 Ga0105245_10202807
821 Ga0114129_10083224
822 Ga0105243_10002576
823 Ga0105243_10097597
824 Ga0105242_10075403
825 Ga0105248_10002938
826 Ga0105248_10185143
827 Ga0105237_10012437
828 Ga0105237_10026284
829 Ga0105237_10087658
830 Ga0105237_10194772
831 Ga0105238_10002244
832 Ga0105238_10003500
833 Ga0099796_10007875
834 Ga0105239_10000954
835 Ga0157347_1000469
836 Ga0157370_10016616
837 Ga0157369_10052318
838 Ga0163162_10017199
839 Ga0157372_10024904
840 Ga0182008_10001152
841 Ga0182008_10002962
842 Ga0182008_10007562
843 Ga0157379_10041978
844 Ga0157376_10253393
845 Ga0182006_1000010
846 Ga0182006_1001273
847 Ga0182006_1002706
848 Ga0182006_1015341
849 Ga0182007_10000021
850 Ga0182007_10000443
851 Ga0182007_10005868
852 Ga0182005_1000009
853 Ga0163161_10000304
854 Ga0163161_10005646
855 Ga0163161_10056169
856 Ga0206353_10748616
857 Ga0213872_10000031
858 Ga0213872_10000561
859 Ga0213872_10000643
860 Ga0213872_10003753
861 Ga0209435_100018
862 Ga0209435_100106
863 Ga0209436_100171
864 Ga0209436_100435
865 Ga0209784_100009
866 Ga0209566_100007
867 Ga0209674_100018
868 Ga0209672_102789
869 Ga0209147_100051
870 Ga0209147_100437
871 Ga0209563_100020
872 Ga0209437_100611
873 Ga0209258_100020
874 Ga0209258_100324
875 Ga0207425_1000006
876 Ga0207425_1000201
877 Ga0207425_1000354
878 Ga0207425_1003415
879 Ga0207425_1003871
880 Ga0209646_1000172
881 Ga0209646_1000186
882 Ga0209026_1000042
883 Ga0209026_1001244
884 Ga0209677_100010
885 Ga0209148_1000031
886 Ga0209759_1000273
887 Ga0209759_1000765
888 Ga0209129_1000009
889 Ga0209129_1000055
890 Ga0209129_1004556
891 Ga0209565_1000036
892 Ga0209565_1000226
893 Ga0209565_1000459
894 Ga0209565_1000488
895 Ga0209565_1000795
896 Ga0209565_1010203
897 Ga0209455_1000345
898 Ga0209673_1000282
899 Ga0209673_1001892
900 Ga0209673_1017751
901 Ga0209130_1000042
902 Ga0209130_1000214
903 Ga0209130_1000255
904 Ga0209130_1000493
905 Ga0209130_1001371
906 Ga0209130_1002656
907 Ga0209130_1003075
908 Ga0209675_1000106
909 Ga0209675_1000876
910 Ga0209675_1001043
911 Ga0209675_1001953
912 Ga0209675_1003028
913 Ga0209675_1007045
914 Ga0209676_1000007
915 Ga0209676_1000346
916 Ga0209676_1000508
917 Ga0209676_1028193
918 Ga0209025_1000017
919 Ga0209025_1000027
920 Ga0209025_1000145
921 Ga0209025_1000510
922 Ga0209025_1005886
923 Ga0209025_1009929
924 Ga0209025_1038322
925 Ga0209025_1042043
926 Ga0209564_1000054
927 Ga0209564_1000098
928 Ga0209564_1000177
929 Ga0209564_1000254
930 Ga0209564_1000410
931 Ga0209564_1001702
932 Ga0209564_1001743
933 Ga0209564_1022586
934 Ga0209758_1000042
935 Ga0209758_1000071
936 Ga0209758_1019144
937 Ga0209758_1020986
938 Ga0209050_1000003
939 Ga0209050_1000183
940 Ga0209050_1001372
941 Ga0209050_1001781
942 Ga0209050_1002607
943 Ga0209050_1003521
944 Ga0209050_1020043
945 Ga0209256_1000001
946 Ga0209256_1000013
947 Ga0209256_1000015
948 Ga0209256_1000032
949 Ga0209256_1000056
950 Ga0209256_1000148
951 Ga0209256_1000330
952 Ga0209256_1000498
953 Ga0209256_1001642
954 Ga0209256_1008619
955 Ga0207426_1000055
956 Ga0207426_1000079
957 Ga0207426_1000097
958 Ga0207426_1001049
959 Ga0209051_1000003
960 Ga0209051_1000022
961 Ga0209051_1000126
962 Ga0209051_1000358
963 Ga0209257_1000010
964 Ga0209257_1000020
965 Ga0209257_1000030
966 Ga0209257_1000214
967 Ga0209257_1033335
968 Ga0207656_10012292
969 Ga0207696_1003048
970 Ga0207655_1003314
971 Ga0207713_1007308
972 Ga0207688_10033400
973 Ga0207705_10194538
974 Ga0207695_10000564
975 Ga0207695_10001901
976 Ga0207695_10017142
977 Ga0207695_10024057
978 Ga0207695_10115296
979 Ga0207652_10252431
980 Ga0207681_10000620
981 Ga0207681_10036722
982 Ga0207681_10115092
983 Ga0207694_10000736
984 Ga0207694_10009874
985 Ga0207690_10001730
986 Ga0207706_10003912
987 Ga0207709_10000808
988 Ga0207709_10003613
989 Ga0207704_10024064
990 Ga0207711_10015630
991 Ga0207711_10119995
992 Ga0207679_10000587
993 Ga0207679_10025234
994 Ga0207679_10038155
995 Ga0207667_10024840
996 Ga0207667_10344873
997 Ga0207668_10001115
998 Ga0207668_10003493
999 Ga0207658_10002807
1000 Ga0207658_10138711
1001 Ga0207703_10097209
1002 Ga0207639_10010659
1003 Ga0207678_10169637
1004 Ga0207702_10093063
1005 Ga0207648_10000133
1006 Ga0207675_100002269
1007 Ga0207683_10102809
1008 Ga0207698_10091380
1009 Ga0207698_10113732
1010 Ga0207698_10348906
1011 Ga0209281_1000083
1012 Ga0209281_1002597
1013 Ga0209996_1001357
1014 Ga0209968_1000055
1015 Ga0209970_1002958
1016 Ga0209282_1000087
1017 Ga0209966_1000136
1018 Ga0268266_10002768
1019 Ga0268266_10007697
1020 Ga0268265_10029375
1021 Ga0268265_10158042
1022 Ga0268265_10226596
1023 Ga0268264_10008150
1024 Ga0268264_10073620
1025 Ga0307512_10101233
1026 Ga0316177_1015726
1027 Ga0314311_1002227
1028 Ga0316178_1072432
1029 Ga0307513_10000011
1030 Ga0307513_10020065
1031 Ga0307408_100001673
1032 Ga0307408_100002531
1033 Ga0307408_100005828
1034 Ga0307408_100017174
1035 Ga0307408_100020243
1036 Ga0307514_10001392
1037 Ga0307514_10028862
1038 Ga0307516_10000236
1039 Ga0307516_10172918
1040 Ga0307405_10090092
1041 Ga0307416_100054694
1042 Ga0307414_10045879
1043 Ga0307414_10244881
1044 Ga0307411_10098104
1045 Ga0373927_0009919
1046 Ga0373925_0007332
1047 Ga0395899_0001398
1048 Ga0395900_0000183
1049 Ga0395900_0024399
1050 Ga0395900_0133230
1051 Ga0395898_0001293
1052 Ga0395905_0000544
1053 Ga0395905_0009714
1054 Ga0395905_0016905
1055 Ga0395905_0329225
1056 Ga0395901_0033688
1057 Ga0436361_0223353
1058 Ga0436361_0287785
1059 Ga0436361_0314120
1060 Ga0436361_0683159
1061 Ga0436361_0913791
1062 Ga0439465_0004902
1063 Ga0439442_004344
1064 Ga0439449_0001042
1065 Ga0439457_011471
1066 Ga0450906_000679
1067 Ga0450907_006037
1068 Ga0450908_001090
1069 Ga0439434_0000981
1070 Ga0451577_0031266
1071 Ga0451577_0032857
1072 Ga0451577_0090871
1073 Ga0451577_0136064
1074 Ga0451577_0142773
1075 Ga0451577_0149093
1076 Ga0451577_0341806
1077 Ga0466969_0000020
1078 Ga0466972_0000594
1079 Ga0466972_0003601
1080 Ga0466966_0024759
1081 Ga0466961_0045638
1082 Ga0453684_0076853
1083 Ga0453684_0118632
1084 Ga0466971_0047891
1085 Ga0466970_0017380
1086 Ga0466957_0009426
1087 Ga0466957_0063909
1088 Ga0466959_0000210
1089 Ga0466959_0027190
1090 Ga0466959_0087364
1091 Ga0451576_0001676
1092 Ga0451576_0004667
1093 Ga0451576_0289200
1094 Ga0495617_000700
1095 Ga0495603_0061901
1096 Ga0495650_0003613
1097 Ga0495605_0009463
1098 Ga0495584_0000116
1099 Ga0495584_0000670
1100 Ga0495584_0005762
1101 Ga0495584_0006923
1102 Ga0495584_0035646
1103 Ga0495585_0000186
1104 Ga0495585_0000433
1105 Ga0495585_0003928
1106 Ga0495585_0032358
1107 Ga0495585_0123292
1108 Ga0495594_0004377
1109 Ga0495596_0000775
1110 Ga0495596_0001012
1111 Ga0495596_0003535
1112 Ga0495607_0122200
1113 Ga0495606_0003426
1114 Ga0495606_0003557
1115 Ga0495606_0005928
1116 Ga0495616_0001219
1117 Ga0495616_0001425
1118 Ga0495616_0010130
1119 Ga0495616_0010703
1120 Ga0495620_0007314
1121 Ga0495630_0029037
1122 Ga0495631_0000096
1123 Ga0495631_0002784
1124 Ga0495637_0010529
1125 Ga0495643_0016003
1126 Ga0495643_0064102
1127 Ga0495644_0014253
1128 Ga0495648_0001005
1129 Ga0495648_0005201
1130 Ga0495648_0023484
1131 Ga0495648_0039731
1132 Ga0495663_0014510
1133 Ga0495666_0010042
1134 Ga0495642_0006506
1135 Ga0495654_0009804
1136 Ga0495654_0020019
1137 Ga0495665_0016384
1138 Ga0495586_0003334
1139 Ga0495587_0055599
1140 Ga0495609_0002156
1141 Ga0495621_0001408
1142 Ga0495597_0022161
1143 Ga0495622_0008301
1144 Ga0495622_0091394
1145 Ga0495633_0005259
1146 Ga0495633_0007099
1147 Ga0495633_0012973
1148 Ga0495633_0028365
1149 Ga0495633_0037893
1150 Ga0495667_0021451
1151 Ga0495656_0020547
1152 Ga0495668_0004688
1153 Ga0495668_0011903
1154 Ga0495668_0024258
1155 Ga0495611_0018718
1156 Ga0495611_0056758
1157 Ga0495625_0000085
1158 Ga0495625_0000136
1159 Ga0495625_0001669
1160 Ga0495625_0032391
1161 Ga0495625_0038416
1162 Ga0495661_0013032
1163 Ga0495661_0074838
1164 Ga0495623_0054571
1165 Ga0495646_0031608
1166 Ga0495669_0000571
1167 Ga0495624_0070658
1168 Ga0495670_0013170
1169 Ga0495670_0079849
1170 Ga0495671_0007334
1171 Ga0495671_0052450
1172 Ga0495589_0008756
1173 Ga0495589_0105179
1174 Ga0495600_0013824
1175 Ga0495581_0019648
1176 Ga0495604_0037349
1177 Ga0495604_0131814
1178 Ga0495672_0000014
1179 Ga0495672_0018828
1180 Ga0495676_0122221
1181 Ga0495683_0000112
1182 Ga0495683_0005323
1183 Ga0495687_028240
1184 Ga0495677_0002013
1185 Ga0495677_0031094
1186 Ga0495673_0018896
1187 Ga0495593_0009381
1188 Ga0495593_0021901
1189 Ga0495602_0050597
1190 Ga0495626_0012603
1191 Ga0495626_0050028
1192 Ga0496100_0109380
1193 Ga0496101_0279508
1194 Ga0496102_0000141
1195 Ga0496103_0000172
1196 Ga0496104_0000114
1197 Ga0496104_0034544
1198 Ga0496104_0160430
1199 Ga0496105_0000073
1200 Ga0496105_0058039
1201 Ga0496108_0026169
1202 Ga0496109_0032888
1203 Ga0496111_0070562
1204 Ga0496112_0167333
1205 Ga0496113_0006082
1206 Ga0496114_0002834
1207 Ga0496114_0029422
1208 Ga0496114_0092669
1209 Ga0496115_0121181
1210 Ga0496116_0014455
1211 Ga0496116_0027604
1212 Ga0496117_0000010
1213 Ga0496117_0005386
1214 Ga0496117_0007249
1215 Ga0496117_0010975
1216 Ga0496117_0105296
1217 Ga0496118_0000009
1218 Ga0496118_0000122
1219 Ga0496118_0002045
1220 Ga0496118_0023039
1221 Ga0496118_0036907
1222 Ga0496119_0000040
1223 Ga0496119_0005938
1224 Ga0496119_0027560
1225 Ga0496119_0125507
1226 Ga0496120_0001789
1227 Ga0496120_0003679
1228 Ga0496121_0001289
1229 Ga0496121_0005261
1230 Ga0496121_0022211
1231 Ga0496121_0035638
1232 Ga0496121_0064651
1233 Ga0496121_0191830
1234 Ga0496122_0000046
1235 Ga0496122_0000456
1236 Ga0496122_0000757
1237 Ga0496122_0013768
1238 Ga0496122_0030343
1239 Ga0496122_0065709
1240 Ga0496123_0000523
1241 Ga0496123_0000847
1242 Ga0496123_0002033
1243 Ga0496123_0015011
1244 Ga0496124_0000007
1245 Ga0496124_0000108
1246 Ga0496124_0001770
1247 Ga0496124_0022284
1248 Ga0496124_0070141
1249 Ga0496124_0143310
1250 Ga0496125_0000028
1251 Ga0496125_0000603
1252 Ga0496125_0000735
1253 Ga0496125_0003263
1254 Ga0496125_0008606
1255 Ga0496125_0014247
1256 Ga0496125_0018169
1257 Ga0496125_0038955
1258 Ga0496126_0000044
1259 Ga0496126_0005011
1260 Ga0496126_0019578
1261 Ga0496126_0077312
1262 Ga0495682_0005001
1263 Ga0501031_0001200
1264 Ga0501031_0071155
1265 Ga0501032_0008974
1266 Ga0501033_0007472
1267 Ga0501034_0093370
1268 Ga0501034_0109738
1269 Ga0501036_0000142
1270 Ga0501036_0268191
1271 Ga0501037_0031304
1272 Ga0501038_0065287
1273 Ga0501043_0000002
1274 Ga0501043_0002495
1275 Ga0501046_0000008
1276 Ga0501046_0006939
1277 Ga0501047_0000003
1278 Ga0501047_0014818
1279 Ga0501048_0001479
1280 Ga0501227_001024
1281 Ga0501227_013386
1282 Ga0501262_000324
1283 Ga0501279_000354
1284 Ga0501035_0000880
1285 Ga0501035_0021894
1286 Ga0501035_0032696
1287 Ga0501035_0038936
1288 Ga0501044_0000825
1289 Ga0501044_0030439
1290 Ga0501045_0009769
1291 nmdc:mga0k408_71899_c1
1292 nmdc:mga07m45_47094_c1
1293 nmdc:mga07m45_816_c1
1294 nmdc:mga07m45_941_c1
1295 nmdc:mga05p37_106967_c1
1296 Ga0500643_013117
1297 Ga0500556_0000869
1298 Ga0500571_000144
1299 Ga0500593_000371
1300 Ga0500593_000531
1301 Ga0500607_001041
1302 Ga0500608_004107
1303 Ga0500618_000688
1304 Ga0500655_000695
1305 Ga0500658_0002093
1306 Ga0500568_0000552
1307 Ga0500577_0000455
1308 Ga0500590_006535
1309 Ga0500616_0007237
1310 Ga0500619_000054
1311 Ga0500622_0004993
1312 Ga0500627_0008899
1313 Ga0500634_0032183
1314 Ga0500638_048782
1315 Ga0500636_0025419
1316 Ga0500636_0035198
1317 Ga0500645_000114
1318 Ga0500645_001909
1319 Ga0590071_009607
1320 Ga0590075_010177
1321 Ga0590075_014252
1322 2511244756
1323 2513230152
1324 2513589818
1325 2585263115
1326 2599622368
1327 2599674540
1328 2599680225
1329 2599692241
1330 2643980225
1331 2644160910
1332 2644338707
1333 2644396834
1334 2644469475
1335 2644732713
1336 2644737250
1337 2738719398
1338 2739282871
1339 2809032557
1340 2819599056
1341 2819720238
1342 2831270845
1343 2838058892
1344 2841913917
1345 2841920482
1346 2842682208
1347 2857542105
1348 2885202335
1349 2885215988
1350 2887376964
1351 2887379820
1352 2899929883
1353 2904546557
1354 2917702181
1355 2919464547
1356 2928028213
1357 2928042186
1358 2928049955
1359 2928054520
1360 2928070113
1361 2928074273
1362 2928086498
1363 2929166011
1364 2929526606
1365 2945915577
1366 2945950395
1367 2945974961
1368 2954770153
1369 2984558553
1370 2984567038
1371 2993358129
1372 8055228617

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

225

327

0.96

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

115

434

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9384 4 380
4ewt-assembly1.cif.gz_B the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9215 4 380
4ewt-assembly1.cif.gz_D the crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus 0.9196 4 383
1ysj-assembly1.cif.gz_A crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.9171 8 380
1ysj-assembly1.cif.gz_B crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family 0.917 8 383
ID Description Score Start End Superfamily
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9734 181 294 3.30.70.360
af_A0A0R0IPM0_41_149_3.30.70.360 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9711 182 289 3.30.70.360
af_A0A0R0IPM1_21_184_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9686 12 119 3.40.630.10
af_Q7XUA8_201_320_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9585 181 292 3.40.630.10
4ewtD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.957 181 294 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A418GRL8-F1-model_v4 Amidohydrolase 0.9879 5 144 GO:0016787
AF-A0A0Q5CSM0-F1-model_v4 Amidohydrolase 0.9848 12 386 GO:0016787
GO:0046872
AF-A0A2E1A3C3-F1-model_v4 Peptidase M20 0.9832 48 385 GO:0016787
GO:0046872
AF-A0A1B4I4A7-F1-model_v4 deleted 0.9821 7 383
AF-A0A847DRM8-F1-model_v4 Amidohydrolase 0.9821 5 145 GO:0016787

Map