F475199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 686 | 290 | 686 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300042435|Ga0439434_0031575|Ga0439434_0031575_109_666 |
| Length | 185 |
| Sequence | MSRTIALDSFLLADADRVVARARAGDQAALEQLYRAFEAPVYNLARRICRTTEDAEDVLQETFFEVCRSIGRYREEGSLWGWVRTIAASKALMRLRRNKYRDTDELNDELVIGQRKEETHLRMDLEAALERLPETSRAVVWLHDVEGYTHDEIAGMMGKTASFSKSQLARAHARLRRWLGEEVLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 165 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 184 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 185 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 188 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 189 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 190 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 191 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 194 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 198 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 260 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 261 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 262 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 265 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 266 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 267 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 273 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 287 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 288 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.71 |
| Metatranscriptomes | 0.29 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.02 |
| Rhizosphere | 91.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_11731781 | 3300004799 | Bacteria | 846 |
| 2 | Ga0058862_10047534 | 3300004803 | Unclassified | 565 |
| 3 | Ga0065715_10363302 | 3300005293 | Bacteria | 932 |
| 4 | Ga0070683_101007997 | 3300005329 | Unclassified | 799 |
| 5 | Ga0070690_100011251 | 3300005330 | Bacteria | 5229 |
| 6 | Ga0068869_100034358 | 3300005334 | Bacteria | 3586 |
| 7 | Ga0070666_10193131 | 3300005335 | Bacteria | 1431 |
| 8 | Ga0070680_100029768 | 3300005336 | Bacteria | 4383 |
| 9 | Ga0070680_100033249 | 3300005336 | Bacteria | 4155 |
| 10 | Ga0070680_100183025 | 3300005336 | Bacteria | 1765 |
| 11 | Ga0070680_100525113 | 3300005336 | Bacteria | 1014 |
| 12 | Ga0070682_100267759 | 3300005337 | Bacteria | 1240 |
| 13 | Ga0070660_100957345 | 3300005339 | Bacteria | 723 |
| 14 | Ga0070689_101060078 | 3300005340 | Bacteria | 723 |
| 15 | Ga0070691_10098121 | 3300005341 | Bacteria | 1452 |
| 16 | Ga0070691_10262915 | 3300005341 | Bacteria | 930 |
| 17 | Ga0070661_100624612 | 3300005344 | Bacteria | 873 |
| 18 | Ga0070692_10050709 | 3300005345 | Unclassified | 2156 |
| 19 | Ga0070692_10162238 | 3300005345 | Bacteria | 1282 |
| 20 | Ga0070692_10512752 | 3300005345 | Bacteria | 779 |
| 21 | Ga0070668_100282918 | 3300005347 | Bacteria | 1386 |
| 22 | Ga0070669_100003834 | 3300005353 | Bacteria | 10858 |
| 23 | Ga0070669_100413474 | 3300005353 | Unclassified | 1106 |
| 24 | Ga0070675_100089952 | 3300005354 | Bacteria | 2571 |
| 25 | Ga0070671_100028927 | 3300005355 | Bacteria | 4567 |
| 26 | Ga0070671_100853265 | 3300005355 | Bacteria | 794 |
| 27 | Ga0070674_100004305 | 3300005356 | Bacteria | 8102 |
| 28 | Ga0070688_100564168 | 3300005365 | Unclassified | 867 |
| 29 | Ga0070659_100114880 | 3300005366 | Bacteria | 2175 |
| 30 | Ga0070659_100356395 | 3300005366 | Bacteria | 1228 |
| 31 | Ga0070667_100010120 | 3300005367 | Bacteria | 7802 |
| 32 | Ga0070709_10207767 | 3300005434 | Bacteria | 1390 |
| 33 | Ga0070709_10683409 | 3300005434 | Bacteria | 797 |
| 34 | Ga0070701_10178859 | 3300005438 | Bacteria | 1240 |
| 35 | Ga0070701_10230518 | 3300005438 | Bacteria | 1109 |
| 36 | Ga0070711_100000102 | 3300005439 | Bacteria | 44792 |
| 37 | Ga0070711_100761413 | 3300005439 | Bacteria | 819 |
| 38 | Ga0070705_100005926 | 3300005440 | Bacteria | 5977 |
| 39 | Ga0070705_100012010 | 3300005440 | Bacteria | 4387 |
| 40 | Ga0070705_100037361 | 3300005440 | Bacteria | 2738 |
| 41 | Ga0070700_100110730 | 3300005441 | Bacteria | 1825 |
| 42 | Ga0070700_100507475 | 3300005441 | Bacteria | 929 |
| 43 | Ga0070694_100022371 | 3300005444 | Bacteria | 4050 |
| 44 | Ga0070694_100161116 | 3300005444 | Bacteria | 1646 |
| 45 | Ga0070708_100002594 | 3300005445 | Bacteria | 13974 |
| 46 | Ga0070708_100041538 | 3300005445 | Bacteria | 4032 |
| 47 | Ga0070708_100059681 | 3300005445 | Bacteria | 3402 |
| 48 | Ga0070708_100073459 | 3300005445 | Unclassified | 3083 |
| 49 | Ga0070708_100263574 | 3300005445 | Unclassified | 1620 |
| 50 | Ga0070663_100154417 | 3300005455 | Bacteria | 1762 |
| 51 | Ga0070663_100566497 | 3300005455 | Bacteria | 951 |
| 52 | Ga0070663_101048340 | 3300005455 | Unclassified | 711 |
| 53 | Ga0070662_100000777 | 3300005457 | Bacteria | 19681 |
| 54 | Ga0070681_10137902 | 3300005458 | Bacteria | 2369 |
| 55 | Ga0068867_100001516 | 3300005459 | Bacteria | 16088 |
| 56 | Ga0070706_100042627 | 3300005467 | Bacteria | 4193 |
| 57 | Ga0070706_100670593 | 3300005467 | Unclassified | 962 |
| 58 | Ga0070706_100767066 | 3300005467 | Unclassified | 893 |
| 59 | Ga0070707_100002297 | 3300005468 | Bacteria | 18268 |
| 60 | Ga0070707_100012208 | 3300005468 | Bacteria | 8018 |
| 61 | Ga0070707_100072853 | 3300005468 | Bacteria | 3312 |
| 62 | Ga0070707_100218541 | 3300005468 | Unclassified | 1857 |
| 63 | Ga0070707_100381693 | 3300005468 | Bacteria | 1369 |
| 64 | Ga0070707_100531370 | 3300005468 | Bacteria | 1138 |
| 65 | Ga0070698_100010863 | 3300005471 | Bacteria | 9688 |
| 66 | Ga0070698_100032052 | 3300005471 | Bacteria | 5446 |
| 67 | Ga0070698_100094655 | 3300005471 | Bacteria | 2966 |
| 68 | Ga0070698_100099506 | 3300005471 | Bacteria | 2881 |
| 69 | Ga0070698_100286524 | 3300005471 | Bacteria | 1578 |
| 70 | Ga0070698_100856901 | 3300005471 | Unclassified | 854 |
| 71 | Ga0070699_100001206 | 3300005518 | Bacteria | 23893 |
| 72 | Ga0070699_100001560 | 3300005518 | Bacteria | 20969 |
| 73 | Ga0070699_100003944 | 3300005518 | Bacteria | 13109 |
| 74 | Ga0070699_100024573 | 3300005518 | Bacteria | 5194 |
| 75 | Ga0070699_100049215 | 3300005518 | Bacteria | 3648 |
| 76 | Ga0070699_100072113 | 3300005518 | Unclassified | 3004 |
| 77 | Ga0070699_100130662 | 3300005518 | Unclassified | 2214 |
| 78 | Ga0070679_100063566 | 3300005530 | Bacteria | 3679 |
| 79 | Ga0070679_100117920 | 3300005530 | Bacteria | 2639 |
| 80 | Ga0070679_100378334 | 3300005530 | Bacteria | 1363 |
| 81 | Ga0070684_101036402 | 3300005535 | Bacteria | 770 |
| 82 | Ga0070697_100049445 | 3300005536 | Bacteria | 3413 |
| 83 | Ga0070697_100116433 | 3300005536 | Bacteria | 2232 |
| 84 | Ga0070697_100924547 | 3300005536 | Bacteria | 774 |
| 85 | Ga0068853_100419163 | 3300005539 | Bacteria | 1255 |
| 86 | Ga0068853_100469796 | 3300005539 | Bacteria | 1185 |
| 87 | Ga0070672_100141839 | 3300005543 | Bacteria | 1982 |
| 88 | Ga0070686_100143449 | 3300005544 | Unclassified | 1665 |
| 89 | Ga0070686_100168115 | 3300005544 | Bacteria | 1549 |
| 90 | Ga0070686_100557900 | 3300005544 | Bacteria | 897 |
| 91 | Ga0070695_100007192 | 3300005545 | Bacteria | 6600 |
| 92 | Ga0070695_100098576 | 3300005545 | Bacteria | 1964 |
| 93 | Ga0070695_100130546 | 3300005545 | Bacteria | 1731 |
| 94 | Ga0070695_100144550 | 3300005545 | Bacteria | 1653 |
| 95 | Ga0070695_100418389 | 3300005545 | Bacteria | 1020 |
| 96 | Ga0070696_100002315 | 3300005546 | Bacteria | 12568 |
| 97 | Ga0070696_100021954 | 3300005546 | Bacteria | 4331 |
| 98 | Ga0070696_100024646 | 3300005546 | Bacteria | 4090 |
| 99 | Ga0070696_100045007 | 3300005546 | Bacteria | 3057 |
| 100 | Ga0070696_100055845 | 3300005546 | Unclassified | 2754 |
| 101 | Ga0070696_100181802 | 3300005546 | Bacteria | 1560 |
| 102 | Ga0070696_100199998 | 3300005546 | Bacteria | 1491 |
| 103 | Ga0070696_100259198 | 3300005546 | Unclassified | 1318 |
| 104 | Ga0070696_100349770 | 3300005546 | Unclassified | 1144 |
| 105 | Ga0070696_101151383 | 3300005546 | Bacteria | 654 |
| 106 | Ga0070693_100001534 | 3300005547 | Bacteria | 10426 |
| 107 | Ga0070693_100050989 | 3300005547 | Unclassified | 2368 |
| 108 | Ga0070693_100141054 | 3300005547 | Bacteria | 1517 |
| 109 | Ga0070665_100128144 | 3300005548 | Unclassified | 2540 |
| 110 | Ga0070665_100271467 | 3300005548 | Bacteria | 1698 |
| 111 | Ga0070704_100000855 | 3300005549 | Bacteria | 15211 |
| 112 | Ga0070704_100006919 | 3300005549 | Bacteria | 6720 |
| 113 | Ga0068855_100111162 | 3300005563 | Bacteria | 3145 |
| 114 | Ga0070664_100015342 | 3300005564 | Bacteria | 6265 |
| 115 | Ga0070664_100854615 | 3300005564 | Bacteria | 852 |
| 116 | Ga0068857_101028156 | 3300005577 | Bacteria | 794 |
| 117 | Ga0068857_101032048 | 3300005577 | Bacteria | 792 |
| 118 | Ga0068854_100009366 | 3300005578 | Bacteria | 6322 |
| 119 | Ga0068854_100929561 | 3300005578 | Unclassified | 766 |
| 120 | Ga0068856_100501079 | 3300005614 | Bacteria | 1235 |
| 121 | Ga0070702_100006351 | 3300005615 | Bacteria | 5589 |
| 122 | Ga0068852_100678687 | 3300005616 | Bacteria | 1039 |
| 123 | Ga0068859_100032642 | 3300005617 | Bacteria | 5229 |
| 124 | Ga0068859_100140770 | 3300005617 | Bacteria | 2486 |
| 125 | Ga0068859_100671415 | 3300005617 | Bacteria | 1128 |
| 126 | Ga0068864_100001860 | 3300005618 | Bacteria | 17319 |
| 127 | Ga0068864_100016288 | 3300005618 | Bacteria | 6187 |
| 128 | Ga0068864_100028332 | 3300005618 | Unclassified | 4732 |
| 129 | Ga0068864_100918073 | 3300005618 | Bacteria | 865 |
| 130 | Ga0068866_10000032 | 3300005718 | Bacteria | 56456 |
| 131 | Ga0068866_10792209 | 3300005718 | Bacteria | 658 |
| 132 | Ga0068861_100010300 | 3300005719 | Bacteria | 6487 |
| 133 | Ga0068851_10325479 | 3300005834 | Bacteria | 889 |
| 134 | Ga0068870_10015518 | 3300005840 | Bacteria | 3616 |
| 135 | Ga0068870_10548462 | 3300005840 | Bacteria | 778 |
| 136 | Ga0068863_100049521 | 3300005841 | Unclassified | 3984 |
| 137 | Ga0068863_100168876 | 3300005841 | Unclassified | 2098 |
| 138 | Ga0068858_100060625 | 3300005842 | Unclassified | 3497 |
| 139 | Ga0068860_100018732 | 3300005843 | Bacteria | 6727 |
| 140 | Ga0068860_100291380 | 3300005843 | Unclassified | 1597 |
| 141 | Ga0068860_100390387 | 3300005843 | Bacteria | 1375 |
| 142 | Ga0068860_100714083 | 3300005843 | Bacteria | 1013 |
| 143 | Ga0068860_101212113 | 3300005843 | Unclassified | 775 |
| 144 | Ga0068862_101198624 | 3300005844 | Bacteria | 758 |
| 145 | Ga0081455_10047462 | 3300005937 | Unclassified | 3719 |
| 146 | Ga0081538_10067306 | 3300005981 | Bacteria | 2001 |
| 147 | Ga0070715_10080104 | 3300006163 | Unclassified | 1480 |
| 148 | Ga0070715_10524791 | 3300006163 | Unclassified | 682 |
| 149 | Ga0070712_100044684 | 3300006175 | Bacteria | 3055 |
| 150 | Ga0097621_100090456 | 3300006237 | Bacteria | 2561 |
| 151 | Ga0068871_100043892 | 3300006358 | Unclassified | 3593 |
| 152 | Ga0075428_100005385 | 3300006844 | Bacteria | 14225 |
| 153 | Ga0075428_100207787 | 3300006844 | Bacteria | 2116 |
| 154 | Ga0075428_101465180 | 3300006844 | Bacteria | 716 |
| 155 | Ga0075430_100211724 | 3300006846 | Bacteria | 1608 |
| 156 | Ga0075430_100494912 | 3300006846 | Unclassified | 1009 |
| 157 | Ga0075431_100013023 | 3300006847 | Bacteria | 8400 |
| 158 | Ga0075431_100063152 | 3300006847 | Bacteria | 3821 |
| 159 | Ga0075431_100075065 | 3300006847 | Bacteria | 3489 |
| 160 | Ga0075431_100186529 | 3300006847 | Bacteria | 2127 |
| 161 | Ga0075431_100343014 | 3300006847 | Bacteria | 1503 |
| 162 | Ga0075431_100609703 | 3300006847 | Unclassified | 1075 |
| 163 | Ga0075433_10069132 | 3300006852 | Bacteria | 3101 |
| 164 | Ga0075433_10116747 | 3300006852 | Bacteria | 2368 |
| 165 | Ga0075433_10161239 | 3300006852 | Bacteria | 1996 |
| 166 | Ga0075433_10179885 | 3300006852 | Bacteria | 1881 |
| 167 | Ga0075434_100001345 | 3300006871 | Bacteria | 20620 |
| 168 | Ga0075434_100003406 | 3300006871 | Bacteria | 14234 |
| 169 | Ga0075434_100076933 | 3300006871 | Bacteria | 3332 |
| 170 | Ga0075429_100010791 | 3300006880 | Bacteria | 7900 |
| 171 | Ga0075429_100043499 | 3300006880 | Bacteria | 3908 |
| 172 | Ga0075429_100138559 | 3300006880 | Bacteria | 2130 |
| 173 | Ga0068865_100008061 | 3300006881 | Bacteria | 6503 |
| 174 | Ga0068865_100341299 | 3300006881 | Bacteria | 1210 |
| 175 | Ga0068865_101322053 | 3300006881 | Bacteria | 641 |
| 176 | Ga0075436_100032424 | 3300006914 | Bacteria | 3601 |
| 177 | Ga0097620_100032641 | 3300006931 | Bacteria | 5229 |
| 178 | Ga0097620_100140774 | 3300006931 | Bacteria | 2486 |
| 179 | Ga0097620_100671424 | 3300006931 | Bacteria | 1128 |
| 180 | Ga0075435_100080594 | 3300007076 | Bacteria | 2673 |
| 181 | Ga0075435_100104673 | 3300007076 | Bacteria | 2348 |
| 182 | Ga0075435_100185144 | 3300007076 | Unclassified | 1761 |
| 183 | Ga0075435_100286487 | 3300007076 | Bacteria | 1407 |
| 184 | Ga0105250_10158497 | 3300009092 | Bacteria | 944 |
| 185 | Ga0105240_10072817 | 3300009093 | Unclassified | 4245 |
| 186 | Ga0111539_10062423 | 3300009094 | Bacteria | 4411 |
| 187 | Ga0105245_10039144 | 3300009098 | Bacteria | 4220 |
| 188 | Ga0105247_10820402 | 3300009101 | Bacteria | 711 |
| 189 | Ga0114129_10032491 | 3300009147 | Bacteria | 7376 |
| 190 | Ga0114129_10088996 | 3300009147 | Bacteria | 4280 |
| 191 | Ga0114129_10122655 | 3300009147 | Bacteria | 3575 |
| 192 | Ga0114129_10308410 | 3300009147 | Bacteria | 2107 |
| 193 | Ga0114129_10524197 | 3300009147 | Bacteria | 1544 |
| 194 | Ga0114129_11044112 | 3300009147 | Unclassified | 1026 |
| 195 | Ga0114129_11088404 | 3300009147 | Bacteria | 1001 |
| 196 | Ga0114129_11209627 | 3300009147 | Bacteria | 941 |
| 197 | Ga0114129_11532326 | 3300009147 | Bacteria | 818 |
| 198 | Ga0105241_10017383 | 3300009174 | Bacteria | 5284 |
| 199 | Ga0105241_10544772 | 3300009174 | Bacteria | 1041 |
| 200 | Ga0105241_10787753 | 3300009174 | Bacteria | 875 |
| 201 | Ga0105242_10001646 | 3300009176 | Bacteria | 17654 |
| 202 | Ga0105248_10001568 | 3300009177 | Bacteria | 25438 |
| 203 | Ga0105248_10031052 | 3300009177 | Bacteria | 5970 |
| 204 | Ga0105248_10178643 | 3300009177 | Bacteria | 2392 |
| 205 | Ga0105248_10675974 | 3300009177 | Unclassified | 1165 |
| 206 | Ga0105248_10966132 | 3300009177 | Bacteria | 962 |
| 207 | Ga0105248_11891517 | 3300009177 | Unclassified | 677 |
| 208 | Ga0105237_10317984 | 3300009545 | Bacteria | 1560 |
| 209 | Ga0105238_10512676 | 3300009551 | Bacteria | 1201 |
| 210 | Ga0105249_10010310 | 3300009553 | Bacteria | 8211 |
| 211 | Ga0105249_10069819 | 3300009553 | Unclassified | 3243 |
| 212 | Ga0105249_10212988 | 3300009553 | Unclassified | 1897 |
| 213 | Ga0105249_10235648 | 3300009553 | Bacteria | 1807 |
| 214 | Ga0105249_10595025 | 3300009553 | Bacteria | 1160 |
| 215 | Ga0105239_10003875 | 3300010375 | Bacteria | 18149 |
| 216 | Ga0105239_10006776 | 3300010375 | Bacteria | 13228 |
| 217 | Ga0105239_10914193 | 3300010375 | Bacteria | 1007 |
| 218 | Ga0105246_10048552 | 3300011119 | Bacteria | 2902 |
| 219 | Ga0105246_11188633 | 3300011119 | Bacteria | 701 |
| 220 | Ga0157378_10000139 | 3300013297 | Bacteria | 68304 |
| 221 | Ga0163162_10003097 | 3300013306 | Bacteria | 15878 |
| 222 | Ga0163162_10029330 | 3300013306 | Bacteria | 5444 |
| 223 | Ga0163162_10873565 | 3300013306 | Bacteria | 1013 |
| 224 | Ga0157372_10118575 | 3300013307 | Unclassified | 3037 |
| 225 | Ga0157375_10070463 | 3300013308 | Bacteria | 3506 |
| 226 | Ga0157375_10071737 | 3300013308 | Unclassified | 3478 |
| 227 | Ga0157375_11985476 | 3300013308 | Bacteria | 691 |
| 228 | Ga0163163_10026921 | 3300014325 | Bacteria | 5501 |
| 229 | Ga0163163_10084441 | 3300014325 | Unclassified | 3181 |
| 230 | Ga0163163_10090141 | 3300014325 | Unclassified | 3079 |
| 231 | Ga0163163_10316965 | 3300014325 | Unclassified | 1613 |
| 232 | Ga0157380_10008310 | 3300014326 | Bacteria | 7397 |
| 233 | Ga0157377_10371196 | 3300014745 | Bacteria | 966 |
| 234 | Ga0157379_10010151 | 3300014968 | Bacteria | 8208 |
| 235 | Ga0157379_10122476 | 3300014968 | Bacteria | 2340 |
| 236 | Ga0157379_10149548 | 3300014968 | Unclassified | 2106 |
| 237 | Ga0157379_10755839 | 3300014968 | Bacteria | 915 |
| 238 | Ga0157379_11716877 | 3300014968 | Bacteria | 615 |
| 239 | Ga0157376_10615504 | 3300014969 | Bacteria | 1082 |
| 240 | Ga0163161_10071511 | 3300017792 | Bacteria | 2539 |
| 241 | Ga0207697_10017558 | 3300025315 | Bacteria | 2940 |
| 242 | Ga0207656_10451414 | 3300025321 | Unclassified | 650 |
| 243 | Ga0207680_10150828 | 3300025903 | Bacteria | 1549 |
| 244 | Ga0207645_10001229 | 3300025907 | Bacteria | 21105 |
| 245 | Ga0207643_10001967 | 3300025908 | Bacteria | 11341 |
| 246 | Ga0207684_10026040 | 3300025910 | Bacteria | 4985 |
| 247 | Ga0207684_10411301 | 3300025910 | Bacteria | 1163 |
| 248 | Ga0207654_10017992 | 3300025911 | Unclassified | 3704 |
| 249 | Ga0207654_10289596 | 3300025911 | Bacteria | 1110 |
| 250 | Ga0207707_10028011 | 3300025912 | Unclassified | 4925 |
| 251 | Ga0207707_10037864 | 3300025912 | Bacteria | 4214 |
| 252 | Ga0207707_10136560 | 3300025912 | Bacteria | 2144 |
| 253 | Ga0207707_10211565 | 3300025912 | Unclassified | 1689 |
| 254 | Ga0207695_10257778 | 3300025913 | Bacteria | 1642 |
| 255 | Ga0207693_10062567 | 3300025915 | Unclassified | 2915 |
| 256 | Ga0207693_10071148 | 3300025915 | Unclassified | 2722 |
| 257 | Ga0207663_10064518 | 3300025916 | Bacteria | 2337 |
| 258 | Ga0207663_10186168 | 3300025916 | Bacteria | 1487 |
| 259 | Ga0207660_10041961 | 3300025917 | Bacteria | 3209 |
| 260 | Ga0207660_10523827 | 3300025917 | Bacteria | 963 |
| 261 | Ga0207657_10200591 | 3300025919 | Unclassified | 1605 |
| 262 | Ga0207649_10494772 | 3300025920 | Bacteria | 929 |
| 263 | Ga0207652_10016876 | 3300025921 | Bacteria | 5969 |
| 264 | Ga0207652_10659745 | 3300025921 | Bacteria | 935 |
| 265 | Ga0207646_10026635 | 3300025922 | Bacteria | 5274 |
| 266 | Ga0207646_10220250 | 3300025922 | Bacteria | 1714 |
| 267 | Ga0207646_10239499 | 3300025922 | Bacteria | 1639 |
| 268 | Ga0207646_10356708 | 3300025922 | Unclassified | 1321 |
| 269 | Ga0207681_10007199 | 3300025923 | Bacteria | 6825 |
| 270 | Ga0207659_10050023 | 3300025926 | Bacteria | 2967 |
| 271 | Ga0207659_10081037 | 3300025926 | Bacteria | 2399 |
| 272 | Ga0207659_10138290 | 3300025926 | Bacteria | 1888 |
| 273 | Ga0207687_10162736 | 3300025927 | Bacteria | 1714 |
| 274 | Ga0207644_10148016 | 3300025931 | Unclassified | 1815 |
| 275 | Ga0207644_10788811 | 3300025931 | Bacteria | 794 |
| 276 | Ga0207690_10152833 | 3300025932 | Bacteria | 1713 |
| 277 | Ga0207690_10209958 | 3300025932 | Bacteria | 1484 |
| 278 | Ga0207690_10453253 | 3300025932 | Bacteria | 1031 |
| 279 | Ga0207706_10000011 | 3300025933 | Bacteria | 196033 |
| 280 | Ga0207706_10249272 | 3300025933 | Bacteria | 1551 |
| 281 | Ga0207706_10869204 | 3300025933 | Bacteria | 763 |
| 282 | Ga0207686_10000172 | 3300025934 | Bacteria | 49408 |
| 283 | Ga0207709_10007865 | 3300025935 | Bacteria | 5909 |
| 284 | Ga0207669_10000157 | 3300025937 | Bacteria | 32354 |
| 285 | Ga0207669_10830320 | 3300025937 | Bacteria | 768 |
| 286 | Ga0207704_10002088 | 3300025938 | Bacteria | 8954 |
| 287 | Ga0207704_10489588 | 3300025938 | Bacteria | 989 |
| 288 | Ga0207711_10002317 | 3300025941 | Bacteria | 17057 |
| 289 | Ga0207711_10266398 | 3300025941 | Bacteria | 1576 |
| 290 | Ga0207711_10286177 | 3300025941 | Bacteria | 1518 |
| 291 | Ga0207689_10037850 | 3300025942 | Bacteria | 3998 |
| 292 | Ga0207679_10009543 | 3300025945 | Bacteria | 6220 |
| 293 | Ga0207679_10280425 | 3300025945 | Bacteria | 1429 |
| 294 | Ga0207679_10665883 | 3300025945 | Bacteria | 942 |
| 295 | Ga0207651_10438928 | 3300025960 | Bacteria | 1118 |
| 296 | Ga0207712_10002980 | 3300025961 | Bacteria | 10809 |
| 297 | Ga0207712_10038810 | 3300025961 | Unclassified | 3258 |
| 298 | Ga0207712_10513498 | 3300025961 | Unclassified | 1026 |
| 299 | Ga0207658_10913867 | 3300025986 | Bacteria | 799 |
| 300 | Ga0207703_10024972 | 3300026035 | Unclassified | 4701 |
| 301 | Ga0207703_10418405 | 3300026035 | Unclassified | 1246 |
| 302 | Ga0207639_10544067 | 3300026041 | Bacteria | 1065 |
| 303 | Ga0207639_10621818 | 3300026041 | Bacteria | 997 |
| 304 | Ga0207678_10064660 | 3300026067 | Unclassified | 3143 |
| 305 | Ga0207678_10130704 | 3300026067 | Bacteria | 2142 |
| 306 | Ga0207678_10468046 | 3300026067 | Unclassified | 1097 |
| 307 | Ga0207678_10805971 | 3300026067 | Unclassified | 829 |
| 308 | Ga0207708_10253435 | 3300026075 | Bacteria | 1419 |
| 309 | Ga0207702_10942387 | 3300026078 | Bacteria | 856 |
| 310 | Ga0207641_10027227 | 3300026088 | Bacteria | 4721 |
| 311 | Ga0207641_10037905 | 3300026088 | Unclassified | 4028 |
| 312 | Ga0207641_11281545 | 3300026088 | Bacteria | 733 |
| 313 | Ga0207648_10000011 | 3300026089 | Bacteria | 182284 |
| 314 | Ga0207648_10333426 | 3300026089 | Bacteria | 1365 |
| 315 | Ga0207676_10006300 | 3300026095 | Bacteria | 8381 |
| 316 | Ga0207676_10340579 | 3300026095 | Bacteria | 1383 |
| 317 | Ga0207676_10635609 | 3300026095 | Bacteria | 1028 |
| 318 | Ga0207674_10765498 | 3300026116 | Unclassified | 932 |
| 319 | Ga0207675_100011521 | 3300026118 | Bacteria | 8274 |
| 320 | Ga0207683_10001778 | 3300026121 | Bacteria | 19080 |
| 321 | Ga0207698_10498510 | 3300026142 | Bacteria | 1185 |
| 322 | Ga0207698_11037715 | 3300026142 | Bacteria | 831 |
| 323 | Ga0210000_1033317 | 3300027462 | Bacteria | 809 |
| 324 | Ga0209974_10017856 | 3300027876 | Bacteria | 2353 |
| 325 | Ga0209974_10032063 | 3300027876 | Bacteria | 1741 |
| 326 | Ga0268266_10075592 | 3300028379 | Unclassified | 2926 |
| 327 | Ga0268265_10061627 | 3300028380 | Bacteria | 2879 |
| 328 | Ga0268265_10512233 | 3300028380 | Bacteria | 1133 |
| 329 | Ga0268264_10007728 | 3300028381 | Bacteria | 8957 |
| 330 | Ga0268264_10843938 | 3300028381 | Bacteria | 917 |
| 331 | Ga0307408_100051148 | 3300031548 | Unclassified | 2975 |
| 332 | Ga0307408_100165045 | 3300031548 | Bacteria | 1763 |
| 333 | Ga0307408_100229906 | 3300031548 | Unclassified | 1518 |
| 334 | Ga0307408_100287984 | 3300031548 | Bacteria | 1370 |
| 335 | Ga0307408_100404857 | 3300031548 | Bacteria | 1172 |
| 336 | Ga0307408_100785642 | 3300031548 | Bacteria | 863 |
| 337 | Ga0307405_10004165 | 3300031731 | Bacteria | 6804 |
| 338 | Ga0307405_10033580 | 3300031731 | Bacteria | 3045 |
| 339 | Ga0307405_10510436 | 3300031731 | Bacteria | 965 |
| 340 | Ga0307413_10004454 | 3300031824 | Bacteria | 6100 |
| 341 | Ga0307413_10007272 | 3300031824 | Bacteria | 5127 |
| 342 | Ga0307413_10007540 | 3300031824 | Bacteria | 5060 |
| 343 | Ga0307413_10017314 | 3300031824 | Bacteria | 3750 |
| 344 | Ga0307413_10059813 | 3300031824 | Bacteria | 2342 |
| 345 | Ga0307413_10060053 | 3300031824 | Bacteria | 2339 |
| 346 | Ga0307413_10099250 | 3300031824 | Bacteria | 1919 |
| 347 | Ga0307410_10002699 | 3300031852 | Bacteria | 8663 |
| 348 | Ga0307410_10057586 | 3300031852 | Bacteria | 2647 |
| 349 | Ga0307410_10131559 | 3300031852 | Bacteria | 1838 |
| 350 | Ga0307410_10585503 | 3300031852 | Bacteria | 929 |
| 351 | Ga0307410_10708428 | 3300031852 | Unclassified | 849 |
| 352 | Ga0307406_10679428 | 3300031901 | Bacteria | 857 |
| 353 | Ga0307407_10005734 | 3300031903 | Bacteria | 5425 |
| 354 | Ga0307407_10018773 | 3300031903 | Unclassified | 3506 |
| 355 | Ga0307407_10100741 | 3300031903 | Unclassified | 1792 |
| 356 | Ga0307407_10224024 | 3300031903 | Bacteria | 1273 |
| 357 | Ga0307407_10603569 | 3300031903 | Bacteria | 817 |
| 358 | Ga0307412_10011948 | 3300031911 | Bacteria | 5045 |
| 359 | Ga0307412_10154589 | 3300031911 | Bacteria | 1697 |
| 360 | Ga0307412_10309156 | 3300031911 | Bacteria | 1252 |
| 361 | Ga0307409_100002275 | 3300031995 | Bacteria | 9945 |
| 362 | Ga0307409_100091330 | 3300031995 | Bacteria | 2495 |
| 363 | Ga0307409_100096578 | 3300031995 | Bacteria | 2438 |
| 364 | Ga0307409_100160884 | 3300031995 | Bacteria | 1963 |
| 365 | Ga0307416_100024136 | 3300032002 | Bacteria | 4431 |
| 366 | Ga0307416_100029603 | 3300032002 | Bacteria | 4094 |
| 367 | Ga0307416_100045355 | 3300032002 | Bacteria | 3461 |
| 368 | Ga0307416_100072270 | 3300032002 | Unclassified | 2870 |
| 369 | Ga0307416_100079063 | 3300032002 | Bacteria | 2770 |
| 370 | Ga0307416_100086280 | 3300032002 | Bacteria | 2675 |
| 371 | Ga0307416_100625476 | 3300032002 | Unclassified | 1159 |
| 372 | Ga0307414_10006731 | 3300032004 | Bacteria | 6429 |
| 373 | Ga0307414_10041942 | 3300032004 | Bacteria | 3105 |
| 374 | Ga0307414_10088458 | 3300032004 | Bacteria | 2292 |
| 375 | Ga0307414_10101065 | 3300032004 | Bacteria | 2170 |
| 376 | Ga0307414_10228280 | 3300032004 | Unclassified | 1533 |
| 377 | Ga0307411_10012443 | 3300032005 | Unclassified | 4644 |
| 378 | Ga0307411_10024192 | 3300032005 | Unclassified | 3616 |
| 379 | Ga0307411_10128694 | 3300032005 | Bacteria | 1846 |
| 380 | Ga0307411_10345284 | 3300032005 | Bacteria | 1211 |
| 381 | Ga0307411_10770474 | 3300032005 | Bacteria | 844 |
| 382 | Ga0307411_10826035 | 3300032005 | Unclassified | 818 |
| 383 | Ga0307415_100011456 | 3300032126 | Bacteria | 5076 |
| 384 | Ga0307415_100087846 | 3300032126 | Bacteria | 2241 |
| 385 | Ga0307415_100118496 | 3300032126 | Unclassified | 1980 |
| 386 | Ga0307415_100125838 | 3300032126 | Bacteria | 1931 |
| 387 | Ga0307415_100163279 | 3300032126 | Unclassified | 1729 |
| 388 | Ga0307415_100286558 | 3300032126 | Bacteria | 1357 |
| 389 | Ga0373928_0030593 | 3300035084 | Bacteria | 1191 |
| 390 | Ga0373928_0143468 | 3300035084 | Bacteria | 656 |
| 391 | Ga0373929_0020923 | 3300035085 | Bacteria | 1323 |
| 392 | Ga0373940_0170410 | 3300035088 | Bacteria | 703 |
| 393 | Ga0373949_0144662 | 3300035090 | Bacteria | 683 |
| 394 | Ga0373951_0150653 | 3300035091 | Bacteria | 652 |
| 395 | Ga0373932_0246169 | 3300035112 | Bacteria | 651 |
| 396 | Ga0373939_0094819 | 3300035114 | Bacteria | 1015 |
| 397 | Ga0373939_0103729 | 3300035114 | Bacteria | 980 |
| 398 | Ga0373941_0160611 | 3300035115 | Bacteria | 831 |
| 399 | Ga0373960_0174229 | 3300035121 | Bacteria | 748 |
| 400 | Ga0373961_0044322 | 3300035241 | Unclassified | 1297 |
| 401 | Ga0373961_0085816 | 3300035241 | Bacteria | 998 |
| 402 | Ga0373961_0139437 | 3300035241 | Bacteria | 818 |
| 403 | Ga0373962_0025813 | 3300035242 | Bacteria | 1580 |
| 404 | Ga0316574_0045654 | 3300035398 | Bacteria | 2714 |
| 405 | Ga0373931_0127275 | 3300035691 | Bacteria | 1462 |
| 406 | Ga0373931_0753738 | 3300035691 | Bacteria | 646 |
| 407 | Ga0373925_0342123 | 3300037068 | Bacteria | 1214 |
| 408 | Ga0395905_0084365 | 3300037471 | Bacteria | 2976 |
| 409 | Ga0395905_0980098 | 3300037471 | Bacteria | 748 |
| 410 | Ga0395901_0833825 | 3300038443 | Unclassified | 909 |
| 411 | Ga0242420_056267 | 3300038996 | Unclassified | 777 |
| 412 | Ga0439439_0000401 | 3300041406 | Bacteria | 7230 |
| 413 | Ga0439461_0062326 | 3300041410 | Bacteria | 850 |
| 414 | Ga0451807_0740935 | 3300041486 | Unclassified | 885 |
| 415 | Ga0451807_1594444 | 3300041486 | Bacteria | 2222 |
| 416 | Ga0451849_0262525 | 3300041505 | Unclassified | 716 |
| 417 | Ga0439431_0045682 | 3300041997 | Bacteria | 1125 |
| 418 | Ga0439445_0044856 | 3300042004 | Bacteria | 1182 |
| 419 | Ga0450921_004167 | 3300042123 | Bacteria | 1046 |
| 420 | Ga0450896_020819 | 3300042133 | Unclassified | 961 |
| 421 | Ga0439446_0002474 | 3300042156 | Bacteria | 4441 |
| 422 | Ga0439446_0045349 | 3300042156 | Bacteria | 1303 |
| 423 | Ga0439434_0031575 | 3300042435 | Bacteria | 1611 |
| 424 | Ga0439435_0010258 | 3300042436 | Bacteria | 2218 |
| 425 | Ga0451577_0029171 | 3300042876 | Bacteria | 4986 |
| 426 | Ga0451577_0045051 | 3300042876 | Unclassified | 3949 |
| 427 | Ga0451577_0419946 | 3300042876 | Bacteria | 1214 |
| 428 | Ga0451577_0601089 | 3300042876 | Bacteria | 998 |
| 429 | Ga0453683_0008077 | 3300044673 | Bacteria | 7082 |
| 430 | Ga0453683_0087489 | 3300044673 | Bacteria | 1953 |
| 431 | Ga0453683_0450334 | 3300044673 | Bacteria | 832 |
| 432 | Ga0453683_0606358 | 3300044673 | Bacteria | 714 |
| 433 | Ga0453684_1097481 | 3300044712 | Unclassified | 841 |
| 434 | Ga0453684_1588892 | 3300044712 | Bacteria | 672 |
| 435 | Ga0451576_0039117 | 3300045051 | Bacteria | 5020 |
| 436 | Ga0451576_0043261 | 3300045051 | Unclassified | 4753 |
| 437 | Ga0451576_0060810 | 3300045051 | Unclassified | 3940 |
| 438 | Ga0451576_0101612 | 3300045051 | Bacteria | 2990 |
| 439 | Ga0451576_0391165 | 3300045051 | Bacteria | 1457 |
| 440 | Ga0495603_0031150 | 3300046455 | Bacteria | 3211 |
| 441 | Ga0495603_0224921 | 3300046455 | Bacteria | 1082 |
| 442 | Ga0495590_0229310 | 3300046457 | Unclassified | 688 |
| 443 | Ga0495580_0425106 | 3300046472 | Bacteria | 893 |
| 444 | Ga0495639_0025905 | 3300046475 | Bacteria | 2589 |
| 445 | Ga0495594_0003842 | 3300046499 | Bacteria | 7716 |
| 446 | Ga0495594_0537573 | 3300046499 | Bacteria | 663 |
| 447 | Ga0495618_0170710 | 3300046514 | Bacteria | 1384 |
| 448 | Ga0495628_0352962 | 3300046516 | Bacteria | 1081 |
| 449 | Ga0495644_0135173 | 3300046523 | Unclassified | 940 |
| 450 | Ga0495640_0055778 | 3300046533 | Bacteria | 2702 |
| 451 | Ga0495586_0020189 | 3300046535 | Bacteria | 3548 |
| 452 | Ga0495586_0095484 | 3300046535 | Unclassified | 1645 |
| 453 | Ga0495622_0017733 | 3300046557 | Bacteria | 3314 |
| 454 | Ga0495622_0235078 | 3300046557 | Bacteria | 809 |
| 455 | Ga0495667_0362787 | 3300046559 | Unclassified | 914 |
| 456 | Ga0495634_0003912 | 3300046642 | Bacteria | 11827 |
| 457 | Ga0495659_0093914 | 3300046664 | Bacteria | 1155 |
| 458 | Ga0495588_0173303 | 3300046674 | Bacteria | 1141 |
| 459 | Ga0495588_0183907 | 3300046674 | Bacteria | 1104 |
| 460 | Ga0495657_0184570 | 3300046675 | Unclassified | 1278 |
| 461 | Ga0495647_0004836 | 3300046681 | Bacteria | 4401 |
| 462 | Ga0495670_0310980 | 3300046691 | Bacteria | 845 |
| 463 | Ga0495636_0025903 | 3300047318 | Unclassified | 2383 |
| 464 | Ga0495674_0250267 | 3300047319 | Bacteria | 1458 |
| 465 | Ga0495676_0648973 | 3300047321 | Bacteria | 685 |
| 466 | Ga0495680_0018395 | 3300047322 | Bacteria | 5934 |
| 467 | Ga0496100_0020060 | 3300048903 | Bacteria | 4002 |
| 468 | Ga0496100_0518736 | 3300048903 | Bacteria | 919 |
| 469 | Ga0496101_0104052 | 3300048904 | Unclassified | 2129 |
| 470 | Ga0496101_0241111 | 3300048904 | Bacteria | 1407 |
| 471 | Ga0496101_0445426 | 3300048904 | Bacteria | 1022 |
| 472 | Ga0496102_0004430 | 3300048905 | Bacteria | 11860 |
| 473 | Ga0496102_0041289 | 3300048905 | Unclassified | 4176 |
| 474 | Ga0496102_0044769 | 3300048905 | Unclassified | 4017 |
| 475 | Ga0496102_0155598 | 3300048905 | Bacteria | 2149 |
| 476 | Ga0496102_0206692 | 3300048905 | Unclassified | 1851 |
| 477 | Ga0496102_1273946 | 3300048905 | Bacteria | 654 |
| 478 | Ga0496103_0017126 | 3300048906 | Bacteria | 4333 |
| 479 | Ga0496103_0270130 | 3300048906 | Bacteria | 1094 |
| 480 | Ga0496103_0436400 | 3300048906 | Bacteria | 840 |
| 481 | Ga0496104_0012154 | 3300048907 | Bacteria | 7733 |
| 482 | Ga0496104_0516753 | 3300048907 | Unclassified | 1105 |
| 483 | Ga0496104_0788460 | 3300048907 | Unclassified | 856 |
| 484 | Ga0496105_0009978 | 3300048908 | Bacteria | 7451 |
| 485 | Ga0496105_0222306 | 3300048908 | Bacteria | 1537 |
| 486 | Ga0496105_0740195 | 3300048908 | Bacteria | 752 |
| 487 | Ga0496106_0029511 | 3300048909 | Bacteria | 4087 |
| 488 | Ga0496106_0105265 | 3300048909 | Unclassified | 2192 |
| 489 | Ga0496106_0144630 | 3300048909 | Unclassified | 1872 |
| 490 | Ga0496106_0283625 | 3300048909 | Bacteria | 1327 |
| 491 | Ga0496106_0895049 | 3300048909 | Unclassified | 701 |
| 492 | Ga0496107_0068715 | 3300048910 | Bacteria | 2571 |
| 493 | Ga0496107_0137799 | 3300048910 | Bacteria | 1803 |
| 494 | Ga0496108_0000530 | 3300048911 | Bacteria | 29778 |
| 495 | Ga0496108_0017523 | 3300048911 | Bacteria | 5860 |
| 496 | Ga0496108_0371112 | 3300048911 | Unclassified | 1249 |
| 497 | Ga0496108_0375471 | 3300048911 | Unclassified | 1241 |
| 498 | Ga0496108_1015538 | 3300048911 | Unclassified | 708 |
| 499 | Ga0496109_0000886 | 3300048912 | Bacteria | 25030 |
| 500 | Ga0496109_0004406 | 3300048912 | Bacteria | 11763 |
| 501 | Ga0496109_0224109 | 3300048912 | Bacteria | 1768 |
| 502 | Ga0496109_1255686 | 3300048912 | Unclassified | 677 |
| 503 | Ga0496110_0095154 | 3300048913 | Unclassified | 2667 |
| 504 | Ga0496110_0495702 | 3300048913 | Bacteria | 1112 |
| 505 | Ga0496110_0838271 | 3300048913 | Bacteria | 824 |
| 506 | Ga0496110_0888518 | 3300048913 | Unclassified | 797 |
| 507 | Ga0496111_0008935 | 3300048914 | Bacteria | 6664 |
| 508 | Ga0496111_0017882 | 3300048914 | Bacteria | 4904 |
| 509 | Ga0496111_0033125 | 3300048914 | Unclassified | 3685 |
| 510 | Ga0496112_0000343 | 3300048915 | Bacteria | 30294 |
| 511 | Ga0496112_0006525 | 3300048915 | Bacteria | 10259 |
| 512 | Ga0496112_0025908 | 3300048915 | Bacteria | 5635 |
| 513 | Ga0496112_0048083 | 3300048915 | Bacteria | 4184 |
| 514 | Ga0496113_0000225 | 3300048916 | Bacteria | 26482 |
| 515 | Ga0496113_0001395 | 3300048916 | Bacteria | 13437 |
| 516 | Ga0496114_0045367 | 3300048917 | Bacteria | 3651 |
| 517 | Ga0496114_0130019 | 3300048917 | Unclassified | 2174 |
| 518 | Ga0496115_0238999 | 3300048918 | Unclassified | 1497 |
| 519 | Ga0496115_0673009 | 3300048918 | Unclassified | 816 |
| 520 | Ga0501031_0240090 | 3300049568 | Bacteria | 1178 |
| 521 | Ga0501033_0124194 | 3300049570 | Bacteria | 1872 |
| 522 | Ga0501033_0406181 | 3300049570 | Bacteria | 949 |
| 523 | Ga0501034_0044000 | 3300049571 | Bacteria | 4516 |
| 524 | Ga0501034_0114976 | 3300049571 | Bacteria | 2679 |
| 525 | Ga0501036_0257200 | 3300049572 | Bacteria | 1463 |
| 526 | Ga0501036_0330619 | 3300049572 | Bacteria | 1273 |
| 527 | Ga0501037_0319468 | 3300049573 | Bacteria | 1075 |
| 528 | Ga0501038_0105018 | 3300049574 | Bacteria | 2347 |
| 529 | Ga0501038_0574207 | 3300049574 | Bacteria | 856 |
| 530 | Ga0501040_0025937 | 3300049576 | Bacteria | 3943 |
| 531 | Ga0501040_0583164 | 3300049576 | Bacteria | 807 |
| 532 | Ga0501041_0158922 | 3300049577 | Bacteria | 1412 |
| 533 | Ga0501041_0509884 | 3300049577 | Bacteria | 765 |
| 534 | Ga0501043_0792777 | 3300049579 | Unclassified | 686 |
| 535 | Ga0501046_0017035 | 3300049580 | Bacteria | 6075 |
| 536 | Ga0501046_0118158 | 3300049580 | Bacteria | 2019 |
| 537 | Ga0501048_0065316 | 3300049582 | Bacteria | 2573 |
| 538 | Ga0501048_0482762 | 3300049582 | Unclassified | 888 |
| 539 | Ga0501067_0005831 | 3300049583 | Bacteria | 6831 |
| 540 | Ga0501067_0009208 | 3300049583 | Bacteria | 5468 |
| 541 | Ga0501067_0071434 | 3300049583 | Bacteria | 1922 |
| 542 | Ga0501067_0130298 | 3300049583 | Bacteria | 1400 |
| 543 | Ga0501067_0287159 | 3300049583 | Bacteria | 916 |
| 544 | Ga0501068_0001812 | 3300049584 | Bacteria | 11354 |
| 545 | Ga0501068_0007727 | 3300049584 | Bacteria | 5950 |
| 546 | Ga0501068_0102951 | 3300049584 | Unclassified | 1770 |
| 547 | Ga0501068_0245079 | 3300049584 | Bacteria | 1141 |
| 548 | Ga0501069_0012776 | 3300049585 | Bacteria | 4470 |
| 549 | Ga0501069_0014049 | 3300049585 | Bacteria | 4277 |
| 550 | Ga0501069_0061873 | 3300049585 | Bacteria | 2090 |
| 551 | Ga0501069_0106809 | 3300049585 | Bacteria | 1592 |
| 552 | Ga0501069_0291042 | 3300049585 | Bacteria | 957 |
| 553 | Ga0501070_0015434 | 3300049586 | Bacteria | 6425 |
| 554 | Ga0501070_0033441 | 3300049586 | Bacteria | 4302 |
| 555 | Ga0501070_0045161 | 3300049586 | Bacteria | 3665 |
| 556 | Ga0501070_0083776 | 3300049586 | Unclassified | 2640 |
| 557 | Ga0501070_0102547 | 3300049586 | Unclassified | 2366 |
| 558 | Ga0501071_0004064 | 3300049587 | Bacteria | 9243 |
| 559 | Ga0501071_0008957 | 3300049587 | Bacteria | 6639 |
| 560 | Ga0501071_0271055 | 3300049587 | Unclassified | 1283 |
| 561 | Ga0501071_0420351 | 3300049587 | Unclassified | 1021 |
| 562 | Ga0501071_0546085 | 3300049587 | Bacteria | 890 |
| 563 | Ga0501072_0018594 | 3300049588 | Bacteria | 5355 |
| 564 | Ga0501072_0026418 | 3300049588 | Bacteria | 4527 |
| 565 | Ga0501072_0042841 | 3300049588 | Bacteria | 3556 |
| 566 | Ga0501072_0048033 | 3300049588 | Bacteria | 3361 |
| 567 | Ga0501072_0730500 | 3300049588 | Bacteria | 777 |
| 568 | Ga0501073_0029915 | 3300049589 | Bacteria | 3889 |
| 569 | Ga0501073_0045950 | 3300049589 | Unclassified | 3074 |
| 570 | Ga0501073_0052803 | 3300049589 | Bacteria | 2845 |
| 571 | Ga0501073_0191313 | 3300049589 | Bacteria | 1416 |
| 572 | Ga0501074_0008030 | 3300049590 | Bacteria | 7643 |
| 573 | Ga0501074_0022454 | 3300049590 | Bacteria | 4584 |
| 574 | Ga0501074_0046206 | 3300049590 | Bacteria | 3148 |
| 575 | Ga0501074_0157615 | 3300049590 | Unclassified | 1621 |
| 576 | Ga0501075_0010146 | 3300049591 | Bacteria | 6610 |
| 577 | Ga0501075_0029007 | 3300049591 | Bacteria | 4090 |
| 578 | Ga0501075_0178679 | 3300049591 | Unclassified | 1620 |
| 579 | Ga0501075_0297449 | 3300049591 | Bacteria | 1230 |
| 580 | Ga0501076_0007418 | 3300049592 | Bacteria | 7981 |
| 581 | Ga0501076_0080019 | 3300049592 | Bacteria | 2622 |
| 582 | Ga0501076_0124950 | 3300049592 | Unclassified | 2085 |
| 583 | Ga0501076_0410356 | 3300049592 | Bacteria | 1114 |
| 584 | Ga0501076_0516432 | 3300049592 | Bacteria | 985 |
| 585 | Ga0501077_0000260 | 3300049593 | Bacteria | 31177 |
| 586 | Ga0501077_0020192 | 3300049593 | Bacteria | 4218 |
| 587 | Ga0501077_0045986 | 3300049593 | Bacteria | 2773 |
| 588 | Ga0501077_0576539 | 3300049593 | Unclassified | 722 |
| 589 | Ga0501202_089866 | 3300049652 | Bacteria | 733 |
| 590 | Ga0501216_034690 | 3300049660 | Bacteria | 946 |
| 591 | Ga0501217_019707 | 3300049661 | Bacteria | 1578 |
| 592 | Ga0501217_020278 | 3300049661 | Unclassified | 1560 |
| 593 | Ga0501233_010892 | 3300049668 | Bacteria | 1800 |
| 594 | Ga0501249_061784 | 3300049679 | Bacteria | 868 |
| 595 | Ga0501253_030460 | 3300049683 | Bacteria | 1025 |
| 596 | Ga0501257_072002 | 3300049686 | Unclassified | 884 |
| 597 | Ga0501221_011185 | 3300049704 | Bacteria | 1610 |
| 598 | Ga0501234_025380 | 3300049707 | Bacteria | 951 |
| 599 | Ga0501079_0006682 | 3300049741 | Bacteria | 8675 |
| 600 | Ga0501079_0023522 | 3300049741 | Bacteria | 4728 |
| 601 | Ga0501079_0225833 | 3300049741 | Unclassified | 1463 |
| 602 | Ga0501079_0357893 | 3300049741 | Bacteria | 1144 |
| 603 | Ga0501079_0859297 | 3300049741 | Bacteria | 714 |
| 604 | Ga0501080_0032078 | 3300049742 | Bacteria | 4897 |
| 605 | Ga0501080_0039082 | 3300049742 | Bacteria | 4429 |
| 606 | Ga0501080_0047393 | 3300049742 | Unclassified | 4000 |
| 607 | Ga0501080_0071855 | 3300049742 | Bacteria | 3219 |
| 608 | Ga0501080_0127719 | 3300049742 | Bacteria | 2354 |
| 609 | Ga0501080_0728523 | 3300049742 | Bacteria | 873 |
| 610 | Ga0501080_0821118 | 3300049742 | Unclassified | 814 |
| 611 | Ga0501080_1105087 | 3300049742 | Unclassified | 684 |
| 612 | Ga0501081_0060736 | 3300049743 | Bacteria | 2619 |
| 613 | Ga0501081_0063481 | 3300049743 | Bacteria | 2563 |
| 614 | Ga0501081_0168698 | 3300049743 | Unclassified | 1580 |
| 615 | Ga0501081_0276618 | 3300049743 | Unclassified | 1228 |
| 616 | Ga0501081_0837442 | 3300049743 | Bacteria | 693 |
| 617 | Ga0501083_0004893 | 3300049744 | Bacteria | 9472 |
| 618 | Ga0501083_0084757 | 3300049744 | Bacteria | 2097 |
| 619 | Ga0501083_0114634 | 3300049744 | Bacteria | 1770 |
| 620 | Ga0501083_0578988 | 3300049744 | Unclassified | 730 |
| 621 | Ga0501268_040747 | 3300049765 | Bacteria | 873 |
| 622 | Ga0501270_008297 | 3300049767 | Bacteria | 1310 |
| 623 | Ga0501270_029083 | 3300049767 | Bacteria | 900 |
| 624 | Ga0501045_0012832 | 3300049824 | Bacteria | 5906 |
| 625 | Ga0501045_0015441 | 3300049824 | Bacteria | 5418 |
| 626 | Ga0501045_0179605 | 3300049824 | Unclassified | 1577 |
| 627 | Ga0501045_0517635 | 3300049824 | Unclassified | 886 |
| 628 | Ga0501045_0723335 | 3300049824 | Unclassified | 734 |
| 629 | Ga0501212_014727 | 3300049851 | Bacteria | 1160 |
| 630 | nmdc:mga05p37_105756_c1 | 3300050507 | Bacteria | 3462 |
| 631 | nmdc:mga05p37_11492_c1 | 3300050507 | Bacteria | 10547 |
| 632 | nmdc:mga05p37_1174461_c1 | 3300050507 | Bacteria | 796 |
| 633 | nmdc:mga05p37_138024_c1 | 3300050507 | Bacteria | 2988 |
| 634 | nmdc:mga05p37_165311_c1 | 3300050507 | Bacteria | 2701 |
| 635 | nmdc:mga05p37_170861_c1 | 3300050507 | Bacteria | 2651 |
| 636 | nmdc:mga05p37_360796_c1 | 3300050507 | Unclassified | 1708 |
| 637 | nmdc:mga05p37_402334_c1 | 3300050507 | Bacteria | 1598 |
| 638 | nmdc:mga05p37_763454_c1 | 3300050507 | Unclassified | 1064 |
| 639 | nmdc:mga09592_136933_c1 | 3300050508 | Bacteria | 2109 |
| 640 | nmdc:mga09592_23347_c1 | 3300050508 | Bacteria | 5108 |
| 641 | nmdc:mga09592_364767_c1 | 3300050508 | Unclassified | 1250 |
| 642 | nmdc:mga09592_483369_c1 | 3300050508 | Unclassified | 1067 |
| 643 | nmdc:mga09592_771467_c1 | 3300050508 | Bacteria | 815 |
| 644 | nmdc:mga0qj67_198609_c1 | 3300050509 | Bacteria | 1630 |
| 645 | nmdc:mga0qj67_459318_c1 | 3300050509 | Bacteria | 1025 |
| 646 | nmdc:mga06r32_20739_c1 | 3300050510 | Bacteria | 6053 |
| 647 | nmdc:mga06r32_227606_c1 | 3300050510 | Bacteria | 1853 |
| 648 | nmdc:mga06r32_58229_c1 | 3300050510 | Bacteria | 3713 |
| 649 | nmdc:mga06r32_70819_c1 | 3300050510 | Unclassified | 3373 |
| 650 | nmdc:mga06r32_943816_c1 | 3300050510 | Unclassified | 817 |
| 651 | nmdc:mga08y16_412358_c1 | 3300050511 | Bacteria | 1381 |
| 652 | nmdc:mga08y16_690933_c1 | 3300050511 | Unclassified | 1021 |
| 653 | nmdc:mga0n895_1142893_c1 | 3300050512 | Bacteria | 754 |
| 654 | nmdc:mga0n895_2011_c1 | 3300050512 | Bacteria | 15626 |
| 655 | nmdc:mga0n895_540458_c1 | 3300050512 | Archaea | 1172 |
| 656 | nmdc:mga0n895_893884_c1 | 3300050512 | Bacteria | 874 |
| 657 | nmdc:mga0n895_918982_c1 | 3300050512 | Bacteria | 860 |
| 658 | nmdc:mga0rr50_243400_c1 | 3300050513 | Bacteria | 1491 |
| 659 | nmdc:mga0rr50_365627_c1 | 3300050513 | Unclassified | 1215 |
| 660 | nmdc:mga0rr50_95824_c1 | 3300050513 | Unclassified | 2320 |
| 661 | nmdc:mga08x19_10821_c1 | 3300050514 | Bacteria | 5486 |
| 662 | nmdc:mga0a205_130456_c1 | 3300050515 | Bacteria | 2414 |
| 663 | nmdc:mga0a205_185057_c1 | 3300050515 | Bacteria | 1976 |
| 664 | nmdc:mga0a205_535171_c1 | 3300050515 | Bacteria | 1027 |
| 665 | nmdc:mga0a205_59556_c1 | 3300050515 | Bacteria | 3688 |
| 666 | nmdc:mga0a205_83247_c1 | 3300050515 | Bacteria | 3090 |
| 667 | Ga0501084_0012198 | 3300054114 | Bacteria | 7111 |
| 668 | Ga0501084_0018137 | 3300054114 | Bacteria | 5862 |
| 669 | Ga0501084_0032795 | 3300054114 | Bacteria | 4346 |
| 670 | Ga0501084_0078704 | 3300054114 | Unclassified | 2763 |
| 671 | Ga0501084_0116453 | 3300054114 | Bacteria | 2246 |
| 672 | Ga0501084_0180567 | 3300054114 | Bacteria | 1781 |
| 673 | Ga0501084_0188597 | 3300054114 | Bacteria | 1740 |
| 674 | Ga0590071_014604 | 3300059421 | Bacteria | 1842 |
| 675 | Ga0590074_036714 | 3300059423 | Unclassified | 876 |
| 676 | Ga0590075_004856 | 3300059424 | Bacteria | 3180 |
| 677 | Ga0590075_016974 | 3300059424 | Archaea | 1793 |
| 678 | Ga0501082_0023164 | 3300060353 | Bacteria | 5356 |
| 679 | Ga0501082_0048394 | 3300060353 | Bacteria | 3664 |
| 680 | Ga0501082_0079964 | 3300060353 | Bacteria | 2820 |
| 681 | Ga0501082_0156280 | 3300060353 | Bacteria | 1981 |
| 682 | Ga0501082_0195226 | 3300060353 | Bacteria | 1761 |
| 683 | Ga0501082_0300056 | 3300060353 | Bacteria | 1399 |
| 684 | Ga0530510_0025511 | 3300061734 | Bacteria | 4227 |
| 685 | Ga0530510_0085130 | 3300061734 | Unclassified | 2303 |
| 686 | Ga0530510_0370164 | 3300061734 | Bacteria | 1078 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_11716877 | Ga0157379_117168771 | 167 |
| 2 | 3300005336 | Ga0070680_100029768 | Ga0070680_1000297684 | 176 |
| 3 | 3300005445 | Ga0070708_100041538 | Ga0070708_1000415383 | 176 |
| 4 | 3300005458 | Ga0070681_10137902 | Ga0070681_101379023 | 176 |
| 5 | 3300005468 | Ga0070707_100531370 | Ga0070707_1005313701 | 176 |
| 6 | 3300005530 | Ga0070679_100117920 | Ga0070679_1001179204 | 176 |
| 7 | 3300005536 | Ga0070697_100924547 | Ga0070697_1009245471 | 176 |
| 8 | 3300005546 | Ga0070696_100199998 | Ga0070696_1001999982 | 176 |
| 9 | 3300005547 | Ga0070693_100141054 | Ga0070693_1001410543 | 176 |
| 10 | 3300006844 | Ga0075428_100207787 | Ga0075428_1002077872 | 176 |
| 11 | 3300006847 | Ga0075431_100063152 | Ga0075431_1000631523 | 176 |
| 12 | 3300006852 | Ga0075433_10116747 | Ga0075433_101167472 | 176 |
| 13 | 3300006871 | Ga0075434_100001345 | Ga0075434_10000134510 | 176 |
| 14 | 3300006880 | Ga0075429_100043499 | Ga0075429_1000434992 | 176 |
| 15 | 3300009147 | Ga0114129_10308410 | Ga0114129_103084102 | 176 |
| 16 | 3300025912 | Ga0207707_10028011 | Ga0207707_100280112 | 176 |
| 17 | 3300025917 | Ga0207660_10041961 | Ga0207660_100419612 | 176 |
| 18 | 3300025921 | Ga0207652_10016876 | Ga0207652_100168768 | 176 |
| 19 | 3300025922 | Ga0207646_10356708 | Ga0207646_103567082 | 176 |
| 20 | 3300042876 | Ga0451577_0419946 | Ga0451577_0419946_74_610 | 176 |
| 21 | 3300044673 | Ga0453683_0008077 | Ga0453683_0008077_870_1406 | 176 |
| 22 | 3300044673 | Ga0453683_0606358 | Ga0453683_0606358_150_686 | 176 |
| 23 | 3300045051 | Ga0451576_0039117 | Ga0451576_0039117_3891_4427 | 176 |
| 24 | 3300045051 | Ga0451576_0391165 | Ga0451576_0391165_277_813 | 176 |
| 25 | 3300049571 | Ga0501034_0044000 | Ga0501034_0044000_3798_4331 | 176 |
| 26 | 3300049571 | Ga0501034_0114976 | Ga0501034_0114976_2106_2639 | 176 |
| 27 | 3300049572 | Ga0501036_0257200 | Ga0501036_0257200_695_1228 | 176 |
| 28 | 3300049579 | Ga0501043_0792777 | Ga0501043_0792777_67_600 | 176 |
| 29 | 3300049583 | Ga0501067_0005831 | Ga0501067_0005831_5183_5716 | 176 |
| 30 | 3300049583 | Ga0501067_0009208 | Ga0501067_0009208_261_794 | 176 |
| 31 | 3300049584 | Ga0501068_0001812 | Ga0501068_0001812_2887_3420 | 176 |
| 32 | 3300049584 | Ga0501068_0007727 | Ga0501068_0007727_227_760 | 176 |
| 33 | 3300049585 | Ga0501069_0012776 | Ga0501069_0012776_170_703 | 176 |
| 34 | 3300049585 | Ga0501069_0014049 | Ga0501069_0014049_2532_3065 | 176 |
| 35 | 3300049585 | Ga0501069_0061873 | Ga0501069_0061873_1532_2065 | 176 |
| 36 | 3300049586 | Ga0501070_0015434 | Ga0501070_0015434_757_1290 | 176 |
| 37 | 3300049586 | Ga0501070_0033441 | Ga0501070_0033441_125_658 | 176 |
| 38 | 3300049586 | Ga0501070_0045161 | Ga0501070_0045161_682_1215 | 176 |
| 39 | 3300049586 | Ga0501070_0083776 | Ga0501070_0083776_1305_1838 | 176 |
| 40 | 3300049587 | Ga0501071_0004064 | Ga0501071_0004064_4186_4719 | 176 |
| 41 | 3300049587 | Ga0501071_0420351 | Ga0501071_0420351_398_931 | 176 |
| 42 | 3300049588 | Ga0501072_0018594 | Ga0501072_0018594_4066_4599 | 176 |
| 43 | 3300049588 | Ga0501072_0042841 | Ga0501072_0042841_2985_3518 | 176 |
| 44 | 3300049589 | Ga0501073_0029915 | Ga0501073_0029915_2539_3072 | 176 |
| 45 | 3300049589 | Ga0501073_0052803 | Ga0501073_0052803_259_792 | 176 |
| 46 | 3300049590 | Ga0501074_0008030 | Ga0501074_0008030_5180_5713 | 176 |
| 47 | 3300049590 | Ga0501074_0022454 | Ga0501074_0022454_3762_4295 | 176 |
| 48 | 3300049741 | Ga0501079_0357893 | Ga0501079_0357893_227_760 | 176 |
| 49 | 3300049742 | Ga0501080_0032078 | Ga0501080_0032078_2444_2977 | 176 |
| 50 | 3300049742 | Ga0501080_0047393 | Ga0501080_0047393_259_792 | 176 |
| 51 | 3300049744 | Ga0501083_0004893 | Ga0501083_0004893_3740_4273 | 176 |
| 52 | 3300049744 | Ga0501083_0084757 | Ga0501083_0084757_1523_2056 | 176 |
| 53 | 3300050507 | nmdc:mga05p37_105756_c1 | nmdc:mga05p37_105756_c1_1873_2409 | 176 |
| 54 | 3300050508 | nmdc:mga09592_23347_c1 | nmdc:mga09592_23347_c1_3960_4496 | 176 |
| 55 | 3300050510 | nmdc:mga06r32_227606_c1 | nmdc:mga06r32_227606_c1_672_1208 | 176 |
| 56 | 3300050512 | nmdc:mga0n895_540458_c1 | nmdc:mga0n895_540458_c1_321_857 | 176 |
| 57 | 3300050515 | nmdc:mga0a205_130456_c1 | nmdc:mga0a205_130456_c1_1582_2118 | 176 |
| 58 | 3300054114 | Ga0501084_0116453 | Ga0501084_0116453_1643_2176 | 176 |
| 59 | 3300054114 | Ga0501084_0180567 | Ga0501084_0180567_50_583 | 176 |
| 60 | 3300054114 | Ga0501084_0188597 | Ga0501084_0188597_32_565 | 176 |
| 61 | 3300060353 | Ga0501082_0079964 | Ga0501082_0079964_234_767 | 176 |
| 62 | 3300005444 | Ga0070694_100022371 | Ga0070694_1000223713 | 177 |
| 63 | 3300005518 | Ga0070699_100072113 | Ga0070699_1000721133 | 177 |
| 64 | 3300005545 | Ga0070695_100098576 | Ga0070695_1000985763 | 177 |
| 65 | 3300005546 | Ga0070696_100002315 | Ga0070696_10000231512 | 177 |
| 66 | 3300006847 | Ga0075431_100609703 | Ga0075431_1006097032 | 177 |
| 67 | 3300009147 | Ga0114129_10524197 | Ga0114129_105241972 | 177 |
| 68 | 3300014968 | Ga0157379_10122476 | Ga0157379_101224763 | 177 |
| 69 | 3300045051 | Ga0451576_0060810 | Ga0451576_0060810_1583_2122 | 177 |
| 70 | 3300048906 | Ga0496103_0436400 | Ga0496103_0436400_177_710 | 177 |
| 71 | 3300049583 | Ga0501067_0130298 | Ga0501067_0130298_803_1342 | 177 |
| 72 | 3300049587 | Ga0501071_0546085 | Ga0501071_0546085_63_602 | 177 |
| 73 | 3300049592 | Ga0501076_0124950 | Ga0501076_0124950_1380_1919 | 177 |
| 74 | 3300049741 | Ga0501079_0225833 | Ga0501079_0225833_102_641 | 177 |
| 75 | 3300049743 | Ga0501081_0063481 | Ga0501081_0063481_160_699 | 177 |
| 76 | 3300049824 | Ga0501045_0517635 | Ga0501045_0517635_301_834 | 177 |
| 77 | 3300050507 | nmdc:mga05p37_402334_c1 | nmdc:mga05p37_402334_c1_700_1233 | 177 |
| 78 | 3300050509 | nmdc:mga0qj67_198609_c1 | nmdc:mga0qj67_198609_c1_978_1511 | 177 |
| 79 | 3300050510 | nmdc:mga06r32_20739_c1 | nmdc:mga06r32_20739_c1_3323_3856 | 177 |
| 80 | 3300060353 | Ga0501082_0195226 | Ga0501082_0195226_832_1371 | 177 |
| 81 | 3300061734 | Ga0530510_0370164 | Ga0530510_0370164_108_641 | 177 |
| 82 | 3300004803 | Ga0058862_10047534 | Ga0058862_100475341 | 178 |
| 83 | 3300005329 | Ga0070683_101007997 | Ga0070683_1010079972 | 178 |
| 84 | 3300005330 | Ga0070690_100011251 | Ga0070690_1000112512 | 178 |
| 85 | 3300005336 | Ga0070680_100183025 | Ga0070680_1001830251 | 178 |
| 86 | 3300005336 | Ga0070680_100525113 | Ga0070680_1005251132 | 178 |
| 87 | 3300005337 | Ga0070682_100267759 | Ga0070682_1002677591 | 178 |
| 88 | 3300005339 | Ga0070660_100957345 | Ga0070660_1009573451 | 178 |
| 89 | 3300005340 | Ga0070689_101060078 | Ga0070689_1010600781 | 178 |
| 90 | 3300005341 | Ga0070691_10098121 | Ga0070691_100981211 | 178 |
| 91 | 3300005341 | Ga0070691_10262915 | Ga0070691_102629151 | 178 |
| 92 | 3300005344 | Ga0070661_100624612 | Ga0070661_1006246121 | 178 |
| 93 | 3300005345 | Ga0070692_10050709 | Ga0070692_100507092 | 178 |
| 94 | 3300005345 | Ga0070692_10512752 | Ga0070692_105127522 | 178 |
| 95 | 3300005353 | Ga0070669_100413474 | Ga0070669_1004134742 | 178 |
| 96 | 3300005354 | Ga0070675_100089952 | Ga0070675_1000899523 | 178 |
| 97 | 3300005355 | Ga0070671_100028927 | Ga0070671_1000289275 | 178 |
| 98 | 3300005365 | Ga0070688_100564168 | Ga0070688_1005641681 | 178 |
| 99 | 3300005366 | Ga0070659_100114880 | Ga0070659_1001148802 | 178 |
| 100 | 3300005366 | Ga0070659_100356395 | Ga0070659_1003563952 | 178 |
| 101 | 3300005434 | Ga0070709_10207767 | Ga0070709_102077673 | 178 |
| 102 | 3300005438 | Ga0070701_10230518 | Ga0070701_102305182 | 178 |
| 103 | 3300005439 | Ga0070711_100000102 | Ga0070711_10000010242 | 178 |
| 104 | 3300005439 | Ga0070711_100761413 | Ga0070711_1007614131 | 178 |
| 105 | 3300005440 | Ga0070705_100037361 | Ga0070705_1000373613 | 178 |
| 106 | 3300005441 | Ga0070700_100507475 | Ga0070700_1005074751 | 178 |
| 107 | 3300005444 | Ga0070694_100161116 | Ga0070694_1001611162 | 178 |
| 108 | 3300005445 | Ga0070708_100073459 | Ga0070708_1000734594 | 178 |
| 109 | 3300005445 | Ga0070708_100263574 | Ga0070708_1002635743 | 178 |
| 110 | 3300005455 | Ga0070663_100154417 | Ga0070663_1001544172 | 178 |
| 111 | 3300005455 | Ga0070663_101048340 | Ga0070663_1010483401 | 178 |
| 112 | 3300005467 | Ga0070706_100670593 | Ga0070706_1006705931 | 178 |
| 113 | 3300005467 | Ga0070706_100767066 | Ga0070706_1007670662 | 178 |
| 114 | 3300005468 | Ga0070707_100012208 | Ga0070707_1000122082 | 178 |
| 115 | 3300005468 | Ga0070707_100072853 | Ga0070707_1000728533 | 178 |
| 116 | 3300005468 | Ga0070707_100218541 | Ga0070707_1002185412 | 178 |
| 117 | 3300005468 | Ga0070707_100381693 | Ga0070707_1003816931 | 178 |
| 118 | 3300005471 | Ga0070698_100010863 | Ga0070698_1000108635 | 178 |
| 119 | 3300005471 | Ga0070698_100032052 | Ga0070698_1000320524 | 178 |
| 120 | 3300005471 | Ga0070698_100094655 | Ga0070698_1000946551 | 178 |
| 121 | 3300005471 | Ga0070698_100099506 | Ga0070698_1000995064 | 178 |
| 122 | 3300005471 | Ga0070698_100286524 | Ga0070698_1002865242 | 178 |
| 123 | 3300005471 | Ga0070698_100856901 | Ga0070698_1008569012 | 178 |
| 124 | 3300005518 | Ga0070699_100001206 | Ga0070699_10000120615 | 178 |
| 125 | 3300005518 | Ga0070699_100001560 | Ga0070699_10000156016 | 178 |
| 126 | 3300005518 | Ga0070699_100024573 | Ga0070699_1000245732 | 178 |
| 127 | 3300005518 | Ga0070699_100049215 | Ga0070699_1000492154 | 178 |
| 128 | 3300005518 | Ga0070699_100130662 | Ga0070699_1001306622 | 178 |
| 129 | 3300005530 | Ga0070679_100063566 | Ga0070679_1000635662 | 178 |
| 130 | 3300005530 | Ga0070679_100378334 | Ga0070679_1003783342 | 178 |
| 131 | 3300005535 | Ga0070684_101036402 | Ga0070684_1010364021 | 178 |
| 132 | 3300005539 | Ga0068853_100469796 | Ga0068853_1004697961 | 178 |
| 133 | 3300005543 | Ga0070672_100141839 | Ga0070672_1001418393 | 178 |
| 134 | 3300005544 | Ga0070686_100143449 | Ga0070686_1001434491 | 178 |
| 135 | 3300005544 | Ga0070686_100557900 | Ga0070686_1005579001 | 178 |
| 136 | 3300005545 | Ga0070695_100130546 | Ga0070695_1001305461 | 178 |
| 137 | 3300005545 | Ga0070695_100418389 | Ga0070695_1004183891 | 178 |
| 138 | 3300005546 | Ga0070696_100021954 | Ga0070696_1000219542 | 178 |
| 139 | 3300005546 | Ga0070696_100024646 | Ga0070696_1000246464 | 178 |
| 140 | 3300005546 | Ga0070696_100055845 | Ga0070696_1000558452 | 178 |
| 141 | 3300005546 | Ga0070696_100259198 | Ga0070696_1002591982 | 178 |
| 142 | 3300005546 | Ga0070696_101151383 | Ga0070696_1011513831 | 178 |
| 143 | 3300005547 | Ga0070693_100050989 | Ga0070693_1000509892 | 178 |
| 144 | 3300005548 | Ga0070665_100128144 | Ga0070665_1001281443 | 178 |
| 145 | 3300005548 | Ga0070665_100271467 | Ga0070665_1002714672 | 178 |
| 146 | 3300005549 | Ga0070704_100000855 | Ga0070704_1000008554 | 178 |
| 147 | 3300005549 | Ga0070704_100006919 | Ga0070704_1000069194 | 178 |
| 148 | 3300005564 | Ga0070664_100854615 | Ga0070664_1008546151 | 178 |
| 149 | 3300005577 | Ga0068857_101032048 | Ga0068857_1010320482 | 178 |
| 150 | 3300005578 | Ga0068854_100929561 | Ga0068854_1009295612 | 178 |
| 151 | 3300005614 | Ga0068856_100501079 | Ga0068856_1005010792 | 178 |
| 152 | 3300005616 | Ga0068852_100678687 | Ga0068852_1006786872 | 178 |
| 153 | 3300005617 | Ga0068859_100032642 | Ga0068859_1000326425 | 178 |
| 154 | 3300005617 | Ga0068859_100140770 | Ga0068859_1001407702 | 178 |
| 155 | 3300005617 | Ga0068859_100671415 | Ga0068859_1006714152 | 178 |
| 156 | 3300005618 | Ga0068864_100028332 | Ga0068864_1000283325 | 178 |
| 157 | 3300005618 | Ga0068864_100918073 | Ga0068864_1009180731 | 178 |
| 158 | 3300005718 | Ga0068866_10792209 | Ga0068866_107922091 | 178 |
| 159 | 3300005834 | Ga0068851_10325479 | Ga0068851_103254792 | 178 |
| 160 | 3300005840 | Ga0068870_10548462 | Ga0068870_105484622 | 178 |
| 161 | 3300005841 | Ga0068863_100049521 | Ga0068863_1000495214 | 178 |
| 162 | 3300005842 | Ga0068858_100060625 | Ga0068858_1000606256 | 178 |
| 163 | 3300005843 | Ga0068860_100291380 | Ga0068860_1002913802 | 178 |
| 164 | 3300005843 | Ga0068860_100390387 | Ga0068860_1003903872 | 178 |
| 165 | 3300005843 | Ga0068860_101212113 | Ga0068860_1012121132 | 178 |
| 166 | 3300005844 | Ga0068862_101198624 | Ga0068862_1011986241 | 178 |
| 167 | 3300006163 | Ga0070715_10080104 | Ga0070715_100801042 | 178 |
| 168 | 3300006163 | Ga0070715_10524791 | Ga0070715_105247912 | 178 |
| 169 | 3300006175 | Ga0070712_100044684 | Ga0070712_1000446844 | 178 |
| 170 | 3300006844 | Ga0075428_101465180 | Ga0075428_1014651801 | 178 |
| 171 | 3300006846 | Ga0075430_100494912 | Ga0075430_1004949121 | 178 |
| 172 | 3300006847 | Ga0075431_100186529 | Ga0075431_1001865293 | 178 |
| 173 | 3300006847 | Ga0075431_100343014 | Ga0075431_1003430142 | 178 |
| 174 | 3300006852 | Ga0075433_10069132 | Ga0075433_100691322 | 178 |
| 175 | 3300006852 | Ga0075433_10161239 | Ga0075433_101612392 | 178 |
| 176 | 3300006852 | Ga0075433_10179885 | Ga0075433_101798852 | 178 |
| 177 | 3300006871 | Ga0075434_100076933 | Ga0075434_1000769331 | 178 |
| 178 | 3300006880 | Ga0075429_100010791 | Ga0075429_1000107919 | 178 |
| 179 | 3300006880 | Ga0075429_100138559 | Ga0075429_1001385592 | 178 |
| 180 | 3300006881 | Ga0068865_101322053 | Ga0068865_1013220531 | 178 |
| 181 | 3300006931 | Ga0097620_100032641 | Ga0097620_1000326415 | 178 |
| 182 | 3300006931 | Ga0097620_100140774 | Ga0097620_1001407742 | 178 |
| 183 | 3300006931 | Ga0097620_100671424 | Ga0097620_1006714242 | 178 |
| 184 | 3300007076 | Ga0075435_100080594 | Ga0075435_1000805943 | 178 |
| 185 | 3300007076 | Ga0075435_100104673 | Ga0075435_1001046733 | 178 |
| 186 | 3300009092 | Ga0105250_10158497 | Ga0105250_101584972 | 178 |
| 187 | 3300009094 | Ga0111539_10062423 | Ga0111539_100624232 | 178 |
| 188 | 3300009147 | Ga0114129_10122655 | Ga0114129_101226552 | 178 |
| 189 | 3300009147 | Ga0114129_11044112 | Ga0114129_110441121 | 178 |
| 190 | 3300009147 | Ga0114129_11088404 | Ga0114129_110884042 | 178 |
| 191 | 3300009147 | Ga0114129_11209627 | Ga0114129_112096272 | 178 |
| 192 | 3300009147 | Ga0114129_11532326 | Ga0114129_115323261 | 178 |
| 193 | 3300009174 | Ga0105241_10544772 | Ga0105241_105447721 | 178 |
| 194 | 3300009177 | Ga0105248_10031052 | Ga0105248_100310521 | 178 |
| 195 | 3300009177 | Ga0105248_10178643 | Ga0105248_101786432 | 178 |
| 196 | 3300009177 | Ga0105248_10675974 | Ga0105248_106759742 | 178 |
| 197 | 3300009177 | Ga0105248_10966132 | Ga0105248_109661321 | 178 |
| 198 | 3300009545 | Ga0105237_10317984 | Ga0105237_103179842 | 178 |
| 199 | 3300009553 | Ga0105249_10595025 | Ga0105249_105950252 | 178 |
| 200 | 3300010375 | Ga0105239_10006776 | Ga0105239_1000677613 | 178 |
| 201 | 3300010375 | Ga0105239_10914193 | Ga0105239_109141932 | 178 |
| 202 | 3300011119 | Ga0105246_11188633 | Ga0105246_111886331 | 178 |
| 203 | 3300013306 | Ga0163162_10003097 | Ga0163162_100030977 | 178 |
| 204 | 3300013306 | Ga0163162_10873565 | Ga0163162_108735651 | 178 |
| 205 | 3300013308 | Ga0157375_11985476 | Ga0157375_119854761 | 178 |
| 206 | 3300014325 | Ga0163163_10084441 | Ga0163163_100844413 | 178 |
| 207 | 3300014325 | Ga0163163_10090141 | Ga0163163_100901412 | 178 |
| 208 | 3300014745 | Ga0157377_10371196 | Ga0157377_103711961 | 178 |
| 209 | 3300014968 | Ga0157379_10755839 | Ga0157379_107558391 | 178 |
| 210 | 3300025911 | Ga0207654_10289596 | Ga0207654_102895962 | 178 |
| 211 | 3300025912 | Ga0207707_10037864 | Ga0207707_100378644 | 178 |
| 212 | 3300025912 | Ga0207707_10136560 | Ga0207707_101365602 | 178 |
| 213 | 3300025912 | Ga0207707_10211565 | Ga0207707_102115652 | 178 |
| 214 | 3300025915 | Ga0207693_10071148 | Ga0207693_100711483 | 178 |
| 215 | 3300025916 | Ga0207663_10064518 | Ga0207663_100645181 | 178 |
| 216 | 3300025917 | Ga0207660_10523827 | Ga0207660_105238271 | 178 |
| 217 | 3300025919 | Ga0207657_10200591 | Ga0207657_102005913 | 178 |
| 218 | 3300025920 | Ga0207649_10494772 | Ga0207649_104947722 | 178 |
| 219 | 3300025921 | Ga0207652_10659745 | Ga0207652_106597452 | 178 |
| 220 | 3300025922 | Ga0207646_10220250 | Ga0207646_102202501 | 178 |
| 221 | 3300025922 | Ga0207646_10239499 | Ga0207646_102394991 | 178 |
| 222 | 3300025926 | Ga0207659_10081037 | Ga0207659_100810372 | 178 |
| 223 | 3300025926 | Ga0207659_10138290 | Ga0207659_101382901 | 178 |
| 224 | 3300025931 | Ga0207644_10148016 | Ga0207644_101480163 | 178 |
| 225 | 3300025932 | Ga0207690_10209958 | Ga0207690_102099582 | 178 |
| 226 | 3300025932 | Ga0207690_10453253 | Ga0207690_104532532 | 178 |
| 227 | 3300025933 | Ga0207706_10869204 | Ga0207706_108692042 | 178 |
| 228 | 3300025937 | Ga0207669_10830320 | Ga0207669_108303201 | 178 |
| 229 | 3300025941 | Ga0207711_10266398 | Ga0207711_102663982 | 178 |
| 230 | 3300025941 | Ga0207711_10286177 | Ga0207711_102861771 | 178 |
| 231 | 3300025945 | Ga0207679_10665883 | Ga0207679_106658832 | 178 |
| 232 | 3300025960 | Ga0207651_10438928 | Ga0207651_104389282 | 178 |
| 233 | 3300025986 | Ga0207658_10913867 | Ga0207658_109138672 | 178 |
| 234 | 3300026035 | Ga0207703_10418405 | Ga0207703_104184051 | 178 |
| 235 | 3300026041 | Ga0207639_10621818 | Ga0207639_106218182 | 178 |
| 236 | 3300026067 | Ga0207678_10805971 | Ga0207678_108059711 | 178 |
| 237 | 3300026078 | Ga0207702_10942387 | Ga0207702_109423872 | 178 |
| 238 | 3300026088 | Ga0207641_10037905 | Ga0207641_100379053 | 178 |
| 239 | 3300026088 | Ga0207641_11281545 | Ga0207641_112815452 | 178 |
| 240 | 3300026095 | Ga0207676_10340579 | Ga0207676_103405792 | 178 |
| 241 | 3300026116 | Ga0207674_10765498 | Ga0207674_107654981 | 178 |
| 242 | 3300026142 | Ga0207698_11037715 | Ga0207698_110377151 | 178 |
| 243 | 3300027462 | Ga0210000_1033317 | Ga0210000_10333171 | 178 |
| 244 | 3300027876 | Ga0209974_10017856 | Ga0209974_100178562 | 178 |
| 245 | 3300027876 | Ga0209974_10032063 | Ga0209974_100320632 | 178 |
| 246 | 3300028379 | Ga0268266_10075592 | Ga0268266_100755923 | 178 |
| 247 | 3300028380 | Ga0268265_10512233 | Ga0268265_105122331 | 178 |
| 248 | 3300028381 | Ga0268264_10843938 | Ga0268264_108439381 | 178 |
| 249 | 3300031548 | Ga0307408_100051148 | Ga0307408_1000511483 | 178 |
| 250 | 3300031548 | Ga0307408_100165045 | Ga0307408_1001650452 | 178 |
| 251 | 3300031548 | Ga0307408_100229906 | Ga0307408_1002299062 | 178 |
| 252 | 3300031548 | Ga0307408_100404857 | Ga0307408_1004048572 | 178 |
| 253 | 3300031548 | Ga0307408_100785642 | Ga0307408_1007856422 | 178 |
| 254 | 3300031731 | Ga0307405_10004165 | Ga0307405_100041656 | 178 |
| 255 | 3300031731 | Ga0307405_10510436 | Ga0307405_105104361 | 178 |
| 256 | 3300031824 | Ga0307413_10004454 | Ga0307413_100044546 | 178 |
| 257 | 3300031824 | Ga0307413_10007272 | Ga0307413_100072722 | 178 |
| 258 | 3300031824 | Ga0307413_10007540 | Ga0307413_100075402 | 178 |
| 259 | 3300031852 | Ga0307410_10002699 | Ga0307410_100026992 | 178 |
| 260 | 3300031852 | Ga0307410_10131559 | Ga0307410_101315592 | 178 |
| 261 | 3300031852 | Ga0307410_10708428 | Ga0307410_107084281 | 178 |
| 262 | 3300031901 | Ga0307406_10679428 | Ga0307406_106794282 | 178 |
| 263 | 3300031903 | Ga0307407_10005734 | Ga0307407_100057342 | 178 |
| 264 | 3300031903 | Ga0307407_10018773 | Ga0307407_100187733 | 178 |
| 265 | 3300031903 | Ga0307407_10100741 | Ga0307407_101007412 | 178 |
| 266 | 3300031903 | Ga0307407_10224024 | Ga0307407_102240241 | 178 |
| 267 | 3300031911 | Ga0307412_10011948 | Ga0307412_100119485 | 178 |
| 268 | 3300031911 | Ga0307412_10309156 | Ga0307412_103091562 | 178 |
| 269 | 3300031995 | Ga0307409_100002275 | Ga0307409_10000227511 | 178 |
| 270 | 3300031995 | Ga0307409_100091330 | Ga0307409_1000913302 | 178 |
| 271 | 3300031995 | Ga0307409_100096578 | Ga0307409_1000965783 | 178 |
| 272 | 3300032002 | Ga0307416_100024136 | Ga0307416_1000241362 | 178 |
| 273 | 3300032002 | Ga0307416_100029603 | Ga0307416_1000296033 | 178 |
| 274 | 3300032002 | Ga0307416_100045355 | Ga0307416_1000453552 | 178 |
| 275 | 3300032002 | Ga0307416_100072270 | Ga0307416_1000722702 | 178 |
| 276 | 3300032002 | Ga0307416_100079063 | Ga0307416_1000790632 | 178 |
| 277 | 3300032004 | Ga0307414_10006731 | Ga0307414_100067317 | 178 |
| 278 | 3300032004 | Ga0307414_10041942 | Ga0307414_100419422 | 178 |
| 279 | 3300032004 | Ga0307414_10088458 | Ga0307414_100884582 | 178 |
| 280 | 3300032005 | Ga0307411_10012443 | Ga0307411_100124433 | 178 |
| 281 | 3300032005 | Ga0307411_10024192 | Ga0307411_100241923 | 178 |
| 282 | 3300032005 | Ga0307411_10128694 | Ga0307411_101286942 | 178 |
| 283 | 3300032005 | Ga0307411_10826035 | Ga0307411_108260351 | 178 |
| 284 | 3300032126 | Ga0307415_100011456 | Ga0307415_1000114563 | 178 |
| 285 | 3300032126 | Ga0307415_100087846 | Ga0307415_1000878462 | 178 |
| 286 | 3300032126 | Ga0307415_100163279 | Ga0307415_1001632792 | 178 |
| 287 | 3300035084 | Ga0373928_0030593 | Ga0373928_0030593_344_880 | 178 |
| 288 | 3300035084 | Ga0373928_0143468 | Ga0373928_0143468_105_641 | 178 |
| 289 | 3300035085 | Ga0373929_0020923 | Ga0373929_0020923_330_866 | 178 |
| 290 | 3300035088 | Ga0373940_0170410 | Ga0373940_0170410_16_552 | 178 |
| 291 | 3300035090 | Ga0373949_0144662 | Ga0373949_0144662_125_661 | 178 |
| 292 | 3300035091 | Ga0373951_0150653 | Ga0373951_0150653_11_547 | 178 |
| 293 | 3300035112 | Ga0373932_0246169 | Ga0373932_0246169_11_547 | 178 |
| 294 | 3300035114 | Ga0373939_0094819 | Ga0373939_0094819_457_993 | 178 |
| 295 | 3300035114 | Ga0373939_0103729 | Ga0373939_0103729_303_839 | 178 |
| 296 | 3300035115 | Ga0373941_0160611 | Ga0373941_0160611_218_754 | 178 |
| 297 | 3300035121 | Ga0373960_0174229 | Ga0373960_0174229_111_647 | 178 |
| 298 | 3300035241 | Ga0373961_0044322 | Ga0373961_0044322_635_1171 | 178 |
| 299 | 3300035241 | Ga0373961_0085816 | Ga0373961_0085816_434_970 | 178 |
| 300 | 3300035241 | Ga0373961_0139437 | Ga0373961_0139437_99_635 | 178 |
| 301 | 3300035242 | Ga0373962_0025813 | Ga0373962_0025813_968_1504 | 178 |
| 302 | 3300035398 | Ga0316574_0045654 | Ga0316574_0045654_1949_2485 | 178 |
| 303 | 3300035691 | Ga0373931_0127275 | Ga0373931_0127275_56_592 | 178 |
| 304 | 3300037068 | Ga0373925_0342123 | Ga0373925_0342123_124_660 | 178 |
| 305 | 3300037471 | Ga0395905_0084365 | Ga0395905_0084365_232_768 | 178 |
| 306 | 3300037471 | Ga0395905_0980098 | Ga0395905_0980098_43_579 | 178 |
| 307 | 3300038443 | Ga0395901_0833825 | Ga0395901_0833825_41_577 | 178 |
| 308 | 3300038996 | Ga0242420_056267 | Ga0242420_056267_87_623 | 178 |
| 309 | 3300041486 | Ga0451807_0740935 | Ga0451807_0740935_124_660 | 178 |
| 310 | 3300042004 | Ga0439445_0044856 | Ga0439445_0044856_303_839 | 178 |
| 311 | 3300042156 | Ga0439446_0045349 | Ga0439446_0045349_14_550 | 178 |
| 312 | 3300042436 | Ga0439435_0010258 | Ga0439435_0010258_890_1426 | 178 |
| 313 | 3300042876 | Ga0451577_0045051 | Ga0451577_0045051_426_962 | 178 |
| 314 | 3300042876 | Ga0451577_0601089 | Ga0451577_0601089_129_665 | 178 |
| 315 | 3300044673 | Ga0453683_0087489 | Ga0453683_0087489_182_718 | 178 |
| 316 | 3300044712 | Ga0453684_1097481 | Ga0453684_1097481_189_725 | 178 |
| 317 | 3300045051 | Ga0451576_0043261 | Ga0451576_0043261_2049_2585 | 178 |
| 318 | 3300045051 | Ga0451576_0101612 | Ga0451576_0101612_1191_1727 | 178 |
| 319 | 3300046457 | Ga0495590_0229310 | Ga0495590_0229310_109_645 | 178 |
| 320 | 3300046514 | Ga0495618_0170710 | Ga0495618_0170710_26_565 | 178 |
| 321 | 3300046516 | Ga0495628_0352962 | Ga0495628_0352962_389_928 | 178 |
| 322 | 3300046533 | Ga0495640_0055778 | Ga0495640_0055778_926_1465 | 178 |
| 323 | 3300046535 | Ga0495586_0020189 | Ga0495586_0020189_2831_3370 | 178 |
| 324 | 3300046535 | Ga0495586_0095484 | Ga0495586_0095484_928_1467 | 178 |
| 325 | 3300046559 | Ga0495667_0362787 | Ga0495667_0362787_79_618 | 178 |
| 326 | 3300046642 | Ga0495634_0003912 | Ga0495634_0003912_2083_2622 | 178 |
| 327 | 3300046681 | Ga0495647_0004836 | Ga0495647_0004836_429_968 | 178 |
| 328 | 3300047319 | Ga0495674_0250267 | Ga0495674_0250267_843_1382 | 178 |
| 329 | 3300047321 | Ga0495676_0648973 | Ga0495676_0648973_28_567 | 178 |
| 330 | 3300047322 | Ga0495680_0018395 | Ga0495680_0018395_3766_4305 | 178 |
| 331 | 3300048903 | Ga0496100_0020060 | Ga0496100_0020060_1197_1733 | 178 |
| 332 | 3300048903 | Ga0496100_0518736 | Ga0496100_0518736_33_569 | 178 |
| 333 | 3300048904 | Ga0496101_0104052 | Ga0496101_0104052_287_823 | 178 |
| 334 | 3300048904 | Ga0496101_0241111 | Ga0496101_0241111_743_1279 | 178 |
| 335 | 3300048905 | Ga0496102_0004430 | Ga0496102_0004430_543_1079 | 178 |
| 336 | 3300048905 | Ga0496102_0041289 | Ga0496102_0041289_2555_3091 | 178 |
| 337 | 3300048905 | Ga0496102_0044769 | Ga0496102_0044769_1840_2376 | 178 |
| 338 | 3300048905 | Ga0496102_0155598 | Ga0496102_0155598_871_1407 | 178 |
| 339 | 3300048905 | Ga0496102_1273946 | Ga0496102_1273946_105_641 | 178 |
| 340 | 3300048906 | Ga0496103_0017126 | Ga0496103_0017126_1344_1880 | 178 |
| 341 | 3300048906 | Ga0496103_0270130 | Ga0496103_0270130_319_855 | 178 |
| 342 | 3300048907 | Ga0496104_0012154 | Ga0496104_0012154_4251_4787 | 178 |
| 343 | 3300048907 | Ga0496104_0516753 | Ga0496104_0516753_35_571 | 178 |
| 344 | 3300048907 | Ga0496104_0788460 | Ga0496104_0788460_309_845 | 178 |
| 345 | 3300048908 | Ga0496105_0009978 | Ga0496105_0009978_986_1522 | 178 |
| 346 | 3300048908 | Ga0496105_0222306 | Ga0496105_0222306_330_866 | 178 |
| 347 | 3300048909 | Ga0496106_0105265 | Ga0496106_0105265_791_1327 | 178 |
| 348 | 3300048909 | Ga0496106_0144630 | Ga0496106_0144630_1243_1779 | 178 |
| 349 | 3300048909 | Ga0496106_0283625 | Ga0496106_0283625_655_1191 | 178 |
| 350 | 3300048910 | Ga0496107_0068715 | Ga0496107_0068715_121_657 | 178 |
| 351 | 3300048910 | Ga0496107_0137799 | Ga0496107_0137799_111_647 | 178 |
| 352 | 3300048911 | Ga0496108_0000530 | Ga0496108_0000530_18552_19088 | 178 |
| 353 | 3300048911 | Ga0496108_0017523 | Ga0496108_0017523_2711_3247 | 178 |
| 354 | 3300048911 | Ga0496108_0375471 | Ga0496108_0375471_646_1182 | 178 |
| 355 | 3300048912 | Ga0496109_0000886 | Ga0496109_0000886_20691_21227 | 178 |
| 356 | 3300048912 | Ga0496109_0004406 | Ga0496109_0004406_11088_11624 | 178 |
| 357 | 3300048912 | Ga0496109_0224109 | Ga0496109_0224109_170_706 | 178 |
| 358 | 3300048913 | Ga0496110_0095154 | Ga0496110_0095154_1406_1942 | 178 |
| 359 | 3300048913 | Ga0496110_0495702 | Ga0496110_0495702_148_684 | 178 |
| 360 | 3300048913 | Ga0496110_0838271 | Ga0496110_0838271_222_758 | 178 |
| 361 | 3300048914 | Ga0496111_0008935 | Ga0496111_0008935_5680_6216 | 178 |
| 362 | 3300048914 | Ga0496111_0017882 | Ga0496111_0017882_1380_1916 | 178 |
| 363 | 3300048914 | Ga0496111_0033125 | Ga0496111_0033125_2799_3335 | 178 |
| 364 | 3300048915 | Ga0496112_0000343 | Ga0496112_0000343_14731_15267 | 178 |
| 365 | 3300048915 | Ga0496112_0006525 | Ga0496112_0006525_4053_4589 | 178 |
| 366 | 3300048915 | Ga0496112_0025908 | Ga0496112_0025908_4118_4654 | 178 |
| 367 | 3300048915 | Ga0496112_0048083 | Ga0496112_0048083_3319_3855 | 178 |
| 368 | 3300048916 | Ga0496113_0000225 | Ga0496113_0000225_13987_14523 | 178 |
| 369 | 3300048916 | Ga0496113_0001395 | Ga0496113_0001395_11158_11694 | 178 |
| 370 | 3300048917 | Ga0496114_0130019 | Ga0496114_0130019_1547_2083 | 178 |
| 371 | 3300048918 | Ga0496115_0238999 | Ga0496115_0238999_107_643 | 178 |
| 372 | 3300048918 | Ga0496115_0673009 | Ga0496115_0673009_172_708 | 178 |
| 373 | 3300049568 | Ga0501031_0240090 | Ga0501031_0240090_630_1166 | 178 |
| 374 | 3300049570 | Ga0501033_0124194 | Ga0501033_0124194_165_701 | 178 |
| 375 | 3300049577 | Ga0501041_0158922 | Ga0501041_0158922_730_1266 | 178 |
| 376 | 3300049580 | Ga0501046_0118158 | Ga0501046_0118158_1406_1942 | 178 |
| 377 | 3300049582 | Ga0501048_0482762 | Ga0501048_0482762_339_875 | 178 |
| 378 | 3300049584 | Ga0501068_0245079 | Ga0501068_0245079_568_1104 | 178 |
| 379 | 3300049585 | Ga0501069_0291042 | Ga0501069_0291042_145_681 | 178 |
| 380 | 3300049589 | Ga0501073_0045950 | Ga0501073_0045950_1030_1566 | 178 |
| 381 | 3300049592 | Ga0501076_0080019 | Ga0501076_0080019_693_1229 | 178 |
| 382 | 3300049592 | Ga0501076_0516432 | Ga0501076_0516432_360_896 | 178 |
| 383 | 3300049593 | Ga0501077_0020192 | Ga0501077_0020192_3542_4078 | 178 |
| 384 | 3300049593 | Ga0501077_0576539 | Ga0501077_0576539_119_655 | 178 |
| 385 | 3300049661 | Ga0501217_020278 | Ga0501217_020278_558_1094 | 178 |
| 386 | 3300049679 | Ga0501249_061784 | Ga0501249_061784_249_785 | 178 |
| 387 | 3300049741 | Ga0501079_0859297 | Ga0501079_0859297_118_654 | 178 |
| 388 | 3300049742 | Ga0501080_0039082 | Ga0501080_0039082_855_1391 | 178 |
| 389 | 3300049742 | Ga0501080_0821118 | Ga0501080_0821118_32_568 | 178 |
| 390 | 3300049742 | Ga0501080_1105087 | Ga0501080_1105087_102_638 | 178 |
| 391 | 3300049743 | Ga0501081_0168698 | Ga0501081_0168698_93_629 | 178 |
| 392 | 3300049744 | Ga0501083_0114634 | Ga0501083_0114634_792_1328 | 178 |
| 393 | 3300049744 | Ga0501083_0578988 | Ga0501083_0578988_169_705 | 178 |
| 394 | 3300049765 | Ga0501268_040747 | Ga0501268_040747_186_722 | 178 |
| 395 | 3300049824 | Ga0501045_0015441 | Ga0501045_0015441_2108_2644 | 178 |
| 396 | 3300049824 | Ga0501045_0179605 | Ga0501045_0179605_962_1498 | 178 |
| 397 | 3300049824 | Ga0501045_0723335 | Ga0501045_0723335_38_574 | 178 |
| 398 | 3300050507 | nmdc:mga05p37_1174461_c1 | nmdc:mga05p37_1174461_c1_233_769 | 178 |
| 399 | 3300050507 | nmdc:mga05p37_170861_c1 | nmdc:mga05p37_170861_c1_511_1047 | 178 |
| 400 | 3300050507 | nmdc:mga05p37_360796_c1 | nmdc:mga05p37_360796_c1_342_878 | 178 |
| 401 | 3300050507 | nmdc:mga05p37_763454_c1 | nmdc:mga05p37_763454_c1_369_905 | 178 |
| 402 | 3300050508 | nmdc:mga09592_136933_c1 | nmdc:mga09592_136933_c1_324_860 | 178 |
| 403 | 3300050508 | nmdc:mga09592_483369_c1 | nmdc:mga09592_483369_c1_12_548 | 178 |
| 404 | 3300050511 | nmdc:mga08y16_412358_c1 | nmdc:mga08y16_412358_c1_501_1037 | 178 |
| 405 | 3300050511 | nmdc:mga08y16_690933_c1 | nmdc:mga08y16_690933_c1_170_706 | 178 |
| 406 | 3300050512 | nmdc:mga0n895_1142893_c1 | nmdc:mga0n895_1142893_c1_23_559 | 178 |
| 407 | 3300050512 | nmdc:mga0n895_893884_c1 | nmdc:mga0n895_893884_c1_10_546 | 178 |
| 408 | 3300050512 | nmdc:mga0n895_918982_c1 | nmdc:mga0n895_918982_c1_115_651 | 178 |
| 409 | 3300050513 | nmdc:mga0rr50_95824_c1 | nmdc:mga0rr50_95824_c1_1180_1716 | 178 |
| 410 | 3300050515 | nmdc:mga0a205_185057_c1 | nmdc:mga0a205_185057_c1_782_1318 | 178 |
| 411 | 3300050515 | nmdc:mga0a205_59556_c1 | nmdc:mga0a205_59556_c1_1114_1650 | 178 |
| 412 | 3300050515 | nmdc:mga0a205_83247_c1 | nmdc:mga0a205_83247_c1_273_809 | 178 |
| 413 | 3300054114 | Ga0501084_0012198 | Ga0501084_0012198_1374_1910 | 178 |
| 414 | 3300054114 | Ga0501084_0078704 | Ga0501084_0078704_1024_1560 | 178 |
| 415 | 3300060353 | Ga0501082_0156280 | Ga0501082_0156280_1401_1937 | 178 |
| 416 | 3300060353 | Ga0501082_0300056 | Ga0501082_0300056_837_1373 | 178 |
| 417 | 3300061734 | Ga0530510_0025511 | Ga0530510_0025511_3612_4148 | 178 |
| 418 | 3300005334 | Ga0068869_100034358 | Ga0068869_1000343584 | 179 |
| 419 | 3300005335 | Ga0070666_10193131 | Ga0070666_101931312 | 179 |
| 420 | 3300005336 | Ga0070680_100033249 | Ga0070680_1000332491 | 179 |
| 421 | 3300005345 | Ga0070692_10162238 | Ga0070692_101622381 | 179 |
| 422 | 3300005347 | Ga0070668_100282918 | Ga0070668_1002829181 | 179 |
| 423 | 3300005353 | Ga0070669_100003834 | Ga0070669_1000038348 | 179 |
| 424 | 3300005355 | Ga0070671_100853265 | Ga0070671_1008532651 | 179 |
| 425 | 3300005356 | Ga0070674_100004305 | Ga0070674_1000043055 | 179 |
| 426 | 3300005367 | Ga0070667_100010120 | Ga0070667_1000101206 | 179 |
| 427 | 3300005438 | Ga0070701_10178859 | Ga0070701_101788592 | 179 |
| 428 | 3300005440 | Ga0070705_100005926 | Ga0070705_1000059264 | 179 |
| 429 | 3300005441 | Ga0070700_100110730 | Ga0070700_1001107303 | 179 |
| 430 | 3300005455 | Ga0070663_100566497 | Ga0070663_1005664972 | 179 |
| 431 | 3300005457 | Ga0070662_100000777 | Ga0070662_10000077717 | 179 |
| 432 | 3300005459 | Ga0068867_100001516 | Ga0068867_10000151613 | 179 |
| 433 | 3300005544 | Ga0070686_100168115 | Ga0070686_1001681152 | 179 |
| 434 | 3300005545 | Ga0070695_100007192 | Ga0070695_1000071926 | 179 |
| 435 | 3300005546 | Ga0070696_100045007 | Ga0070696_1000450074 | 179 |
| 436 | 3300005547 | Ga0070693_100001534 | Ga0070693_1000015347 | 179 |
| 437 | 3300005563 | Ga0068855_100111162 | Ga0068855_1001111621 | 179 |
| 438 | 3300005578 | Ga0068854_100009366 | Ga0068854_1000093666 | 179 |
| 439 | 3300005615 | Ga0070702_100006351 | Ga0070702_1000063512 | 179 |
| 440 | 3300005618 | Ga0068864_100001860 | Ga0068864_1000018607 | 179 |
| 441 | 3300005718 | Ga0068866_10000032 | Ga0068866_1000003233 | 179 |
| 442 | 3300005719 | Ga0068861_100010300 | Ga0068861_1000103005 | 179 |
| 443 | 3300005840 | Ga0068870_10015518 | Ga0068870_100155182 | 179 |
| 444 | 3300005843 | Ga0068860_100018732 | Ga0068860_1000187326 | 179 |
| 445 | 3300005843 | Ga0068860_100714083 | Ga0068860_1007140832 | 179 |
| 446 | 3300006237 | Ga0097621_100090456 | Ga0097621_1000904564 | 179 |
| 447 | 3300006358 | Ga0068871_100043892 | Ga0068871_1000438923 | 179 |
| 448 | 3300006881 | Ga0068865_100008061 | Ga0068865_1000080614 | 179 |
| 449 | 3300006881 | Ga0068865_100341299 | Ga0068865_1003412992 | 179 |
| 450 | 3300009093 | Ga0105240_10072817 | Ga0105240_100728173 | 179 |
| 451 | 3300009098 | Ga0105245_10039144 | Ga0105245_100391442 | 179 |
| 452 | 3300009174 | Ga0105241_10017383 | Ga0105241_100173834 | 179 |
| 453 | 3300009176 | Ga0105242_10001646 | Ga0105242_1000164614 | 179 |
| 454 | 3300009177 | Ga0105248_10001568 | Ga0105248_1000156821 | 179 |
| 455 | 3300009551 | Ga0105238_10512676 | Ga0105238_105126761 | 179 |
| 456 | 3300009553 | Ga0105249_10010310 | Ga0105249_100103106 | 179 |
| 457 | 3300009553 | Ga0105249_10069819 | Ga0105249_100698192 | 179 |
| 458 | 3300009553 | Ga0105249_10212988 | Ga0105249_102129882 | 179 |
| 459 | 3300009553 | Ga0105249_10235648 | Ga0105249_102356482 | 179 |
| 460 | 3300010375 | Ga0105239_10003875 | Ga0105239_1000387514 | 179 |
| 461 | 3300011119 | Ga0105246_10048552 | Ga0105246_100485521 | 179 |
| 462 | 3300013297 | Ga0157378_10000139 | Ga0157378_100001392 | 179 |
| 463 | 3300013306 | Ga0163162_10029330 | Ga0163162_100293304 | 179 |
| 464 | 3300013307 | Ga0157372_10118575 | Ga0157372_101185752 | 179 |
| 465 | 3300013308 | Ga0157375_10071737 | Ga0157375_100717373 | 179 |
| 466 | 3300014325 | Ga0163163_10316965 | Ga0163163_103169651 | 179 |
| 467 | 3300014326 | Ga0157380_10008310 | Ga0157380_100083103 | 179 |
| 468 | 3300014968 | Ga0157379_10010151 | Ga0157379_100101514 | 179 |
| 469 | 3300014969 | Ga0157376_10615504 | Ga0157376_106155042 | 179 |
| 470 | 3300017792 | Ga0163161_10071511 | Ga0163161_100715114 | 179 |
| 471 | 3300025315 | Ga0207697_10017558 | Ga0207697_100175583 | 179 |
| 472 | 3300025903 | Ga0207680_10150828 | Ga0207680_101508282 | 179 |
| 473 | 3300025907 | Ga0207645_10001229 | Ga0207645_100012293 | 179 |
| 474 | 3300025908 | Ga0207643_10001967 | Ga0207643_100019679 | 179 |
| 475 | 3300025911 | Ga0207654_10017992 | Ga0207654_100179922 | 179 |
| 476 | 3300025913 | Ga0207695_10257778 | Ga0207695_102577783 | 179 |
| 477 | 3300025923 | Ga0207681_10007199 | Ga0207681_100071994 | 179 |
| 478 | 3300025926 | Ga0207659_10050023 | Ga0207659_100500234 | 179 |
| 479 | 3300025927 | Ga0207687_10162736 | Ga0207687_101627362 | 179 |
| 480 | 3300025931 | Ga0207644_10788811 | Ga0207644_107888111 | 179 |
| 481 | 3300025932 | Ga0207690_10152833 | Ga0207690_101528332 | 179 |
| 482 | 3300025933 | Ga0207706_10000011 | Ga0207706_10000011116 | 179 |
| 483 | 3300025934 | Ga0207686_10000172 | Ga0207686_1000017232 | 179 |
| 484 | 3300025935 | Ga0207709_10007865 | Ga0207709_100078651 | 179 |
| 485 | 3300025937 | Ga0207669_10000157 | Ga0207669_100001576 | 179 |
| 486 | 3300025938 | Ga0207704_10002088 | Ga0207704_100020884 | 179 |
| 487 | 3300025941 | Ga0207711_10002317 | Ga0207711_1000231712 | 179 |
| 488 | 3300025942 | Ga0207689_10037850 | Ga0207689_100378504 | 179 |
| 489 | 3300025961 | Ga0207712_10002980 | Ga0207712_100029804 | 179 |
| 490 | 3300025961 | Ga0207712_10038810 | Ga0207712_100388103 | 179 |
| 491 | 3300025961 | Ga0207712_10513498 | Ga0207712_105134982 | 179 |
| 492 | 3300026035 | Ga0207703_10024972 | Ga0207703_100249722 | 179 |
| 493 | 3300026067 | Ga0207678_10064660 | Ga0207678_100646602 | 179 |
| 494 | 3300026067 | Ga0207678_10468046 | Ga0207678_104680461 | 179 |
| 495 | 3300026075 | Ga0207708_10253435 | Ga0207708_102534352 | 179 |
| 496 | 3300026089 | Ga0207648_10000011 | Ga0207648_10000011150 | 179 |
| 497 | 3300026095 | Ga0207676_10635609 | Ga0207676_106356091 | 179 |
| 498 | 3300026118 | Ga0207675_100011521 | Ga0207675_1000115215 | 179 |
| 499 | 3300026121 | Ga0207683_10001778 | Ga0207683_1000177817 | 179 |
| 500 | 3300028380 | Ga0268265_10061627 | Ga0268265_100616272 | 179 |
| 501 | 3300028381 | Ga0268264_10007728 | Ga0268264_100077282 | 179 |
| 502 | 3300041486 | Ga0451807_1594444 | Ga0451807_1594444_1438_1977 | 179 |
| 503 | 3300041505 | Ga0451849_0262525 | Ga0451849_0262525_113_652 | 179 |
| 504 | 3300046455 | Ga0495603_0031150 | Ga0495603_0031150_1620_2159 | 179 |
| 505 | 3300046475 | Ga0495639_0025905 | Ga0495639_0025905_1074_1613 | 179 |
| 506 | 3300046499 | Ga0495594_0003842 | Ga0495594_0003842_2841_3380 | 179 |
| 507 | 3300046523 | Ga0495644_0135173 | Ga0495644_0135173_14_553 | 179 |
| 508 | 3300046557 | Ga0495622_0017733 | Ga0495622_0017733_1073_1612 | 179 |
| 509 | 3300046664 | Ga0495659_0093914 | Ga0495659_0093914_264_803 | 179 |
| 510 | 3300046674 | Ga0495588_0173303 | Ga0495588_0173303_497_1036 | 179 |
| 511 | 3300046675 | Ga0495657_0184570 | Ga0495657_0184570_228_767 | 179 |
| 512 | 3300047318 | Ga0495636_0025903 | Ga0495636_0025903_1037_1576 | 179 |
| 513 | 3300048909 | Ga0496106_0029511 | Ga0496106_0029511_1047_1586 | 179 |
| 514 | 3300048917 | Ga0496114_0045367 | Ga0496114_0045367_1275_1814 | 179 |
| 515 | 3300049742 | Ga0501080_0071855 | Ga0501080_0071855_904_1443 | 179 |
| 516 | 3300050515 | nmdc:mga0a205_535171_c1 | nmdc:mga0a205_535171_c1_288_827 | 179 |
| 517 | 3300006846 | Ga0075430_100211724 | Ga0075430_1002117242 | 180 |
| 518 | 3300006847 | Ga0075431_100075065 | Ga0075431_1000750655 | 180 |
| 519 | 3300048905 | Ga0496102_0206692 | Ga0496102_0206692_177_728 | 180 |
| 520 | 3300049583 | Ga0501067_0287159 | Ga0501067_0287159_295_846 | 180 |
| 521 | 3300049584 | Ga0501068_0102951 | Ga0501068_0102951_1101_1652 | 180 |
| 522 | 3300049591 | Ga0501075_0178679 | Ga0501075_0178679_257_811 | 180 |
| 523 | 3300049743 | Ga0501081_0837442 | Ga0501081_0837442_28_579 | 180 |
| 524 | 3300050510 | nmdc:mga06r32_943816_c1 | nmdc:mga06r32_943816_c1_206_757 | 180 |
| 525 | 3300004799 | Ga0058863_11731781 | Ga0058863_117317811 | 181 |
| 526 | 3300005293 | Ga0065715_10363302 | Ga0065715_103633022 | 181 |
| 527 | 3300005434 | Ga0070709_10683409 | Ga0070709_106834092 | 181 |
| 528 | 3300005440 | Ga0070705_100012010 | Ga0070705_1000120102 | 181 |
| 529 | 3300005445 | Ga0070708_100002594 | Ga0070708_1000025947 | 181 |
| 530 | 3300005445 | Ga0070708_100059681 | Ga0070708_1000596812 | 181 |
| 531 | 3300005467 | Ga0070706_100042627 | Ga0070706_1000426273 | 181 |
| 532 | 3300005468 | Ga0070707_100002297 | Ga0070707_1000022972 | 181 |
| 533 | 3300005518 | Ga0070699_100003944 | Ga0070699_1000039446 | 181 |
| 534 | 3300005536 | Ga0070697_100049445 | Ga0070697_1000494454 | 181 |
| 535 | 3300005536 | Ga0070697_100116433 | Ga0070697_1001164332 | 181 |
| 536 | 3300005539 | Ga0068853_100419163 | Ga0068853_1004191632 | 181 |
| 537 | 3300005545 | Ga0070695_100144550 | Ga0070695_1001445502 | 181 |
| 538 | 3300005546 | Ga0070696_100181802 | Ga0070696_1001818022 | 181 |
| 539 | 3300005546 | Ga0070696_100349770 | Ga0070696_1003497702 | 181 |
| 540 | 3300005564 | Ga0070664_100015342 | Ga0070664_1000153423 | 181 |
| 541 | 3300005577 | Ga0068857_101028156 | Ga0068857_1010281562 | 181 |
| 542 | 3300005618 | Ga0068864_100016288 | Ga0068864_1000162885 | 181 |
| 543 | 3300005841 | Ga0068863_100168876 | Ga0068863_1001688763 | 181 |
| 544 | 3300005937 | Ga0081455_10047462 | Ga0081455_100474625 | 181 |
| 545 | 3300005981 | Ga0081538_10067306 | Ga0081538_100673063 | 181 |
| 546 | 3300006844 | Ga0075428_100005385 | Ga0075428_10000538515 | 181 |
| 547 | 3300006847 | Ga0075431_100013023 | Ga0075431_10001302310 | 181 |
| 548 | 3300006871 | Ga0075434_100003406 | Ga0075434_1000034064 | 181 |
| 549 | 3300006914 | Ga0075436_100032424 | Ga0075436_1000324243 | 181 |
| 550 | 3300007076 | Ga0075435_100185144 | Ga0075435_1001851442 | 181 |
| 551 | 3300007076 | Ga0075435_100286487 | Ga0075435_1002864873 | 181 |
| 552 | 3300009101 | Ga0105247_10820402 | Ga0105247_108204021 | 181 |
| 553 | 3300009147 | Ga0114129_10032491 | Ga0114129_100324915 | 181 |
| 554 | 3300009147 | Ga0114129_10088996 | Ga0114129_100889966 | 181 |
| 555 | 3300009174 | Ga0105241_10787753 | Ga0105241_107877532 | 181 |
| 556 | 3300009177 | Ga0105248_11891517 | Ga0105248_118915171 | 181 |
| 557 | 3300013308 | Ga0157375_10070463 | Ga0157375_100704634 | 181 |
| 558 | 3300014325 | Ga0163163_10026921 | Ga0163163_100269213 | 181 |
| 559 | 3300014968 | Ga0157379_10149548 | Ga0157379_101495481 | 181 |
| 560 | 3300025321 | Ga0207656_10451414 | Ga0207656_104514141 | 181 |
| 561 | 3300025910 | Ga0207684_10026040 | Ga0207684_100260402 | 181 |
| 562 | 3300025910 | Ga0207684_10411301 | Ga0207684_104113012 | 181 |
| 563 | 3300025915 | Ga0207693_10062567 | Ga0207693_100625674 | 181 |
| 564 | 3300025916 | Ga0207663_10186168 | Ga0207663_101861682 | 181 |
| 565 | 3300025922 | Ga0207646_10026635 | Ga0207646_100266354 | 181 |
| 566 | 3300025933 | Ga0207706_10249272 | Ga0207706_102492722 | 181 |
| 567 | 3300025938 | Ga0207704_10489588 | Ga0207704_104895881 | 181 |
| 568 | 3300025945 | Ga0207679_10009543 | Ga0207679_100095435 | 181 |
| 569 | 3300025945 | Ga0207679_10280425 | Ga0207679_102804252 | 181 |
| 570 | 3300026041 | Ga0207639_10544067 | Ga0207639_105440672 | 181 |
| 571 | 3300026067 | Ga0207678_10130704 | Ga0207678_101307043 | 181 |
| 572 | 3300026088 | Ga0207641_10027227 | Ga0207641_100272272 | 181 |
| 573 | 3300026089 | Ga0207648_10333426 | Ga0207648_103334261 | 181 |
| 574 | 3300026095 | Ga0207676_10006300 | Ga0207676_100063005 | 181 |
| 575 | 3300026142 | Ga0207698_10498510 | Ga0207698_104985102 | 181 |
| 576 | 3300031548 | Ga0307408_100287984 | Ga0307408_1002879842 | 181 |
| 577 | 3300031731 | Ga0307405_10033580 | Ga0307405_100335803 | 181 |
| 578 | 3300031824 | Ga0307413_10017314 | Ga0307413_100173143 | 181 |
| 579 | 3300031824 | Ga0307413_10059813 | Ga0307413_100598132 | 181 |
| 580 | 3300031824 | Ga0307413_10060053 | Ga0307413_100600533 | 181 |
| 581 | 3300031824 | Ga0307413_10099250 | Ga0307413_100992502 | 181 |
| 582 | 3300031852 | Ga0307410_10057586 | Ga0307410_100575862 | 181 |
| 583 | 3300031852 | Ga0307410_10585503 | Ga0307410_105855032 | 181 |
| 584 | 3300031903 | Ga0307407_10603569 | Ga0307407_106035691 | 181 |
| 585 | 3300031911 | Ga0307412_10154589 | Ga0307412_101545892 | 181 |
| 586 | 3300031995 | Ga0307409_100160884 | Ga0307409_1001608841 | 181 |
| 587 | 3300032002 | Ga0307416_100086280 | Ga0307416_1000862802 | 181 |
| 588 | 3300032002 | Ga0307416_100625476 | Ga0307416_1006254762 | 181 |
| 589 | 3300032004 | Ga0307414_10101065 | Ga0307414_101010653 | 181 |
| 590 | 3300032004 | Ga0307414_10228280 | Ga0307414_102282802 | 181 |
| 591 | 3300032005 | Ga0307411_10345284 | Ga0307411_103452842 | 181 |
| 592 | 3300032005 | Ga0307411_10770474 | Ga0307411_107704742 | 181 |
| 593 | 3300032126 | Ga0307415_100118496 | Ga0307415_1001184962 | 181 |
| 594 | 3300032126 | Ga0307415_100125838 | Ga0307415_1001258382 | 181 |
| 595 | 3300032126 | Ga0307415_100286558 | Ga0307415_1002865582 | 181 |
| 596 | 3300035691 | Ga0373931_0753738 | Ga0373931_0753738_76_630 | 181 |
| 597 | 3300041406 | Ga0439439_0000401 | Ga0439439_0000401_2334_2888 | 181 |
| 598 | 3300041410 | Ga0439461_0062326 | Ga0439461_0062326_174_728 | 181 |
| 599 | 3300041997 | Ga0439431_0045682 | Ga0439431_0045682_397_951 | 181 |
| 600 | 3300042123 | Ga0450921_004167 | Ga0450921_004167_103_657 | 181 |
| 601 | 3300042133 | Ga0450896_020819 | Ga0450896_020819_207_761 | 181 |
| 602 | 3300042156 | Ga0439446_0002474 | Ga0439446_0002474_1229_1783 | 181 |
| 603 | 3300042435 | Ga0439434_0031575 | Ga0439434_0031575_109_666 | 181 |
| 604 | 3300042876 | Ga0451577_0029171 | Ga0451577_0029171_2508_3065 | 181 |
| 605 | 3300044673 | Ga0453683_0450334 | Ga0453683_0450334_69_623 | 181 |
| 606 | 3300044712 | Ga0453684_1588892 | Ga0453684_1588892_63_617 | 181 |
| 607 | 3300046455 | Ga0495603_0224921 | Ga0495603_0224921_495_1049 | 181 |
| 608 | 3300046472 | Ga0495580_0425106 | Ga0495580_0425106_230_784 | 181 |
| 609 | 3300046499 | Ga0495594_0537573 | Ga0495594_0537573_78_632 | 181 |
| 610 | 3300046557 | Ga0495622_0235078 | Ga0495622_0235078_110_664 | 181 |
| 611 | 3300046674 | Ga0495588_0183907 | Ga0495588_0183907_450_1004 | 181 |
| 612 | 3300046691 | Ga0495670_0310980 | Ga0495670_0310980_59_613 | 181 |
| 613 | 3300048904 | Ga0496101_0445426 | Ga0496101_0445426_306_860 | 181 |
| 614 | 3300048908 | Ga0496105_0740195 | Ga0496105_0740195_90_644 | 181 |
| 615 | 3300048909 | Ga0496106_0895049 | Ga0496106_0895049_18_572 | 181 |
| 616 | 3300048911 | Ga0496108_0371112 | Ga0496108_0371112_17_571 | 181 |
| 617 | 3300048911 | Ga0496108_1015538 | Ga0496108_1015538_113_667 | 181 |
| 618 | 3300048912 | Ga0496109_1255686 | Ga0496109_1255686_88_642 | 181 |
| 619 | 3300048913 | Ga0496110_0888518 | Ga0496110_0888518_99_653 | 181 |
| 620 | 3300049570 | Ga0501033_0406181 | Ga0501033_0406181_273_827 | 181 |
| 621 | 3300049572 | Ga0501036_0330619 | Ga0501036_0330619_585_1139 | 181 |
| 622 | 3300049573 | Ga0501037_0319468 | Ga0501037_0319468_433_987 | 181 |
| 623 | 3300049574 | Ga0501038_0105018 | Ga0501038_0105018_106_660 | 181 |
| 624 | 3300049574 | Ga0501038_0574207 | Ga0501038_0574207_137_691 | 181 |
| 625 | 3300049576 | Ga0501040_0025937 | Ga0501040_0025937_562_1116 | 181 |
| 626 | 3300049576 | Ga0501040_0583164 | Ga0501040_0583164_200_754 | 181 |
| 627 | 3300049577 | Ga0501041_0509884 | Ga0501041_0509884_69_623 | 181 |
| 628 | 3300049580 | Ga0501046_0017035 | Ga0501046_0017035_3795_4349 | 181 |
| 629 | 3300049582 | Ga0501048_0065316 | Ga0501048_0065316_69_623 | 181 |
| 630 | 3300049583 | Ga0501067_0071434 | Ga0501067_0071434_1315_1869 | 181 |
| 631 | 3300049585 | Ga0501069_0106809 | Ga0501069_0106809_208_762 | 181 |
| 632 | 3300049586 | Ga0501070_0102547 | Ga0501070_0102547_934_1488 | 181 |
| 633 | 3300049587 | Ga0501071_0008957 | Ga0501071_0008957_6011_6565 | 181 |
| 634 | 3300049587 | Ga0501071_0271055 | Ga0501071_0271055_30_584 | 181 |
| 635 | 3300049588 | Ga0501072_0026418 | Ga0501072_0026418_621_1175 | 181 |
| 636 | 3300049588 | Ga0501072_0048033 | Ga0501072_0048033_104_658 | 181 |
| 637 | 3300049588 | Ga0501072_0730500 | Ga0501072_0730500_95_649 | 181 |
| 638 | 3300049589 | Ga0501073_0191313 | Ga0501073_0191313_717_1271 | 181 |
| 639 | 3300049590 | Ga0501074_0046206 | Ga0501074_0046206_96_650 | 181 |
| 640 | 3300049590 | Ga0501074_0157615 | Ga0501074_0157615_451_1005 | 181 |
| 641 | 3300049591 | Ga0501075_0010146 | Ga0501075_0010146_5947_6501 | 181 |
| 642 | 3300049591 | Ga0501075_0029007 | Ga0501075_0029007_1616_2170 | 181 |
| 643 | 3300049591 | Ga0501075_0297449 | Ga0501075_0297449_55_609 | 181 |
| 644 | 3300049592 | Ga0501076_0007418 | Ga0501076_0007418_5899_6453 | 181 |
| 645 | 3300049592 | Ga0501076_0410356 | Ga0501076_0410356_101_655 | 181 |
| 646 | 3300049593 | Ga0501077_0000260 | Ga0501077_0000260_9278_9832 | 181 |
| 647 | 3300049593 | Ga0501077_0045986 | Ga0501077_0045986_100_654 | 181 |
| 648 | 3300049652 | Ga0501202_089866 | Ga0501202_089866_112_666 | 181 |
| 649 | 3300049660 | Ga0501216_034690 | Ga0501216_034690_73_627 | 181 |
| 650 | 3300049661 | Ga0501217_019707 | Ga0501217_019707_990_1544 | 181 |
| 651 | 3300049668 | Ga0501233_010892 | Ga0501233_010892_937_1491 | 181 |
| 652 | 3300049683 | Ga0501253_030460 | Ga0501253_030460_114_668 | 181 |
| 653 | 3300049686 | Ga0501257_072002 | Ga0501257_072002_253_807 | 181 |
| 654 | 3300049704 | Ga0501221_011185 | Ga0501221_011185_591_1145 | 181 |
| 655 | 3300049707 | Ga0501234_025380 | Ga0501234_025380_382_936 | 181 |
| 656 | 3300049741 | Ga0501079_0006682 | Ga0501079_0006682_5061_5615 | 181 |
| 657 | 3300049741 | Ga0501079_0023522 | Ga0501079_0023522_4121_4675 | 181 |
| 658 | 3300049742 | Ga0501080_0127719 | Ga0501080_0127719_1754_2308 | 181 |
| 659 | 3300049742 | Ga0501080_0728523 | Ga0501080_0728523_90_644 | 181 |
| 660 | 3300049743 | Ga0501081_0060736 | Ga0501081_0060736_193_747 | 181 |
| 661 | 3300049743 | Ga0501081_0276618 | Ga0501081_0276618_114_668 | 181 |
| 662 | 3300049767 | Ga0501270_008297 | Ga0501270_008297_96_650 | 181 |
| 663 | 3300049767 | Ga0501270_029083 | Ga0501270_029083_11_565 | 181 |
| 664 | 3300049824 | Ga0501045_0012832 | Ga0501045_0012832_4955_5509 | 181 |
| 665 | 3300049851 | Ga0501212_014727 | Ga0501212_014727_58_612 | 181 |
| 666 | 3300050507 | nmdc:mga05p37_11492_c1 | nmdc:mga05p37_11492_c1_9471_10025 | 181 |
| 667 | 3300050507 | nmdc:mga05p37_138024_c1 | nmdc:mga05p37_138024_c1_2388_2942 | 181 |
| 668 | 3300050507 | nmdc:mga05p37_165311_c1 | nmdc:mga05p37_165311_c1_2114_2671 | 181 |
| 669 | 3300050508 | nmdc:mga09592_364767_c1 | nmdc:mga09592_364767_c1_498_1055 | 181 |
| 670 | 3300050508 | nmdc:mga09592_771467_c1 | nmdc:mga09592_771467_c1_141_734 | 181 |
| 671 | 3300050509 | nmdc:mga0qj67_459318_c1 | nmdc:mga0qj67_459318_c1_78_635 | 181 |
| 672 | 3300050510 | nmdc:mga06r32_58229_c1 | nmdc:mga06r32_58229_c1_2855_3412 | 181 |
| 673 | 3300050510 | nmdc:mga06r32_70819_c1 | nmdc:mga06r32_70819_c1_159_713 | 181 |
| 674 | 3300050512 | nmdc:mga0n895_2011_c1 | nmdc:mga0n895_2011_c1_5475_6029 | 181 |
| 675 | 3300050513 | nmdc:mga0rr50_243400_c1 | nmdc:mga0rr50_243400_c1_883_1437 | 181 |
| 676 | 3300050513 | nmdc:mga0rr50_365627_c1 | nmdc:mga0rr50_365627_c1_520_1074 | 181 |
| 677 | 3300050514 | nmdc:mga08x19_10821_c1 | nmdc:mga08x19_10821_c1_3234_3788 | 181 |
| 678 | 3300054114 | Ga0501084_0018137 | Ga0501084_0018137_4218_4772 | 181 |
| 679 | 3300054114 | Ga0501084_0032795 | Ga0501084_0032795_101_655 | 181 |
| 680 | 3300059421 | Ga0590071_014604 | Ga0590071_014604_226_780 | 181 |
| 681 | 3300059423 | Ga0590074_036714 | Ga0590074_036714_291_845 | 181 |
| 682 | 3300059424 | Ga0590075_004856 | Ga0590075_004856_2071_2625 | 181 |
| 683 | 3300059424 | Ga0590075_016974 | Ga0590075_016974_698_1252 | 181 |
| 684 | 3300060353 | Ga0501082_0023164 | Ga0501082_0023164_630_1184 | 181 |
| 685 | 3300060353 | Ga0501082_0048394 | Ga0501082_0048394_1832_2386 | 181 |
| 686 | 3300061734 | Ga0530510_0085130 | Ga0530510_0085130_1283_1837 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9728 | 121 | 171 |
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.9716 | 121 | 171 |
| 4lup-assembly2.cif.gz_C | crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand | 0.9502 | 13 | 100 |
| 6eo2-assembly1.cif.gz_A | conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed | 0.9402 | 128 | 171 |
| 3hug-assembly2.cif.gz_E | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.9389 | 121 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o8xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9728 | 121 | 171 | 1.10.10.10 |
| 2o8xA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9716 | 121 | 171 | 1.10.10.10 |
| 2o8xC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9688 | 121 | 171 | 1.10.10.10 |
| 1or7A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9628 | 121 | 176 | 1.10.10.10 |
| 4nqwA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9581 | 121 | 175 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9BAP8-F1-model_v4 | RNA polymerase sigma-70 region 2 domain-containing protein | 0.724 | 9 | 136 |
GO:0006352
GO:0016987 |
| AF-A0A7K1C7F9-F1-model_v4 | Sigma-70 family RNA polymerase sigma factor | 0.6844 | 14 | 155 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A7C1PVA3-F1-model_v4 | deleted | 0.6818 | 1 | 150 |
|
| AF-A0A7C1PVA3-F1-model_v4 | deleted | 0.6606 | 1 | 150 |
|
| AF-A0A1H2C9P8-F1-model_v4 | deleted | 0.6563 | 1 | 178 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar