F475199

General Info

Members Datasets Scaffolds Average Seq Length
686 290 686 180

Family's Representative Sequence

Representative Sequence 3300042435|Ga0439434_0031575|Ga0439434_0031575_109_666
Length 185
Sequence MSRTIALDSFLLADADRVVARARAGDQAALEQLYRAFEAPVYNLARRICRTTEDAEDVLQETFFEVCRSIGRYREEGSLWGWVRTIAASKALMRLRRNKYRDTDELNDELVIGQRKEETHLRMDLEAALERLPETSRAVVWLHDVEGYTHDEIAGMMGKTASFSKSQLARAHARLRRWLGEEVLV

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
191 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
260 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
264 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
265 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
266 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
267 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
287 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.02
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11731781 3300004799 Bacteria 846
2 Ga0058862_10047534 3300004803 Unclassified 565
3 Ga0065715_10363302 3300005293 Bacteria 932
4 Ga0070683_101007997 3300005329 Unclassified 799
5 Ga0070690_100011251 3300005330 Bacteria 5229
6 Ga0068869_100034358 3300005334 Bacteria 3586
7 Ga0070666_10193131 3300005335 Bacteria 1431
8 Ga0070680_100029768 3300005336 Bacteria 4383
9 Ga0070680_100033249 3300005336 Bacteria 4155
10 Ga0070680_100183025 3300005336 Bacteria 1765
11 Ga0070680_100525113 3300005336 Bacteria 1014
12 Ga0070682_100267759 3300005337 Bacteria 1240
13 Ga0070660_100957345 3300005339 Bacteria 723
14 Ga0070689_101060078 3300005340 Bacteria 723
15 Ga0070691_10098121 3300005341 Bacteria 1452
16 Ga0070691_10262915 3300005341 Bacteria 930
17 Ga0070661_100624612 3300005344 Bacteria 873
18 Ga0070692_10050709 3300005345 Unclassified 2156
19 Ga0070692_10162238 3300005345 Bacteria 1282
20 Ga0070692_10512752 3300005345 Bacteria 779
21 Ga0070668_100282918 3300005347 Bacteria 1386
22 Ga0070669_100003834 3300005353 Bacteria 10858
23 Ga0070669_100413474 3300005353 Unclassified 1106
24 Ga0070675_100089952 3300005354 Bacteria 2571
25 Ga0070671_100028927 3300005355 Bacteria 4567
26 Ga0070671_100853265 3300005355 Bacteria 794
27 Ga0070674_100004305 3300005356 Bacteria 8102
28 Ga0070688_100564168 3300005365 Unclassified 867
29 Ga0070659_100114880 3300005366 Bacteria 2175
30 Ga0070659_100356395 3300005366 Bacteria 1228
31 Ga0070667_100010120 3300005367 Bacteria 7802
32 Ga0070709_10207767 3300005434 Bacteria 1390
33 Ga0070709_10683409 3300005434 Bacteria 797
34 Ga0070701_10178859 3300005438 Bacteria 1240
35 Ga0070701_10230518 3300005438 Bacteria 1109
36 Ga0070711_100000102 3300005439 Bacteria 44792
37 Ga0070711_100761413 3300005439 Bacteria 819
38 Ga0070705_100005926 3300005440 Bacteria 5977
39 Ga0070705_100012010 3300005440 Bacteria 4387
40 Ga0070705_100037361 3300005440 Bacteria 2738
41 Ga0070700_100110730 3300005441 Bacteria 1825
42 Ga0070700_100507475 3300005441 Bacteria 929
43 Ga0070694_100022371 3300005444 Bacteria 4050
44 Ga0070694_100161116 3300005444 Bacteria 1646
45 Ga0070708_100002594 3300005445 Bacteria 13974
46 Ga0070708_100041538 3300005445 Bacteria 4032
47 Ga0070708_100059681 3300005445 Bacteria 3402
48 Ga0070708_100073459 3300005445 Unclassified 3083
49 Ga0070708_100263574 3300005445 Unclassified 1620
50 Ga0070663_100154417 3300005455 Bacteria 1762
51 Ga0070663_100566497 3300005455 Bacteria 951
52 Ga0070663_101048340 3300005455 Unclassified 711
53 Ga0070662_100000777 3300005457 Bacteria 19681
54 Ga0070681_10137902 3300005458 Bacteria 2369
55 Ga0068867_100001516 3300005459 Bacteria 16088
56 Ga0070706_100042627 3300005467 Bacteria 4193
57 Ga0070706_100670593 3300005467 Unclassified 962
58 Ga0070706_100767066 3300005467 Unclassified 893
59 Ga0070707_100002297 3300005468 Bacteria 18268
60 Ga0070707_100012208 3300005468 Bacteria 8018
61 Ga0070707_100072853 3300005468 Bacteria 3312
62 Ga0070707_100218541 3300005468 Unclassified 1857
63 Ga0070707_100381693 3300005468 Bacteria 1369
64 Ga0070707_100531370 3300005468 Bacteria 1138
65 Ga0070698_100010863 3300005471 Bacteria 9688
66 Ga0070698_100032052 3300005471 Bacteria 5446
67 Ga0070698_100094655 3300005471 Bacteria 2966
68 Ga0070698_100099506 3300005471 Bacteria 2881
69 Ga0070698_100286524 3300005471 Bacteria 1578
70 Ga0070698_100856901 3300005471 Unclassified 854
71 Ga0070699_100001206 3300005518 Bacteria 23893
72 Ga0070699_100001560 3300005518 Bacteria 20969
73 Ga0070699_100003944 3300005518 Bacteria 13109
74 Ga0070699_100024573 3300005518 Bacteria 5194
75 Ga0070699_100049215 3300005518 Bacteria 3648
76 Ga0070699_100072113 3300005518 Unclassified 3004
77 Ga0070699_100130662 3300005518 Unclassified 2214
78 Ga0070679_100063566 3300005530 Bacteria 3679
79 Ga0070679_100117920 3300005530 Bacteria 2639
80 Ga0070679_100378334 3300005530 Bacteria 1363
81 Ga0070684_101036402 3300005535 Bacteria 770
82 Ga0070697_100049445 3300005536 Bacteria 3413
83 Ga0070697_100116433 3300005536 Bacteria 2232
84 Ga0070697_100924547 3300005536 Bacteria 774
85 Ga0068853_100419163 3300005539 Bacteria 1255
86 Ga0068853_100469796 3300005539 Bacteria 1185
87 Ga0070672_100141839 3300005543 Bacteria 1982
88 Ga0070686_100143449 3300005544 Unclassified 1665
89 Ga0070686_100168115 3300005544 Bacteria 1549
90 Ga0070686_100557900 3300005544 Bacteria 897
91 Ga0070695_100007192 3300005545 Bacteria 6600
92 Ga0070695_100098576 3300005545 Bacteria 1964
93 Ga0070695_100130546 3300005545 Bacteria 1731
94 Ga0070695_100144550 3300005545 Bacteria 1653
95 Ga0070695_100418389 3300005545 Bacteria 1020
96 Ga0070696_100002315 3300005546 Bacteria 12568
97 Ga0070696_100021954 3300005546 Bacteria 4331
98 Ga0070696_100024646 3300005546 Bacteria 4090
99 Ga0070696_100045007 3300005546 Bacteria 3057
100 Ga0070696_100055845 3300005546 Unclassified 2754
101 Ga0070696_100181802 3300005546 Bacteria 1560
102 Ga0070696_100199998 3300005546 Bacteria 1491
103 Ga0070696_100259198 3300005546 Unclassified 1318
104 Ga0070696_100349770 3300005546 Unclassified 1144
105 Ga0070696_101151383 3300005546 Bacteria 654
106 Ga0070693_100001534 3300005547 Bacteria 10426
107 Ga0070693_100050989 3300005547 Unclassified 2368
108 Ga0070693_100141054 3300005547 Bacteria 1517
109 Ga0070665_100128144 3300005548 Unclassified 2540
110 Ga0070665_100271467 3300005548 Bacteria 1698
111 Ga0070704_100000855 3300005549 Bacteria 15211
112 Ga0070704_100006919 3300005549 Bacteria 6720
113 Ga0068855_100111162 3300005563 Bacteria 3145
114 Ga0070664_100015342 3300005564 Bacteria 6265
115 Ga0070664_100854615 3300005564 Bacteria 852
116 Ga0068857_101028156 3300005577 Bacteria 794
117 Ga0068857_101032048 3300005577 Bacteria 792
118 Ga0068854_100009366 3300005578 Bacteria 6322
119 Ga0068854_100929561 3300005578 Unclassified 766
120 Ga0068856_100501079 3300005614 Bacteria 1235
121 Ga0070702_100006351 3300005615 Bacteria 5589
122 Ga0068852_100678687 3300005616 Bacteria 1039
123 Ga0068859_100032642 3300005617 Bacteria 5229
124 Ga0068859_100140770 3300005617 Bacteria 2486
125 Ga0068859_100671415 3300005617 Bacteria 1128
126 Ga0068864_100001860 3300005618 Bacteria 17319
127 Ga0068864_100016288 3300005618 Bacteria 6187
128 Ga0068864_100028332 3300005618 Unclassified 4732
129 Ga0068864_100918073 3300005618 Bacteria 865
130 Ga0068866_10000032 3300005718 Bacteria 56456
131 Ga0068866_10792209 3300005718 Bacteria 658
132 Ga0068861_100010300 3300005719 Bacteria 6487
133 Ga0068851_10325479 3300005834 Bacteria 889
134 Ga0068870_10015518 3300005840 Bacteria 3616
135 Ga0068870_10548462 3300005840 Bacteria 778
136 Ga0068863_100049521 3300005841 Unclassified 3984
137 Ga0068863_100168876 3300005841 Unclassified 2098
138 Ga0068858_100060625 3300005842 Unclassified 3497
139 Ga0068860_100018732 3300005843 Bacteria 6727
140 Ga0068860_100291380 3300005843 Unclassified 1597
141 Ga0068860_100390387 3300005843 Bacteria 1375
142 Ga0068860_100714083 3300005843 Bacteria 1013
143 Ga0068860_101212113 3300005843 Unclassified 775
144 Ga0068862_101198624 3300005844 Bacteria 758
145 Ga0081455_10047462 3300005937 Unclassified 3719
146 Ga0081538_10067306 3300005981 Bacteria 2001
147 Ga0070715_10080104 3300006163 Unclassified 1480
148 Ga0070715_10524791 3300006163 Unclassified 682
149 Ga0070712_100044684 3300006175 Bacteria 3055
150 Ga0097621_100090456 3300006237 Bacteria 2561
151 Ga0068871_100043892 3300006358 Unclassified 3593
152 Ga0075428_100005385 3300006844 Bacteria 14225
153 Ga0075428_100207787 3300006844 Bacteria 2116
154 Ga0075428_101465180 3300006844 Bacteria 716
155 Ga0075430_100211724 3300006846 Bacteria 1608
156 Ga0075430_100494912 3300006846 Unclassified 1009
157 Ga0075431_100013023 3300006847 Bacteria 8400
158 Ga0075431_100063152 3300006847 Bacteria 3821
159 Ga0075431_100075065 3300006847 Bacteria 3489
160 Ga0075431_100186529 3300006847 Bacteria 2127
161 Ga0075431_100343014 3300006847 Bacteria 1503
162 Ga0075431_100609703 3300006847 Unclassified 1075
163 Ga0075433_10069132 3300006852 Bacteria 3101
164 Ga0075433_10116747 3300006852 Bacteria 2368
165 Ga0075433_10161239 3300006852 Bacteria 1996
166 Ga0075433_10179885 3300006852 Bacteria 1881
167 Ga0075434_100001345 3300006871 Bacteria 20620
168 Ga0075434_100003406 3300006871 Bacteria 14234
169 Ga0075434_100076933 3300006871 Bacteria 3332
170 Ga0075429_100010791 3300006880 Bacteria 7900
171 Ga0075429_100043499 3300006880 Bacteria 3908
172 Ga0075429_100138559 3300006880 Bacteria 2130
173 Ga0068865_100008061 3300006881 Bacteria 6503
174 Ga0068865_100341299 3300006881 Bacteria 1210
175 Ga0068865_101322053 3300006881 Bacteria 641
176 Ga0075436_100032424 3300006914 Bacteria 3601
177 Ga0097620_100032641 3300006931 Bacteria 5229
178 Ga0097620_100140774 3300006931 Bacteria 2486
179 Ga0097620_100671424 3300006931 Bacteria 1128
180 Ga0075435_100080594 3300007076 Bacteria 2673
181 Ga0075435_100104673 3300007076 Bacteria 2348
182 Ga0075435_100185144 3300007076 Unclassified 1761
183 Ga0075435_100286487 3300007076 Bacteria 1407
184 Ga0105250_10158497 3300009092 Bacteria 944
185 Ga0105240_10072817 3300009093 Unclassified 4245
186 Ga0111539_10062423 3300009094 Bacteria 4411
187 Ga0105245_10039144 3300009098 Bacteria 4220
188 Ga0105247_10820402 3300009101 Bacteria 711
189 Ga0114129_10032491 3300009147 Bacteria 7376
190 Ga0114129_10088996 3300009147 Bacteria 4280
191 Ga0114129_10122655 3300009147 Bacteria 3575
192 Ga0114129_10308410 3300009147 Bacteria 2107
193 Ga0114129_10524197 3300009147 Bacteria 1544
194 Ga0114129_11044112 3300009147 Unclassified 1026
195 Ga0114129_11088404 3300009147 Bacteria 1001
196 Ga0114129_11209627 3300009147 Bacteria 941
197 Ga0114129_11532326 3300009147 Bacteria 818
198 Ga0105241_10017383 3300009174 Bacteria 5284
199 Ga0105241_10544772 3300009174 Bacteria 1041
200 Ga0105241_10787753 3300009174 Bacteria 875
201 Ga0105242_10001646 3300009176 Bacteria 17654
202 Ga0105248_10001568 3300009177 Bacteria 25438
203 Ga0105248_10031052 3300009177 Bacteria 5970
204 Ga0105248_10178643 3300009177 Bacteria 2392
205 Ga0105248_10675974 3300009177 Unclassified 1165
206 Ga0105248_10966132 3300009177 Bacteria 962
207 Ga0105248_11891517 3300009177 Unclassified 677
208 Ga0105237_10317984 3300009545 Bacteria 1560
209 Ga0105238_10512676 3300009551 Bacteria 1201
210 Ga0105249_10010310 3300009553 Bacteria 8211
211 Ga0105249_10069819 3300009553 Unclassified 3243
212 Ga0105249_10212988 3300009553 Unclassified 1897
213 Ga0105249_10235648 3300009553 Bacteria 1807
214 Ga0105249_10595025 3300009553 Bacteria 1160
215 Ga0105239_10003875 3300010375 Bacteria 18149
216 Ga0105239_10006776 3300010375 Bacteria 13228
217 Ga0105239_10914193 3300010375 Bacteria 1007
218 Ga0105246_10048552 3300011119 Bacteria 2902
219 Ga0105246_11188633 3300011119 Bacteria 701
220 Ga0157378_10000139 3300013297 Bacteria 68304
221 Ga0163162_10003097 3300013306 Bacteria 15878
222 Ga0163162_10029330 3300013306 Bacteria 5444
223 Ga0163162_10873565 3300013306 Bacteria 1013
224 Ga0157372_10118575 3300013307 Unclassified 3037
225 Ga0157375_10070463 3300013308 Bacteria 3506
226 Ga0157375_10071737 3300013308 Unclassified 3478
227 Ga0157375_11985476 3300013308 Bacteria 691
228 Ga0163163_10026921 3300014325 Bacteria 5501
229 Ga0163163_10084441 3300014325 Unclassified 3181
230 Ga0163163_10090141 3300014325 Unclassified 3079
231 Ga0163163_10316965 3300014325 Unclassified 1613
232 Ga0157380_10008310 3300014326 Bacteria 7397
233 Ga0157377_10371196 3300014745 Bacteria 966
234 Ga0157379_10010151 3300014968 Bacteria 8208
235 Ga0157379_10122476 3300014968 Bacteria 2340
236 Ga0157379_10149548 3300014968 Unclassified 2106
237 Ga0157379_10755839 3300014968 Bacteria 915
238 Ga0157379_11716877 3300014968 Bacteria 615
239 Ga0157376_10615504 3300014969 Bacteria 1082
240 Ga0163161_10071511 3300017792 Bacteria 2539
241 Ga0207697_10017558 3300025315 Bacteria 2940
242 Ga0207656_10451414 3300025321 Unclassified 650
243 Ga0207680_10150828 3300025903 Bacteria 1549
244 Ga0207645_10001229 3300025907 Bacteria 21105
245 Ga0207643_10001967 3300025908 Bacteria 11341
246 Ga0207684_10026040 3300025910 Bacteria 4985
247 Ga0207684_10411301 3300025910 Bacteria 1163
248 Ga0207654_10017992 3300025911 Unclassified 3704
249 Ga0207654_10289596 3300025911 Bacteria 1110
250 Ga0207707_10028011 3300025912 Unclassified 4925
251 Ga0207707_10037864 3300025912 Bacteria 4214
252 Ga0207707_10136560 3300025912 Bacteria 2144
253 Ga0207707_10211565 3300025912 Unclassified 1689
254 Ga0207695_10257778 3300025913 Bacteria 1642
255 Ga0207693_10062567 3300025915 Unclassified 2915
256 Ga0207693_10071148 3300025915 Unclassified 2722
257 Ga0207663_10064518 3300025916 Bacteria 2337
258 Ga0207663_10186168 3300025916 Bacteria 1487
259 Ga0207660_10041961 3300025917 Bacteria 3209
260 Ga0207660_10523827 3300025917 Bacteria 963
261 Ga0207657_10200591 3300025919 Unclassified 1605
262 Ga0207649_10494772 3300025920 Bacteria 929
263 Ga0207652_10016876 3300025921 Bacteria 5969
264 Ga0207652_10659745 3300025921 Bacteria 935
265 Ga0207646_10026635 3300025922 Bacteria 5274
266 Ga0207646_10220250 3300025922 Bacteria 1714
267 Ga0207646_10239499 3300025922 Bacteria 1639
268 Ga0207646_10356708 3300025922 Unclassified 1321
269 Ga0207681_10007199 3300025923 Bacteria 6825
270 Ga0207659_10050023 3300025926 Bacteria 2967
271 Ga0207659_10081037 3300025926 Bacteria 2399
272 Ga0207659_10138290 3300025926 Bacteria 1888
273 Ga0207687_10162736 3300025927 Bacteria 1714
274 Ga0207644_10148016 3300025931 Unclassified 1815
275 Ga0207644_10788811 3300025931 Bacteria 794
276 Ga0207690_10152833 3300025932 Bacteria 1713
277 Ga0207690_10209958 3300025932 Bacteria 1484
278 Ga0207690_10453253 3300025932 Bacteria 1031
279 Ga0207706_10000011 3300025933 Bacteria 196033
280 Ga0207706_10249272 3300025933 Bacteria 1551
281 Ga0207706_10869204 3300025933 Bacteria 763
282 Ga0207686_10000172 3300025934 Bacteria 49408
283 Ga0207709_10007865 3300025935 Bacteria 5909
284 Ga0207669_10000157 3300025937 Bacteria 32354
285 Ga0207669_10830320 3300025937 Bacteria 768
286 Ga0207704_10002088 3300025938 Bacteria 8954
287 Ga0207704_10489588 3300025938 Bacteria 989
288 Ga0207711_10002317 3300025941 Bacteria 17057
289 Ga0207711_10266398 3300025941 Bacteria 1576
290 Ga0207711_10286177 3300025941 Bacteria 1518
291 Ga0207689_10037850 3300025942 Bacteria 3998
292 Ga0207679_10009543 3300025945 Bacteria 6220
293 Ga0207679_10280425 3300025945 Bacteria 1429
294 Ga0207679_10665883 3300025945 Bacteria 942
295 Ga0207651_10438928 3300025960 Bacteria 1118
296 Ga0207712_10002980 3300025961 Bacteria 10809
297 Ga0207712_10038810 3300025961 Unclassified 3258
298 Ga0207712_10513498 3300025961 Unclassified 1026
299 Ga0207658_10913867 3300025986 Bacteria 799
300 Ga0207703_10024972 3300026035 Unclassified 4701
301 Ga0207703_10418405 3300026035 Unclassified 1246
302 Ga0207639_10544067 3300026041 Bacteria 1065
303 Ga0207639_10621818 3300026041 Bacteria 997
304 Ga0207678_10064660 3300026067 Unclassified 3143
305 Ga0207678_10130704 3300026067 Bacteria 2142
306 Ga0207678_10468046 3300026067 Unclassified 1097
307 Ga0207678_10805971 3300026067 Unclassified 829
308 Ga0207708_10253435 3300026075 Bacteria 1419
309 Ga0207702_10942387 3300026078 Bacteria 856
310 Ga0207641_10027227 3300026088 Bacteria 4721
311 Ga0207641_10037905 3300026088 Unclassified 4028
312 Ga0207641_11281545 3300026088 Bacteria 733
313 Ga0207648_10000011 3300026089 Bacteria 182284
314 Ga0207648_10333426 3300026089 Bacteria 1365
315 Ga0207676_10006300 3300026095 Bacteria 8381
316 Ga0207676_10340579 3300026095 Bacteria 1383
317 Ga0207676_10635609 3300026095 Bacteria 1028
318 Ga0207674_10765498 3300026116 Unclassified 932
319 Ga0207675_100011521 3300026118 Bacteria 8274
320 Ga0207683_10001778 3300026121 Bacteria 19080
321 Ga0207698_10498510 3300026142 Bacteria 1185
322 Ga0207698_11037715 3300026142 Bacteria 831
323 Ga0210000_1033317 3300027462 Bacteria 809
324 Ga0209974_10017856 3300027876 Bacteria 2353
325 Ga0209974_10032063 3300027876 Bacteria 1741
326 Ga0268266_10075592 3300028379 Unclassified 2926
327 Ga0268265_10061627 3300028380 Bacteria 2879
328 Ga0268265_10512233 3300028380 Bacteria 1133
329 Ga0268264_10007728 3300028381 Bacteria 8957
330 Ga0268264_10843938 3300028381 Bacteria 917
331 Ga0307408_100051148 3300031548 Unclassified 2975
332 Ga0307408_100165045 3300031548 Bacteria 1763
333 Ga0307408_100229906 3300031548 Unclassified 1518
334 Ga0307408_100287984 3300031548 Bacteria 1370
335 Ga0307408_100404857 3300031548 Bacteria 1172
336 Ga0307408_100785642 3300031548 Bacteria 863
337 Ga0307405_10004165 3300031731 Bacteria 6804
338 Ga0307405_10033580 3300031731 Bacteria 3045
339 Ga0307405_10510436 3300031731 Bacteria 965
340 Ga0307413_10004454 3300031824 Bacteria 6100
341 Ga0307413_10007272 3300031824 Bacteria 5127
342 Ga0307413_10007540 3300031824 Bacteria 5060
343 Ga0307413_10017314 3300031824 Bacteria 3750
344 Ga0307413_10059813 3300031824 Bacteria 2342
345 Ga0307413_10060053 3300031824 Bacteria 2339
346 Ga0307413_10099250 3300031824 Bacteria 1919
347 Ga0307410_10002699 3300031852 Bacteria 8663
348 Ga0307410_10057586 3300031852 Bacteria 2647
349 Ga0307410_10131559 3300031852 Bacteria 1838
350 Ga0307410_10585503 3300031852 Bacteria 929
351 Ga0307410_10708428 3300031852 Unclassified 849
352 Ga0307406_10679428 3300031901 Bacteria 857
353 Ga0307407_10005734 3300031903 Bacteria 5425
354 Ga0307407_10018773 3300031903 Unclassified 3506
355 Ga0307407_10100741 3300031903 Unclassified 1792
356 Ga0307407_10224024 3300031903 Bacteria 1273
357 Ga0307407_10603569 3300031903 Bacteria 817
358 Ga0307412_10011948 3300031911 Bacteria 5045
359 Ga0307412_10154589 3300031911 Bacteria 1697
360 Ga0307412_10309156 3300031911 Bacteria 1252
361 Ga0307409_100002275 3300031995 Bacteria 9945
362 Ga0307409_100091330 3300031995 Bacteria 2495
363 Ga0307409_100096578 3300031995 Bacteria 2438
364 Ga0307409_100160884 3300031995 Bacteria 1963
365 Ga0307416_100024136 3300032002 Bacteria 4431
366 Ga0307416_100029603 3300032002 Bacteria 4094
367 Ga0307416_100045355 3300032002 Bacteria 3461
368 Ga0307416_100072270 3300032002 Unclassified 2870
369 Ga0307416_100079063 3300032002 Bacteria 2770
370 Ga0307416_100086280 3300032002 Bacteria 2675
371 Ga0307416_100625476 3300032002 Unclassified 1159
372 Ga0307414_10006731 3300032004 Bacteria 6429
373 Ga0307414_10041942 3300032004 Bacteria 3105
374 Ga0307414_10088458 3300032004 Bacteria 2292
375 Ga0307414_10101065 3300032004 Bacteria 2170
376 Ga0307414_10228280 3300032004 Unclassified 1533
377 Ga0307411_10012443 3300032005 Unclassified 4644
378 Ga0307411_10024192 3300032005 Unclassified 3616
379 Ga0307411_10128694 3300032005 Bacteria 1846
380 Ga0307411_10345284 3300032005 Bacteria 1211
381 Ga0307411_10770474 3300032005 Bacteria 844
382 Ga0307411_10826035 3300032005 Unclassified 818
383 Ga0307415_100011456 3300032126 Bacteria 5076
384 Ga0307415_100087846 3300032126 Bacteria 2241
385 Ga0307415_100118496 3300032126 Unclassified 1980
386 Ga0307415_100125838 3300032126 Bacteria 1931
387 Ga0307415_100163279 3300032126 Unclassified 1729
388 Ga0307415_100286558 3300032126 Bacteria 1357
389 Ga0373928_0030593 3300035084 Bacteria 1191
390 Ga0373928_0143468 3300035084 Bacteria 656
391 Ga0373929_0020923 3300035085 Bacteria 1323
392 Ga0373940_0170410 3300035088 Bacteria 703
393 Ga0373949_0144662 3300035090 Bacteria 683
394 Ga0373951_0150653 3300035091 Bacteria 652
395 Ga0373932_0246169 3300035112 Bacteria 651
396 Ga0373939_0094819 3300035114 Bacteria 1015
397 Ga0373939_0103729 3300035114 Bacteria 980
398 Ga0373941_0160611 3300035115 Bacteria 831
399 Ga0373960_0174229 3300035121 Bacteria 748
400 Ga0373961_0044322 3300035241 Unclassified 1297
401 Ga0373961_0085816 3300035241 Bacteria 998
402 Ga0373961_0139437 3300035241 Bacteria 818
403 Ga0373962_0025813 3300035242 Bacteria 1580
404 Ga0316574_0045654 3300035398 Bacteria 2714
405 Ga0373931_0127275 3300035691 Bacteria 1462
406 Ga0373931_0753738 3300035691 Bacteria 646
407 Ga0373925_0342123 3300037068 Bacteria 1214
408 Ga0395905_0084365 3300037471 Bacteria 2976
409 Ga0395905_0980098 3300037471 Bacteria 748
410 Ga0395901_0833825 3300038443 Unclassified 909
411 Ga0242420_056267 3300038996 Unclassified 777
412 Ga0439439_0000401 3300041406 Bacteria 7230
413 Ga0439461_0062326 3300041410 Bacteria 850
414 Ga0451807_0740935 3300041486 Unclassified 885
415 Ga0451807_1594444 3300041486 Bacteria 2222
416 Ga0451849_0262525 3300041505 Unclassified 716
417 Ga0439431_0045682 3300041997 Bacteria 1125
418 Ga0439445_0044856 3300042004 Bacteria 1182
419 Ga0450921_004167 3300042123 Bacteria 1046
420 Ga0450896_020819 3300042133 Unclassified 961
421 Ga0439446_0002474 3300042156 Bacteria 4441
422 Ga0439446_0045349 3300042156 Bacteria 1303
423 Ga0439434_0031575 3300042435 Bacteria 1611
424 Ga0439435_0010258 3300042436 Bacteria 2218
425 Ga0451577_0029171 3300042876 Bacteria 4986
426 Ga0451577_0045051 3300042876 Unclassified 3949
427 Ga0451577_0419946 3300042876 Bacteria 1214
428 Ga0451577_0601089 3300042876 Bacteria 998
429 Ga0453683_0008077 3300044673 Bacteria 7082
430 Ga0453683_0087489 3300044673 Bacteria 1953
431 Ga0453683_0450334 3300044673 Bacteria 832
432 Ga0453683_0606358 3300044673 Bacteria 714
433 Ga0453684_1097481 3300044712 Unclassified 841
434 Ga0453684_1588892 3300044712 Bacteria 672
435 Ga0451576_0039117 3300045051 Bacteria 5020
436 Ga0451576_0043261 3300045051 Unclassified 4753
437 Ga0451576_0060810 3300045051 Unclassified 3940
438 Ga0451576_0101612 3300045051 Bacteria 2990
439 Ga0451576_0391165 3300045051 Bacteria 1457
440 Ga0495603_0031150 3300046455 Bacteria 3211
441 Ga0495603_0224921 3300046455 Bacteria 1082
442 Ga0495590_0229310 3300046457 Unclassified 688
443 Ga0495580_0425106 3300046472 Bacteria 893
444 Ga0495639_0025905 3300046475 Bacteria 2589
445 Ga0495594_0003842 3300046499 Bacteria 7716
446 Ga0495594_0537573 3300046499 Bacteria 663
447 Ga0495618_0170710 3300046514 Bacteria 1384
448 Ga0495628_0352962 3300046516 Bacteria 1081
449 Ga0495644_0135173 3300046523 Unclassified 940
450 Ga0495640_0055778 3300046533 Bacteria 2702
451 Ga0495586_0020189 3300046535 Bacteria 3548
452 Ga0495586_0095484 3300046535 Unclassified 1645
453 Ga0495622_0017733 3300046557 Bacteria 3314
454 Ga0495622_0235078 3300046557 Bacteria 809
455 Ga0495667_0362787 3300046559 Unclassified 914
456 Ga0495634_0003912 3300046642 Bacteria 11827
457 Ga0495659_0093914 3300046664 Bacteria 1155
458 Ga0495588_0173303 3300046674 Bacteria 1141
459 Ga0495588_0183907 3300046674 Bacteria 1104
460 Ga0495657_0184570 3300046675 Unclassified 1278
461 Ga0495647_0004836 3300046681 Bacteria 4401
462 Ga0495670_0310980 3300046691 Bacteria 845
463 Ga0495636_0025903 3300047318 Unclassified 2383
464 Ga0495674_0250267 3300047319 Bacteria 1458
465 Ga0495676_0648973 3300047321 Bacteria 685
466 Ga0495680_0018395 3300047322 Bacteria 5934
467 Ga0496100_0020060 3300048903 Bacteria 4002
468 Ga0496100_0518736 3300048903 Bacteria 919
469 Ga0496101_0104052 3300048904 Unclassified 2129
470 Ga0496101_0241111 3300048904 Bacteria 1407
471 Ga0496101_0445426 3300048904 Bacteria 1022
472 Ga0496102_0004430 3300048905 Bacteria 11860
473 Ga0496102_0041289 3300048905 Unclassified 4176
474 Ga0496102_0044769 3300048905 Unclassified 4017
475 Ga0496102_0155598 3300048905 Bacteria 2149
476 Ga0496102_0206692 3300048905 Unclassified 1851
477 Ga0496102_1273946 3300048905 Bacteria 654
478 Ga0496103_0017126 3300048906 Bacteria 4333
479 Ga0496103_0270130 3300048906 Bacteria 1094
480 Ga0496103_0436400 3300048906 Bacteria 840
481 Ga0496104_0012154 3300048907 Bacteria 7733
482 Ga0496104_0516753 3300048907 Unclassified 1105
483 Ga0496104_0788460 3300048907 Unclassified 856
484 Ga0496105_0009978 3300048908 Bacteria 7451
485 Ga0496105_0222306 3300048908 Bacteria 1537
486 Ga0496105_0740195 3300048908 Bacteria 752
487 Ga0496106_0029511 3300048909 Bacteria 4087
488 Ga0496106_0105265 3300048909 Unclassified 2192
489 Ga0496106_0144630 3300048909 Unclassified 1872
490 Ga0496106_0283625 3300048909 Bacteria 1327
491 Ga0496106_0895049 3300048909 Unclassified 701
492 Ga0496107_0068715 3300048910 Bacteria 2571
493 Ga0496107_0137799 3300048910 Bacteria 1803
494 Ga0496108_0000530 3300048911 Bacteria 29778
495 Ga0496108_0017523 3300048911 Bacteria 5860
496 Ga0496108_0371112 3300048911 Unclassified 1249
497 Ga0496108_0375471 3300048911 Unclassified 1241
498 Ga0496108_1015538 3300048911 Unclassified 708
499 Ga0496109_0000886 3300048912 Bacteria 25030
500 Ga0496109_0004406 3300048912 Bacteria 11763
501 Ga0496109_0224109 3300048912 Bacteria 1768
502 Ga0496109_1255686 3300048912 Unclassified 677
503 Ga0496110_0095154 3300048913 Unclassified 2667
504 Ga0496110_0495702 3300048913 Bacteria 1112
505 Ga0496110_0838271 3300048913 Bacteria 824
506 Ga0496110_0888518 3300048913 Unclassified 797
507 Ga0496111_0008935 3300048914 Bacteria 6664
508 Ga0496111_0017882 3300048914 Bacteria 4904
509 Ga0496111_0033125 3300048914 Unclassified 3685
510 Ga0496112_0000343 3300048915 Bacteria 30294
511 Ga0496112_0006525 3300048915 Bacteria 10259
512 Ga0496112_0025908 3300048915 Bacteria 5635
513 Ga0496112_0048083 3300048915 Bacteria 4184
514 Ga0496113_0000225 3300048916 Bacteria 26482
515 Ga0496113_0001395 3300048916 Bacteria 13437
516 Ga0496114_0045367 3300048917 Bacteria 3651
517 Ga0496114_0130019 3300048917 Unclassified 2174
518 Ga0496115_0238999 3300048918 Unclassified 1497
519 Ga0496115_0673009 3300048918 Unclassified 816
520 Ga0501031_0240090 3300049568 Bacteria 1178
521 Ga0501033_0124194 3300049570 Bacteria 1872
522 Ga0501033_0406181 3300049570 Bacteria 949
523 Ga0501034_0044000 3300049571 Bacteria 4516
524 Ga0501034_0114976 3300049571 Bacteria 2679
525 Ga0501036_0257200 3300049572 Bacteria 1463
526 Ga0501036_0330619 3300049572 Bacteria 1273
527 Ga0501037_0319468 3300049573 Bacteria 1075
528 Ga0501038_0105018 3300049574 Bacteria 2347
529 Ga0501038_0574207 3300049574 Bacteria 856
530 Ga0501040_0025937 3300049576 Bacteria 3943
531 Ga0501040_0583164 3300049576 Bacteria 807
532 Ga0501041_0158922 3300049577 Bacteria 1412
533 Ga0501041_0509884 3300049577 Bacteria 765
534 Ga0501043_0792777 3300049579 Unclassified 686
535 Ga0501046_0017035 3300049580 Bacteria 6075
536 Ga0501046_0118158 3300049580 Bacteria 2019
537 Ga0501048_0065316 3300049582 Bacteria 2573
538 Ga0501048_0482762 3300049582 Unclassified 888
539 Ga0501067_0005831 3300049583 Bacteria 6831
540 Ga0501067_0009208 3300049583 Bacteria 5468
541 Ga0501067_0071434 3300049583 Bacteria 1922
542 Ga0501067_0130298 3300049583 Bacteria 1400
543 Ga0501067_0287159 3300049583 Bacteria 916
544 Ga0501068_0001812 3300049584 Bacteria 11354
545 Ga0501068_0007727 3300049584 Bacteria 5950
546 Ga0501068_0102951 3300049584 Unclassified 1770
547 Ga0501068_0245079 3300049584 Bacteria 1141
548 Ga0501069_0012776 3300049585 Bacteria 4470
549 Ga0501069_0014049 3300049585 Bacteria 4277
550 Ga0501069_0061873 3300049585 Bacteria 2090
551 Ga0501069_0106809 3300049585 Bacteria 1592
552 Ga0501069_0291042 3300049585 Bacteria 957
553 Ga0501070_0015434 3300049586 Bacteria 6425
554 Ga0501070_0033441 3300049586 Bacteria 4302
555 Ga0501070_0045161 3300049586 Bacteria 3665
556 Ga0501070_0083776 3300049586 Unclassified 2640
557 Ga0501070_0102547 3300049586 Unclassified 2366
558 Ga0501071_0004064 3300049587 Bacteria 9243
559 Ga0501071_0008957 3300049587 Bacteria 6639
560 Ga0501071_0271055 3300049587 Unclassified 1283
561 Ga0501071_0420351 3300049587 Unclassified 1021
562 Ga0501071_0546085 3300049587 Bacteria 890
563 Ga0501072_0018594 3300049588 Bacteria 5355
564 Ga0501072_0026418 3300049588 Bacteria 4527
565 Ga0501072_0042841 3300049588 Bacteria 3556
566 Ga0501072_0048033 3300049588 Bacteria 3361
567 Ga0501072_0730500 3300049588 Bacteria 777
568 Ga0501073_0029915 3300049589 Bacteria 3889
569 Ga0501073_0045950 3300049589 Unclassified 3074
570 Ga0501073_0052803 3300049589 Bacteria 2845
571 Ga0501073_0191313 3300049589 Bacteria 1416
572 Ga0501074_0008030 3300049590 Bacteria 7643
573 Ga0501074_0022454 3300049590 Bacteria 4584
574 Ga0501074_0046206 3300049590 Bacteria 3148
575 Ga0501074_0157615 3300049590 Unclassified 1621
576 Ga0501075_0010146 3300049591 Bacteria 6610
577 Ga0501075_0029007 3300049591 Bacteria 4090
578 Ga0501075_0178679 3300049591 Unclassified 1620
579 Ga0501075_0297449 3300049591 Bacteria 1230
580 Ga0501076_0007418 3300049592 Bacteria 7981
581 Ga0501076_0080019 3300049592 Bacteria 2622
582 Ga0501076_0124950 3300049592 Unclassified 2085
583 Ga0501076_0410356 3300049592 Bacteria 1114
584 Ga0501076_0516432 3300049592 Bacteria 985
585 Ga0501077_0000260 3300049593 Bacteria 31177
586 Ga0501077_0020192 3300049593 Bacteria 4218
587 Ga0501077_0045986 3300049593 Bacteria 2773
588 Ga0501077_0576539 3300049593 Unclassified 722
589 Ga0501202_089866 3300049652 Bacteria 733
590 Ga0501216_034690 3300049660 Bacteria 946
591 Ga0501217_019707 3300049661 Bacteria 1578
592 Ga0501217_020278 3300049661 Unclassified 1560
593 Ga0501233_010892 3300049668 Bacteria 1800
594 Ga0501249_061784 3300049679 Bacteria 868
595 Ga0501253_030460 3300049683 Bacteria 1025
596 Ga0501257_072002 3300049686 Unclassified 884
597 Ga0501221_011185 3300049704 Bacteria 1610
598 Ga0501234_025380 3300049707 Bacteria 951
599 Ga0501079_0006682 3300049741 Bacteria 8675
600 Ga0501079_0023522 3300049741 Bacteria 4728
601 Ga0501079_0225833 3300049741 Unclassified 1463
602 Ga0501079_0357893 3300049741 Bacteria 1144
603 Ga0501079_0859297 3300049741 Bacteria 714
604 Ga0501080_0032078 3300049742 Bacteria 4897
605 Ga0501080_0039082 3300049742 Bacteria 4429
606 Ga0501080_0047393 3300049742 Unclassified 4000
607 Ga0501080_0071855 3300049742 Bacteria 3219
608 Ga0501080_0127719 3300049742 Bacteria 2354
609 Ga0501080_0728523 3300049742 Bacteria 873
610 Ga0501080_0821118 3300049742 Unclassified 814
611 Ga0501080_1105087 3300049742 Unclassified 684
612 Ga0501081_0060736 3300049743 Bacteria 2619
613 Ga0501081_0063481 3300049743 Bacteria 2563
614 Ga0501081_0168698 3300049743 Unclassified 1580
615 Ga0501081_0276618 3300049743 Unclassified 1228
616 Ga0501081_0837442 3300049743 Bacteria 693
617 Ga0501083_0004893 3300049744 Bacteria 9472
618 Ga0501083_0084757 3300049744 Bacteria 2097
619 Ga0501083_0114634 3300049744 Bacteria 1770
620 Ga0501083_0578988 3300049744 Unclassified 730
621 Ga0501268_040747 3300049765 Bacteria 873
622 Ga0501270_008297 3300049767 Bacteria 1310
623 Ga0501270_029083 3300049767 Bacteria 900
624 Ga0501045_0012832 3300049824 Bacteria 5906
625 Ga0501045_0015441 3300049824 Bacteria 5418
626 Ga0501045_0179605 3300049824 Unclassified 1577
627 Ga0501045_0517635 3300049824 Unclassified 886
628 Ga0501045_0723335 3300049824 Unclassified 734
629 Ga0501212_014727 3300049851 Bacteria 1160
630 nmdc:mga05p37_105756_c1 3300050507 Bacteria 3462
631 nmdc:mga05p37_11492_c1 3300050507 Bacteria 10547
632 nmdc:mga05p37_1174461_c1 3300050507 Bacteria 796
633 nmdc:mga05p37_138024_c1 3300050507 Bacteria 2988
634 nmdc:mga05p37_165311_c1 3300050507 Bacteria 2701
635 nmdc:mga05p37_170861_c1 3300050507 Bacteria 2651
636 nmdc:mga05p37_360796_c1 3300050507 Unclassified 1708
637 nmdc:mga05p37_402334_c1 3300050507 Bacteria 1598
638 nmdc:mga05p37_763454_c1 3300050507 Unclassified 1064
639 nmdc:mga09592_136933_c1 3300050508 Bacteria 2109
640 nmdc:mga09592_23347_c1 3300050508 Bacteria 5108
641 nmdc:mga09592_364767_c1 3300050508 Unclassified 1250
642 nmdc:mga09592_483369_c1 3300050508 Unclassified 1067
643 nmdc:mga09592_771467_c1 3300050508 Bacteria 815
644 nmdc:mga0qj67_198609_c1 3300050509 Bacteria 1630
645 nmdc:mga0qj67_459318_c1 3300050509 Bacteria 1025
646 nmdc:mga06r32_20739_c1 3300050510 Bacteria 6053
647 nmdc:mga06r32_227606_c1 3300050510 Bacteria 1853
648 nmdc:mga06r32_58229_c1 3300050510 Bacteria 3713
649 nmdc:mga06r32_70819_c1 3300050510 Unclassified 3373
650 nmdc:mga06r32_943816_c1 3300050510 Unclassified 817
651 nmdc:mga08y16_412358_c1 3300050511 Bacteria 1381
652 nmdc:mga08y16_690933_c1 3300050511 Unclassified 1021
653 nmdc:mga0n895_1142893_c1 3300050512 Bacteria 754
654 nmdc:mga0n895_2011_c1 3300050512 Bacteria 15626
655 nmdc:mga0n895_540458_c1 3300050512 Archaea 1172
656 nmdc:mga0n895_893884_c1 3300050512 Bacteria 874
657 nmdc:mga0n895_918982_c1 3300050512 Bacteria 860
658 nmdc:mga0rr50_243400_c1 3300050513 Bacteria 1491
659 nmdc:mga0rr50_365627_c1 3300050513 Unclassified 1215
660 nmdc:mga0rr50_95824_c1 3300050513 Unclassified 2320
661 nmdc:mga08x19_10821_c1 3300050514 Bacteria 5486
662 nmdc:mga0a205_130456_c1 3300050515 Bacteria 2414
663 nmdc:mga0a205_185057_c1 3300050515 Bacteria 1976
664 nmdc:mga0a205_535171_c1 3300050515 Bacteria 1027
665 nmdc:mga0a205_59556_c1 3300050515 Bacteria 3688
666 nmdc:mga0a205_83247_c1 3300050515 Bacteria 3090
667 Ga0501084_0012198 3300054114 Bacteria 7111
668 Ga0501084_0018137 3300054114 Bacteria 5862
669 Ga0501084_0032795 3300054114 Bacteria 4346
670 Ga0501084_0078704 3300054114 Unclassified 2763
671 Ga0501084_0116453 3300054114 Bacteria 2246
672 Ga0501084_0180567 3300054114 Bacteria 1781
673 Ga0501084_0188597 3300054114 Bacteria 1740
674 Ga0590071_014604 3300059421 Bacteria 1842
675 Ga0590074_036714 3300059423 Unclassified 876
676 Ga0590075_004856 3300059424 Bacteria 3180
677 Ga0590075_016974 3300059424 Archaea 1793
678 Ga0501082_0023164 3300060353 Bacteria 5356
679 Ga0501082_0048394 3300060353 Bacteria 3664
680 Ga0501082_0079964 3300060353 Bacteria 2820
681 Ga0501082_0156280 3300060353 Bacteria 1981
682 Ga0501082_0195226 3300060353 Bacteria 1761
683 Ga0501082_0300056 3300060353 Bacteria 1399
684 Ga0530510_0025511 3300061734 Bacteria 4227
685 Ga0530510_0085130 3300061734 Unclassified 2303
686 Ga0530510_0370164 3300061734 Bacteria 1078

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_11716877 Ga0157379_117168771 167
2 3300005336 Ga0070680_100029768 Ga0070680_1000297684 176
3 3300005445 Ga0070708_100041538 Ga0070708_1000415383 176
4 3300005458 Ga0070681_10137902 Ga0070681_101379023 176
5 3300005468 Ga0070707_100531370 Ga0070707_1005313701 176
6 3300005530 Ga0070679_100117920 Ga0070679_1001179204 176
7 3300005536 Ga0070697_100924547 Ga0070697_1009245471 176
8 3300005546 Ga0070696_100199998 Ga0070696_1001999982 176
9 3300005547 Ga0070693_100141054 Ga0070693_1001410543 176
10 3300006844 Ga0075428_100207787 Ga0075428_1002077872 176
11 3300006847 Ga0075431_100063152 Ga0075431_1000631523 176
12 3300006852 Ga0075433_10116747 Ga0075433_101167472 176
13 3300006871 Ga0075434_100001345 Ga0075434_10000134510 176
14 3300006880 Ga0075429_100043499 Ga0075429_1000434992 176
15 3300009147 Ga0114129_10308410 Ga0114129_103084102 176
16 3300025912 Ga0207707_10028011 Ga0207707_100280112 176
17 3300025917 Ga0207660_10041961 Ga0207660_100419612 176
18 3300025921 Ga0207652_10016876 Ga0207652_100168768 176
19 3300025922 Ga0207646_10356708 Ga0207646_103567082 176
20 3300042876 Ga0451577_0419946 Ga0451577_0419946_74_610 176
21 3300044673 Ga0453683_0008077 Ga0453683_0008077_870_1406 176
22 3300044673 Ga0453683_0606358 Ga0453683_0606358_150_686 176
23 3300045051 Ga0451576_0039117 Ga0451576_0039117_3891_4427 176
24 3300045051 Ga0451576_0391165 Ga0451576_0391165_277_813 176
25 3300049571 Ga0501034_0044000 Ga0501034_0044000_3798_4331 176
26 3300049571 Ga0501034_0114976 Ga0501034_0114976_2106_2639 176
27 3300049572 Ga0501036_0257200 Ga0501036_0257200_695_1228 176
28 3300049579 Ga0501043_0792777 Ga0501043_0792777_67_600 176
29 3300049583 Ga0501067_0005831 Ga0501067_0005831_5183_5716 176
30 3300049583 Ga0501067_0009208 Ga0501067_0009208_261_794 176
31 3300049584 Ga0501068_0001812 Ga0501068_0001812_2887_3420 176
32 3300049584 Ga0501068_0007727 Ga0501068_0007727_227_760 176
33 3300049585 Ga0501069_0012776 Ga0501069_0012776_170_703 176
34 3300049585 Ga0501069_0014049 Ga0501069_0014049_2532_3065 176
35 3300049585 Ga0501069_0061873 Ga0501069_0061873_1532_2065 176
36 3300049586 Ga0501070_0015434 Ga0501070_0015434_757_1290 176
37 3300049586 Ga0501070_0033441 Ga0501070_0033441_125_658 176
38 3300049586 Ga0501070_0045161 Ga0501070_0045161_682_1215 176
39 3300049586 Ga0501070_0083776 Ga0501070_0083776_1305_1838 176
40 3300049587 Ga0501071_0004064 Ga0501071_0004064_4186_4719 176
41 3300049587 Ga0501071_0420351 Ga0501071_0420351_398_931 176
42 3300049588 Ga0501072_0018594 Ga0501072_0018594_4066_4599 176
43 3300049588 Ga0501072_0042841 Ga0501072_0042841_2985_3518 176
44 3300049589 Ga0501073_0029915 Ga0501073_0029915_2539_3072 176
45 3300049589 Ga0501073_0052803 Ga0501073_0052803_259_792 176
46 3300049590 Ga0501074_0008030 Ga0501074_0008030_5180_5713 176
47 3300049590 Ga0501074_0022454 Ga0501074_0022454_3762_4295 176
48 3300049741 Ga0501079_0357893 Ga0501079_0357893_227_760 176
49 3300049742 Ga0501080_0032078 Ga0501080_0032078_2444_2977 176
50 3300049742 Ga0501080_0047393 Ga0501080_0047393_259_792 176
51 3300049744 Ga0501083_0004893 Ga0501083_0004893_3740_4273 176
52 3300049744 Ga0501083_0084757 Ga0501083_0084757_1523_2056 176
53 3300050507 nmdc:mga05p37_105756_c1 nmdc:mga05p37_105756_c1_1873_2409 176
54 3300050508 nmdc:mga09592_23347_c1 nmdc:mga09592_23347_c1_3960_4496 176
55 3300050510 nmdc:mga06r32_227606_c1 nmdc:mga06r32_227606_c1_672_1208 176
56 3300050512 nmdc:mga0n895_540458_c1 nmdc:mga0n895_540458_c1_321_857 176
57 3300050515 nmdc:mga0a205_130456_c1 nmdc:mga0a205_130456_c1_1582_2118 176
58 3300054114 Ga0501084_0116453 Ga0501084_0116453_1643_2176 176
59 3300054114 Ga0501084_0180567 Ga0501084_0180567_50_583 176
60 3300054114 Ga0501084_0188597 Ga0501084_0188597_32_565 176
61 3300060353 Ga0501082_0079964 Ga0501082_0079964_234_767 176
62 3300005444 Ga0070694_100022371 Ga0070694_1000223713 177
63 3300005518 Ga0070699_100072113 Ga0070699_1000721133 177
64 3300005545 Ga0070695_100098576 Ga0070695_1000985763 177
65 3300005546 Ga0070696_100002315 Ga0070696_10000231512 177
66 3300006847 Ga0075431_100609703 Ga0075431_1006097032 177
67 3300009147 Ga0114129_10524197 Ga0114129_105241972 177
68 3300014968 Ga0157379_10122476 Ga0157379_101224763 177
69 3300045051 Ga0451576_0060810 Ga0451576_0060810_1583_2122 177
70 3300048906 Ga0496103_0436400 Ga0496103_0436400_177_710 177
71 3300049583 Ga0501067_0130298 Ga0501067_0130298_803_1342 177
72 3300049587 Ga0501071_0546085 Ga0501071_0546085_63_602 177
73 3300049592 Ga0501076_0124950 Ga0501076_0124950_1380_1919 177
74 3300049741 Ga0501079_0225833 Ga0501079_0225833_102_641 177
75 3300049743 Ga0501081_0063481 Ga0501081_0063481_160_699 177
76 3300049824 Ga0501045_0517635 Ga0501045_0517635_301_834 177
77 3300050507 nmdc:mga05p37_402334_c1 nmdc:mga05p37_402334_c1_700_1233 177
78 3300050509 nmdc:mga0qj67_198609_c1 nmdc:mga0qj67_198609_c1_978_1511 177
79 3300050510 nmdc:mga06r32_20739_c1 nmdc:mga06r32_20739_c1_3323_3856 177
80 3300060353 Ga0501082_0195226 Ga0501082_0195226_832_1371 177
81 3300061734 Ga0530510_0370164 Ga0530510_0370164_108_641 177
82 3300004803 Ga0058862_10047534 Ga0058862_100475341 178
83 3300005329 Ga0070683_101007997 Ga0070683_1010079972 178
84 3300005330 Ga0070690_100011251 Ga0070690_1000112512 178
85 3300005336 Ga0070680_100183025 Ga0070680_1001830251 178
86 3300005336 Ga0070680_100525113 Ga0070680_1005251132 178
87 3300005337 Ga0070682_100267759 Ga0070682_1002677591 178
88 3300005339 Ga0070660_100957345 Ga0070660_1009573451 178
89 3300005340 Ga0070689_101060078 Ga0070689_1010600781 178
90 3300005341 Ga0070691_10098121 Ga0070691_100981211 178
91 3300005341 Ga0070691_10262915 Ga0070691_102629151 178
92 3300005344 Ga0070661_100624612 Ga0070661_1006246121 178
93 3300005345 Ga0070692_10050709 Ga0070692_100507092 178
94 3300005345 Ga0070692_10512752 Ga0070692_105127522 178
95 3300005353 Ga0070669_100413474 Ga0070669_1004134742 178
96 3300005354 Ga0070675_100089952 Ga0070675_1000899523 178
97 3300005355 Ga0070671_100028927 Ga0070671_1000289275 178
98 3300005365 Ga0070688_100564168 Ga0070688_1005641681 178
99 3300005366 Ga0070659_100114880 Ga0070659_1001148802 178
100 3300005366 Ga0070659_100356395 Ga0070659_1003563952 178
101 3300005434 Ga0070709_10207767 Ga0070709_102077673 178
102 3300005438 Ga0070701_10230518 Ga0070701_102305182 178
103 3300005439 Ga0070711_100000102 Ga0070711_10000010242 178
104 3300005439 Ga0070711_100761413 Ga0070711_1007614131 178
105 3300005440 Ga0070705_100037361 Ga0070705_1000373613 178
106 3300005441 Ga0070700_100507475 Ga0070700_1005074751 178
107 3300005444 Ga0070694_100161116 Ga0070694_1001611162 178
108 3300005445 Ga0070708_100073459 Ga0070708_1000734594 178
109 3300005445 Ga0070708_100263574 Ga0070708_1002635743 178
110 3300005455 Ga0070663_100154417 Ga0070663_1001544172 178
111 3300005455 Ga0070663_101048340 Ga0070663_1010483401 178
112 3300005467 Ga0070706_100670593 Ga0070706_1006705931 178
113 3300005467 Ga0070706_100767066 Ga0070706_1007670662 178
114 3300005468 Ga0070707_100012208 Ga0070707_1000122082 178
115 3300005468 Ga0070707_100072853 Ga0070707_1000728533 178
116 3300005468 Ga0070707_100218541 Ga0070707_1002185412 178
117 3300005468 Ga0070707_100381693 Ga0070707_1003816931 178
118 3300005471 Ga0070698_100010863 Ga0070698_1000108635 178
119 3300005471 Ga0070698_100032052 Ga0070698_1000320524 178
120 3300005471 Ga0070698_100094655 Ga0070698_1000946551 178
121 3300005471 Ga0070698_100099506 Ga0070698_1000995064 178
122 3300005471 Ga0070698_100286524 Ga0070698_1002865242 178
123 3300005471 Ga0070698_100856901 Ga0070698_1008569012 178
124 3300005518 Ga0070699_100001206 Ga0070699_10000120615 178
125 3300005518 Ga0070699_100001560 Ga0070699_10000156016 178
126 3300005518 Ga0070699_100024573 Ga0070699_1000245732 178
127 3300005518 Ga0070699_100049215 Ga0070699_1000492154 178
128 3300005518 Ga0070699_100130662 Ga0070699_1001306622 178
129 3300005530 Ga0070679_100063566 Ga0070679_1000635662 178
130 3300005530 Ga0070679_100378334 Ga0070679_1003783342 178
131 3300005535 Ga0070684_101036402 Ga0070684_1010364021 178
132 3300005539 Ga0068853_100469796 Ga0068853_1004697961 178
133 3300005543 Ga0070672_100141839 Ga0070672_1001418393 178
134 3300005544 Ga0070686_100143449 Ga0070686_1001434491 178
135 3300005544 Ga0070686_100557900 Ga0070686_1005579001 178
136 3300005545 Ga0070695_100130546 Ga0070695_1001305461 178
137 3300005545 Ga0070695_100418389 Ga0070695_1004183891 178
138 3300005546 Ga0070696_100021954 Ga0070696_1000219542 178
139 3300005546 Ga0070696_100024646 Ga0070696_1000246464 178
140 3300005546 Ga0070696_100055845 Ga0070696_1000558452 178
141 3300005546 Ga0070696_100259198 Ga0070696_1002591982 178
142 3300005546 Ga0070696_101151383 Ga0070696_1011513831 178
143 3300005547 Ga0070693_100050989 Ga0070693_1000509892 178
144 3300005548 Ga0070665_100128144 Ga0070665_1001281443 178
145 3300005548 Ga0070665_100271467 Ga0070665_1002714672 178
146 3300005549 Ga0070704_100000855 Ga0070704_1000008554 178
147 3300005549 Ga0070704_100006919 Ga0070704_1000069194 178
148 3300005564 Ga0070664_100854615 Ga0070664_1008546151 178
149 3300005577 Ga0068857_101032048 Ga0068857_1010320482 178
150 3300005578 Ga0068854_100929561 Ga0068854_1009295612 178
151 3300005614 Ga0068856_100501079 Ga0068856_1005010792 178
152 3300005616 Ga0068852_100678687 Ga0068852_1006786872 178
153 3300005617 Ga0068859_100032642 Ga0068859_1000326425 178
154 3300005617 Ga0068859_100140770 Ga0068859_1001407702 178
155 3300005617 Ga0068859_100671415 Ga0068859_1006714152 178
156 3300005618 Ga0068864_100028332 Ga0068864_1000283325 178
157 3300005618 Ga0068864_100918073 Ga0068864_1009180731 178
158 3300005718 Ga0068866_10792209 Ga0068866_107922091 178
159 3300005834 Ga0068851_10325479 Ga0068851_103254792 178
160 3300005840 Ga0068870_10548462 Ga0068870_105484622 178
161 3300005841 Ga0068863_100049521 Ga0068863_1000495214 178
162 3300005842 Ga0068858_100060625 Ga0068858_1000606256 178
163 3300005843 Ga0068860_100291380 Ga0068860_1002913802 178
164 3300005843 Ga0068860_100390387 Ga0068860_1003903872 178
165 3300005843 Ga0068860_101212113 Ga0068860_1012121132 178
166 3300005844 Ga0068862_101198624 Ga0068862_1011986241 178
167 3300006163 Ga0070715_10080104 Ga0070715_100801042 178
168 3300006163 Ga0070715_10524791 Ga0070715_105247912 178
169 3300006175 Ga0070712_100044684 Ga0070712_1000446844 178
170 3300006844 Ga0075428_101465180 Ga0075428_1014651801 178
171 3300006846 Ga0075430_100494912 Ga0075430_1004949121 178
172 3300006847 Ga0075431_100186529 Ga0075431_1001865293 178
173 3300006847 Ga0075431_100343014 Ga0075431_1003430142 178
174 3300006852 Ga0075433_10069132 Ga0075433_100691322 178
175 3300006852 Ga0075433_10161239 Ga0075433_101612392 178
176 3300006852 Ga0075433_10179885 Ga0075433_101798852 178
177 3300006871 Ga0075434_100076933 Ga0075434_1000769331 178
178 3300006880 Ga0075429_100010791 Ga0075429_1000107919 178
179 3300006880 Ga0075429_100138559 Ga0075429_1001385592 178
180 3300006881 Ga0068865_101322053 Ga0068865_1013220531 178
181 3300006931 Ga0097620_100032641 Ga0097620_1000326415 178
182 3300006931 Ga0097620_100140774 Ga0097620_1001407742 178
183 3300006931 Ga0097620_100671424 Ga0097620_1006714242 178
184 3300007076 Ga0075435_100080594 Ga0075435_1000805943 178
185 3300007076 Ga0075435_100104673 Ga0075435_1001046733 178
186 3300009092 Ga0105250_10158497 Ga0105250_101584972 178
187 3300009094 Ga0111539_10062423 Ga0111539_100624232 178
188 3300009147 Ga0114129_10122655 Ga0114129_101226552 178
189 3300009147 Ga0114129_11044112 Ga0114129_110441121 178
190 3300009147 Ga0114129_11088404 Ga0114129_110884042 178
191 3300009147 Ga0114129_11209627 Ga0114129_112096272 178
192 3300009147 Ga0114129_11532326 Ga0114129_115323261 178
193 3300009174 Ga0105241_10544772 Ga0105241_105447721 178
194 3300009177 Ga0105248_10031052 Ga0105248_100310521 178
195 3300009177 Ga0105248_10178643 Ga0105248_101786432 178
196 3300009177 Ga0105248_10675974 Ga0105248_106759742 178
197 3300009177 Ga0105248_10966132 Ga0105248_109661321 178
198 3300009545 Ga0105237_10317984 Ga0105237_103179842 178
199 3300009553 Ga0105249_10595025 Ga0105249_105950252 178
200 3300010375 Ga0105239_10006776 Ga0105239_1000677613 178
201 3300010375 Ga0105239_10914193 Ga0105239_109141932 178
202 3300011119 Ga0105246_11188633 Ga0105246_111886331 178
203 3300013306 Ga0163162_10003097 Ga0163162_100030977 178
204 3300013306 Ga0163162_10873565 Ga0163162_108735651 178
205 3300013308 Ga0157375_11985476 Ga0157375_119854761 178
206 3300014325 Ga0163163_10084441 Ga0163163_100844413 178
207 3300014325 Ga0163163_10090141 Ga0163163_100901412 178
208 3300014745 Ga0157377_10371196 Ga0157377_103711961 178
209 3300014968 Ga0157379_10755839 Ga0157379_107558391 178
210 3300025911 Ga0207654_10289596 Ga0207654_102895962 178
211 3300025912 Ga0207707_10037864 Ga0207707_100378644 178
212 3300025912 Ga0207707_10136560 Ga0207707_101365602 178
213 3300025912 Ga0207707_10211565 Ga0207707_102115652 178
214 3300025915 Ga0207693_10071148 Ga0207693_100711483 178
215 3300025916 Ga0207663_10064518 Ga0207663_100645181 178
216 3300025917 Ga0207660_10523827 Ga0207660_105238271 178
217 3300025919 Ga0207657_10200591 Ga0207657_102005913 178
218 3300025920 Ga0207649_10494772 Ga0207649_104947722 178
219 3300025921 Ga0207652_10659745 Ga0207652_106597452 178
220 3300025922 Ga0207646_10220250 Ga0207646_102202501 178
221 3300025922 Ga0207646_10239499 Ga0207646_102394991 178
222 3300025926 Ga0207659_10081037 Ga0207659_100810372 178
223 3300025926 Ga0207659_10138290 Ga0207659_101382901 178
224 3300025931 Ga0207644_10148016 Ga0207644_101480163 178
225 3300025932 Ga0207690_10209958 Ga0207690_102099582 178
226 3300025932 Ga0207690_10453253 Ga0207690_104532532 178
227 3300025933 Ga0207706_10869204 Ga0207706_108692042 178
228 3300025937 Ga0207669_10830320 Ga0207669_108303201 178
229 3300025941 Ga0207711_10266398 Ga0207711_102663982 178
230 3300025941 Ga0207711_10286177 Ga0207711_102861771 178
231 3300025945 Ga0207679_10665883 Ga0207679_106658832 178
232 3300025960 Ga0207651_10438928 Ga0207651_104389282 178
233 3300025986 Ga0207658_10913867 Ga0207658_109138672 178
234 3300026035 Ga0207703_10418405 Ga0207703_104184051 178
235 3300026041 Ga0207639_10621818 Ga0207639_106218182 178
236 3300026067 Ga0207678_10805971 Ga0207678_108059711 178
237 3300026078 Ga0207702_10942387 Ga0207702_109423872 178
238 3300026088 Ga0207641_10037905 Ga0207641_100379053 178
239 3300026088 Ga0207641_11281545 Ga0207641_112815452 178
240 3300026095 Ga0207676_10340579 Ga0207676_103405792 178
241 3300026116 Ga0207674_10765498 Ga0207674_107654981 178
242 3300026142 Ga0207698_11037715 Ga0207698_110377151 178
243 3300027462 Ga0210000_1033317 Ga0210000_10333171 178
244 3300027876 Ga0209974_10017856 Ga0209974_100178562 178
245 3300027876 Ga0209974_10032063 Ga0209974_100320632 178
246 3300028379 Ga0268266_10075592 Ga0268266_100755923 178
247 3300028380 Ga0268265_10512233 Ga0268265_105122331 178
248 3300028381 Ga0268264_10843938 Ga0268264_108439381 178
249 3300031548 Ga0307408_100051148 Ga0307408_1000511483 178
250 3300031548 Ga0307408_100165045 Ga0307408_1001650452 178
251 3300031548 Ga0307408_100229906 Ga0307408_1002299062 178
252 3300031548 Ga0307408_100404857 Ga0307408_1004048572 178
253 3300031548 Ga0307408_100785642 Ga0307408_1007856422 178
254 3300031731 Ga0307405_10004165 Ga0307405_100041656 178
255 3300031731 Ga0307405_10510436 Ga0307405_105104361 178
256 3300031824 Ga0307413_10004454 Ga0307413_100044546 178
257 3300031824 Ga0307413_10007272 Ga0307413_100072722 178
258 3300031824 Ga0307413_10007540 Ga0307413_100075402 178
259 3300031852 Ga0307410_10002699 Ga0307410_100026992 178
260 3300031852 Ga0307410_10131559 Ga0307410_101315592 178
261 3300031852 Ga0307410_10708428 Ga0307410_107084281 178
262 3300031901 Ga0307406_10679428 Ga0307406_106794282 178
263 3300031903 Ga0307407_10005734 Ga0307407_100057342 178
264 3300031903 Ga0307407_10018773 Ga0307407_100187733 178
265 3300031903 Ga0307407_10100741 Ga0307407_101007412 178
266 3300031903 Ga0307407_10224024 Ga0307407_102240241 178
267 3300031911 Ga0307412_10011948 Ga0307412_100119485 178
268 3300031911 Ga0307412_10309156 Ga0307412_103091562 178
269 3300031995 Ga0307409_100002275 Ga0307409_10000227511 178
270 3300031995 Ga0307409_100091330 Ga0307409_1000913302 178
271 3300031995 Ga0307409_100096578 Ga0307409_1000965783 178
272 3300032002 Ga0307416_100024136 Ga0307416_1000241362 178
273 3300032002 Ga0307416_100029603 Ga0307416_1000296033 178
274 3300032002 Ga0307416_100045355 Ga0307416_1000453552 178
275 3300032002 Ga0307416_100072270 Ga0307416_1000722702 178
276 3300032002 Ga0307416_100079063 Ga0307416_1000790632 178
277 3300032004 Ga0307414_10006731 Ga0307414_100067317 178
278 3300032004 Ga0307414_10041942 Ga0307414_100419422 178
279 3300032004 Ga0307414_10088458 Ga0307414_100884582 178
280 3300032005 Ga0307411_10012443 Ga0307411_100124433 178
281 3300032005 Ga0307411_10024192 Ga0307411_100241923 178
282 3300032005 Ga0307411_10128694 Ga0307411_101286942 178
283 3300032005 Ga0307411_10826035 Ga0307411_108260351 178
284 3300032126 Ga0307415_100011456 Ga0307415_1000114563 178
285 3300032126 Ga0307415_100087846 Ga0307415_1000878462 178
286 3300032126 Ga0307415_100163279 Ga0307415_1001632792 178
287 3300035084 Ga0373928_0030593 Ga0373928_0030593_344_880 178
288 3300035084 Ga0373928_0143468 Ga0373928_0143468_105_641 178
289 3300035085 Ga0373929_0020923 Ga0373929_0020923_330_866 178
290 3300035088 Ga0373940_0170410 Ga0373940_0170410_16_552 178
291 3300035090 Ga0373949_0144662 Ga0373949_0144662_125_661 178
292 3300035091 Ga0373951_0150653 Ga0373951_0150653_11_547 178
293 3300035112 Ga0373932_0246169 Ga0373932_0246169_11_547 178
294 3300035114 Ga0373939_0094819 Ga0373939_0094819_457_993 178
295 3300035114 Ga0373939_0103729 Ga0373939_0103729_303_839 178
296 3300035115 Ga0373941_0160611 Ga0373941_0160611_218_754 178
297 3300035121 Ga0373960_0174229 Ga0373960_0174229_111_647 178
298 3300035241 Ga0373961_0044322 Ga0373961_0044322_635_1171 178
299 3300035241 Ga0373961_0085816 Ga0373961_0085816_434_970 178
300 3300035241 Ga0373961_0139437 Ga0373961_0139437_99_635 178
301 3300035242 Ga0373962_0025813 Ga0373962_0025813_968_1504 178
302 3300035398 Ga0316574_0045654 Ga0316574_0045654_1949_2485 178
303 3300035691 Ga0373931_0127275 Ga0373931_0127275_56_592 178
304 3300037068 Ga0373925_0342123 Ga0373925_0342123_124_660 178
305 3300037471 Ga0395905_0084365 Ga0395905_0084365_232_768 178
306 3300037471 Ga0395905_0980098 Ga0395905_0980098_43_579 178
307 3300038443 Ga0395901_0833825 Ga0395901_0833825_41_577 178
308 3300038996 Ga0242420_056267 Ga0242420_056267_87_623 178
309 3300041486 Ga0451807_0740935 Ga0451807_0740935_124_660 178
310 3300042004 Ga0439445_0044856 Ga0439445_0044856_303_839 178
311 3300042156 Ga0439446_0045349 Ga0439446_0045349_14_550 178
312 3300042436 Ga0439435_0010258 Ga0439435_0010258_890_1426 178
313 3300042876 Ga0451577_0045051 Ga0451577_0045051_426_962 178
314 3300042876 Ga0451577_0601089 Ga0451577_0601089_129_665 178
315 3300044673 Ga0453683_0087489 Ga0453683_0087489_182_718 178
316 3300044712 Ga0453684_1097481 Ga0453684_1097481_189_725 178
317 3300045051 Ga0451576_0043261 Ga0451576_0043261_2049_2585 178
318 3300045051 Ga0451576_0101612 Ga0451576_0101612_1191_1727 178
319 3300046457 Ga0495590_0229310 Ga0495590_0229310_109_645 178
320 3300046514 Ga0495618_0170710 Ga0495618_0170710_26_565 178
321 3300046516 Ga0495628_0352962 Ga0495628_0352962_389_928 178
322 3300046533 Ga0495640_0055778 Ga0495640_0055778_926_1465 178
323 3300046535 Ga0495586_0020189 Ga0495586_0020189_2831_3370 178
324 3300046535 Ga0495586_0095484 Ga0495586_0095484_928_1467 178
325 3300046559 Ga0495667_0362787 Ga0495667_0362787_79_618 178
326 3300046642 Ga0495634_0003912 Ga0495634_0003912_2083_2622 178
327 3300046681 Ga0495647_0004836 Ga0495647_0004836_429_968 178
328 3300047319 Ga0495674_0250267 Ga0495674_0250267_843_1382 178
329 3300047321 Ga0495676_0648973 Ga0495676_0648973_28_567 178
330 3300047322 Ga0495680_0018395 Ga0495680_0018395_3766_4305 178
331 3300048903 Ga0496100_0020060 Ga0496100_0020060_1197_1733 178
332 3300048903 Ga0496100_0518736 Ga0496100_0518736_33_569 178
333 3300048904 Ga0496101_0104052 Ga0496101_0104052_287_823 178
334 3300048904 Ga0496101_0241111 Ga0496101_0241111_743_1279 178
335 3300048905 Ga0496102_0004430 Ga0496102_0004430_543_1079 178
336 3300048905 Ga0496102_0041289 Ga0496102_0041289_2555_3091 178
337 3300048905 Ga0496102_0044769 Ga0496102_0044769_1840_2376 178
338 3300048905 Ga0496102_0155598 Ga0496102_0155598_871_1407 178
339 3300048905 Ga0496102_1273946 Ga0496102_1273946_105_641 178
340 3300048906 Ga0496103_0017126 Ga0496103_0017126_1344_1880 178
341 3300048906 Ga0496103_0270130 Ga0496103_0270130_319_855 178
342 3300048907 Ga0496104_0012154 Ga0496104_0012154_4251_4787 178
343 3300048907 Ga0496104_0516753 Ga0496104_0516753_35_571 178
344 3300048907 Ga0496104_0788460 Ga0496104_0788460_309_845 178
345 3300048908 Ga0496105_0009978 Ga0496105_0009978_986_1522 178
346 3300048908 Ga0496105_0222306 Ga0496105_0222306_330_866 178
347 3300048909 Ga0496106_0105265 Ga0496106_0105265_791_1327 178
348 3300048909 Ga0496106_0144630 Ga0496106_0144630_1243_1779 178
349 3300048909 Ga0496106_0283625 Ga0496106_0283625_655_1191 178
350 3300048910 Ga0496107_0068715 Ga0496107_0068715_121_657 178
351 3300048910 Ga0496107_0137799 Ga0496107_0137799_111_647 178
352 3300048911 Ga0496108_0000530 Ga0496108_0000530_18552_19088 178
353 3300048911 Ga0496108_0017523 Ga0496108_0017523_2711_3247 178
354 3300048911 Ga0496108_0375471 Ga0496108_0375471_646_1182 178
355 3300048912 Ga0496109_0000886 Ga0496109_0000886_20691_21227 178
356 3300048912 Ga0496109_0004406 Ga0496109_0004406_11088_11624 178
357 3300048912 Ga0496109_0224109 Ga0496109_0224109_170_706 178
358 3300048913 Ga0496110_0095154 Ga0496110_0095154_1406_1942 178
359 3300048913 Ga0496110_0495702 Ga0496110_0495702_148_684 178
360 3300048913 Ga0496110_0838271 Ga0496110_0838271_222_758 178
361 3300048914 Ga0496111_0008935 Ga0496111_0008935_5680_6216 178
362 3300048914 Ga0496111_0017882 Ga0496111_0017882_1380_1916 178
363 3300048914 Ga0496111_0033125 Ga0496111_0033125_2799_3335 178
364 3300048915 Ga0496112_0000343 Ga0496112_0000343_14731_15267 178
365 3300048915 Ga0496112_0006525 Ga0496112_0006525_4053_4589 178
366 3300048915 Ga0496112_0025908 Ga0496112_0025908_4118_4654 178
367 3300048915 Ga0496112_0048083 Ga0496112_0048083_3319_3855 178
368 3300048916 Ga0496113_0000225 Ga0496113_0000225_13987_14523 178
369 3300048916 Ga0496113_0001395 Ga0496113_0001395_11158_11694 178
370 3300048917 Ga0496114_0130019 Ga0496114_0130019_1547_2083 178
371 3300048918 Ga0496115_0238999 Ga0496115_0238999_107_643 178
372 3300048918 Ga0496115_0673009 Ga0496115_0673009_172_708 178
373 3300049568 Ga0501031_0240090 Ga0501031_0240090_630_1166 178
374 3300049570 Ga0501033_0124194 Ga0501033_0124194_165_701 178
375 3300049577 Ga0501041_0158922 Ga0501041_0158922_730_1266 178
376 3300049580 Ga0501046_0118158 Ga0501046_0118158_1406_1942 178
377 3300049582 Ga0501048_0482762 Ga0501048_0482762_339_875 178
378 3300049584 Ga0501068_0245079 Ga0501068_0245079_568_1104 178
379 3300049585 Ga0501069_0291042 Ga0501069_0291042_145_681 178
380 3300049589 Ga0501073_0045950 Ga0501073_0045950_1030_1566 178
381 3300049592 Ga0501076_0080019 Ga0501076_0080019_693_1229 178
382 3300049592 Ga0501076_0516432 Ga0501076_0516432_360_896 178
383 3300049593 Ga0501077_0020192 Ga0501077_0020192_3542_4078 178
384 3300049593 Ga0501077_0576539 Ga0501077_0576539_119_655 178
385 3300049661 Ga0501217_020278 Ga0501217_020278_558_1094 178
386 3300049679 Ga0501249_061784 Ga0501249_061784_249_785 178
387 3300049741 Ga0501079_0859297 Ga0501079_0859297_118_654 178
388 3300049742 Ga0501080_0039082 Ga0501080_0039082_855_1391 178
389 3300049742 Ga0501080_0821118 Ga0501080_0821118_32_568 178
390 3300049742 Ga0501080_1105087 Ga0501080_1105087_102_638 178
391 3300049743 Ga0501081_0168698 Ga0501081_0168698_93_629 178
392 3300049744 Ga0501083_0114634 Ga0501083_0114634_792_1328 178
393 3300049744 Ga0501083_0578988 Ga0501083_0578988_169_705 178
394 3300049765 Ga0501268_040747 Ga0501268_040747_186_722 178
395 3300049824 Ga0501045_0015441 Ga0501045_0015441_2108_2644 178
396 3300049824 Ga0501045_0179605 Ga0501045_0179605_962_1498 178
397 3300049824 Ga0501045_0723335 Ga0501045_0723335_38_574 178
398 3300050507 nmdc:mga05p37_1174461_c1 nmdc:mga05p37_1174461_c1_233_769 178
399 3300050507 nmdc:mga05p37_170861_c1 nmdc:mga05p37_170861_c1_511_1047 178
400 3300050507 nmdc:mga05p37_360796_c1 nmdc:mga05p37_360796_c1_342_878 178
401 3300050507 nmdc:mga05p37_763454_c1 nmdc:mga05p37_763454_c1_369_905 178
402 3300050508 nmdc:mga09592_136933_c1 nmdc:mga09592_136933_c1_324_860 178
403 3300050508 nmdc:mga09592_483369_c1 nmdc:mga09592_483369_c1_12_548 178
404 3300050511 nmdc:mga08y16_412358_c1 nmdc:mga08y16_412358_c1_501_1037 178
405 3300050511 nmdc:mga08y16_690933_c1 nmdc:mga08y16_690933_c1_170_706 178
406 3300050512 nmdc:mga0n895_1142893_c1 nmdc:mga0n895_1142893_c1_23_559 178
407 3300050512 nmdc:mga0n895_893884_c1 nmdc:mga0n895_893884_c1_10_546 178
408 3300050512 nmdc:mga0n895_918982_c1 nmdc:mga0n895_918982_c1_115_651 178
409 3300050513 nmdc:mga0rr50_95824_c1 nmdc:mga0rr50_95824_c1_1180_1716 178
410 3300050515 nmdc:mga0a205_185057_c1 nmdc:mga0a205_185057_c1_782_1318 178
411 3300050515 nmdc:mga0a205_59556_c1 nmdc:mga0a205_59556_c1_1114_1650 178
412 3300050515 nmdc:mga0a205_83247_c1 nmdc:mga0a205_83247_c1_273_809 178
413 3300054114 Ga0501084_0012198 Ga0501084_0012198_1374_1910 178
414 3300054114 Ga0501084_0078704 Ga0501084_0078704_1024_1560 178
415 3300060353 Ga0501082_0156280 Ga0501082_0156280_1401_1937 178
416 3300060353 Ga0501082_0300056 Ga0501082_0300056_837_1373 178
417 3300061734 Ga0530510_0025511 Ga0530510_0025511_3612_4148 178
418 3300005334 Ga0068869_100034358 Ga0068869_1000343584 179
419 3300005335 Ga0070666_10193131 Ga0070666_101931312 179
420 3300005336 Ga0070680_100033249 Ga0070680_1000332491 179
421 3300005345 Ga0070692_10162238 Ga0070692_101622381 179
422 3300005347 Ga0070668_100282918 Ga0070668_1002829181 179
423 3300005353 Ga0070669_100003834 Ga0070669_1000038348 179
424 3300005355 Ga0070671_100853265 Ga0070671_1008532651 179
425 3300005356 Ga0070674_100004305 Ga0070674_1000043055 179
426 3300005367 Ga0070667_100010120 Ga0070667_1000101206 179
427 3300005438 Ga0070701_10178859 Ga0070701_101788592 179
428 3300005440 Ga0070705_100005926 Ga0070705_1000059264 179
429 3300005441 Ga0070700_100110730 Ga0070700_1001107303 179
430 3300005455 Ga0070663_100566497 Ga0070663_1005664972 179
431 3300005457 Ga0070662_100000777 Ga0070662_10000077717 179
432 3300005459 Ga0068867_100001516 Ga0068867_10000151613 179
433 3300005544 Ga0070686_100168115 Ga0070686_1001681152 179
434 3300005545 Ga0070695_100007192 Ga0070695_1000071926 179
435 3300005546 Ga0070696_100045007 Ga0070696_1000450074 179
436 3300005547 Ga0070693_100001534 Ga0070693_1000015347 179
437 3300005563 Ga0068855_100111162 Ga0068855_1001111621 179
438 3300005578 Ga0068854_100009366 Ga0068854_1000093666 179
439 3300005615 Ga0070702_100006351 Ga0070702_1000063512 179
440 3300005618 Ga0068864_100001860 Ga0068864_1000018607 179
441 3300005718 Ga0068866_10000032 Ga0068866_1000003233 179
442 3300005719 Ga0068861_100010300 Ga0068861_1000103005 179
443 3300005840 Ga0068870_10015518 Ga0068870_100155182 179
444 3300005843 Ga0068860_100018732 Ga0068860_1000187326 179
445 3300005843 Ga0068860_100714083 Ga0068860_1007140832 179
446 3300006237 Ga0097621_100090456 Ga0097621_1000904564 179
447 3300006358 Ga0068871_100043892 Ga0068871_1000438923 179
448 3300006881 Ga0068865_100008061 Ga0068865_1000080614 179
449 3300006881 Ga0068865_100341299 Ga0068865_1003412992 179
450 3300009093 Ga0105240_10072817 Ga0105240_100728173 179
451 3300009098 Ga0105245_10039144 Ga0105245_100391442 179
452 3300009174 Ga0105241_10017383 Ga0105241_100173834 179
453 3300009176 Ga0105242_10001646 Ga0105242_1000164614 179
454 3300009177 Ga0105248_10001568 Ga0105248_1000156821 179
455 3300009551 Ga0105238_10512676 Ga0105238_105126761 179
456 3300009553 Ga0105249_10010310 Ga0105249_100103106 179
457 3300009553 Ga0105249_10069819 Ga0105249_100698192 179
458 3300009553 Ga0105249_10212988 Ga0105249_102129882 179
459 3300009553 Ga0105249_10235648 Ga0105249_102356482 179
460 3300010375 Ga0105239_10003875 Ga0105239_1000387514 179
461 3300011119 Ga0105246_10048552 Ga0105246_100485521 179
462 3300013297 Ga0157378_10000139 Ga0157378_100001392 179
463 3300013306 Ga0163162_10029330 Ga0163162_100293304 179
464 3300013307 Ga0157372_10118575 Ga0157372_101185752 179
465 3300013308 Ga0157375_10071737 Ga0157375_100717373 179
466 3300014325 Ga0163163_10316965 Ga0163163_103169651 179
467 3300014326 Ga0157380_10008310 Ga0157380_100083103 179
468 3300014968 Ga0157379_10010151 Ga0157379_100101514 179
469 3300014969 Ga0157376_10615504 Ga0157376_106155042 179
470 3300017792 Ga0163161_10071511 Ga0163161_100715114 179
471 3300025315 Ga0207697_10017558 Ga0207697_100175583 179
472 3300025903 Ga0207680_10150828 Ga0207680_101508282 179
473 3300025907 Ga0207645_10001229 Ga0207645_100012293 179
474 3300025908 Ga0207643_10001967 Ga0207643_100019679 179
475 3300025911 Ga0207654_10017992 Ga0207654_100179922 179
476 3300025913 Ga0207695_10257778 Ga0207695_102577783 179
477 3300025923 Ga0207681_10007199 Ga0207681_100071994 179
478 3300025926 Ga0207659_10050023 Ga0207659_100500234 179
479 3300025927 Ga0207687_10162736 Ga0207687_101627362 179
480 3300025931 Ga0207644_10788811 Ga0207644_107888111 179
481 3300025932 Ga0207690_10152833 Ga0207690_101528332 179
482 3300025933 Ga0207706_10000011 Ga0207706_10000011116 179
483 3300025934 Ga0207686_10000172 Ga0207686_1000017232 179
484 3300025935 Ga0207709_10007865 Ga0207709_100078651 179
485 3300025937 Ga0207669_10000157 Ga0207669_100001576 179
486 3300025938 Ga0207704_10002088 Ga0207704_100020884 179
487 3300025941 Ga0207711_10002317 Ga0207711_1000231712 179
488 3300025942 Ga0207689_10037850 Ga0207689_100378504 179
489 3300025961 Ga0207712_10002980 Ga0207712_100029804 179
490 3300025961 Ga0207712_10038810 Ga0207712_100388103 179
491 3300025961 Ga0207712_10513498 Ga0207712_105134982 179
492 3300026035 Ga0207703_10024972 Ga0207703_100249722 179
493 3300026067 Ga0207678_10064660 Ga0207678_100646602 179
494 3300026067 Ga0207678_10468046 Ga0207678_104680461 179
495 3300026075 Ga0207708_10253435 Ga0207708_102534352 179
496 3300026089 Ga0207648_10000011 Ga0207648_10000011150 179
497 3300026095 Ga0207676_10635609 Ga0207676_106356091 179
498 3300026118 Ga0207675_100011521 Ga0207675_1000115215 179
499 3300026121 Ga0207683_10001778 Ga0207683_1000177817 179
500 3300028380 Ga0268265_10061627 Ga0268265_100616272 179
501 3300028381 Ga0268264_10007728 Ga0268264_100077282 179
502 3300041486 Ga0451807_1594444 Ga0451807_1594444_1438_1977 179
503 3300041505 Ga0451849_0262525 Ga0451849_0262525_113_652 179
504 3300046455 Ga0495603_0031150 Ga0495603_0031150_1620_2159 179
505 3300046475 Ga0495639_0025905 Ga0495639_0025905_1074_1613 179
506 3300046499 Ga0495594_0003842 Ga0495594_0003842_2841_3380 179
507 3300046523 Ga0495644_0135173 Ga0495644_0135173_14_553 179
508 3300046557 Ga0495622_0017733 Ga0495622_0017733_1073_1612 179
509 3300046664 Ga0495659_0093914 Ga0495659_0093914_264_803 179
510 3300046674 Ga0495588_0173303 Ga0495588_0173303_497_1036 179
511 3300046675 Ga0495657_0184570 Ga0495657_0184570_228_767 179
512 3300047318 Ga0495636_0025903 Ga0495636_0025903_1037_1576 179
513 3300048909 Ga0496106_0029511 Ga0496106_0029511_1047_1586 179
514 3300048917 Ga0496114_0045367 Ga0496114_0045367_1275_1814 179
515 3300049742 Ga0501080_0071855 Ga0501080_0071855_904_1443 179
516 3300050515 nmdc:mga0a205_535171_c1 nmdc:mga0a205_535171_c1_288_827 179
517 3300006846 Ga0075430_100211724 Ga0075430_1002117242 180
518 3300006847 Ga0075431_100075065 Ga0075431_1000750655 180
519 3300048905 Ga0496102_0206692 Ga0496102_0206692_177_728 180
520 3300049583 Ga0501067_0287159 Ga0501067_0287159_295_846 180
521 3300049584 Ga0501068_0102951 Ga0501068_0102951_1101_1652 180
522 3300049591 Ga0501075_0178679 Ga0501075_0178679_257_811 180
523 3300049743 Ga0501081_0837442 Ga0501081_0837442_28_579 180
524 3300050510 nmdc:mga06r32_943816_c1 nmdc:mga06r32_943816_c1_206_757 180
525 3300004799 Ga0058863_11731781 Ga0058863_117317811 181
526 3300005293 Ga0065715_10363302 Ga0065715_103633022 181
527 3300005434 Ga0070709_10683409 Ga0070709_106834092 181
528 3300005440 Ga0070705_100012010 Ga0070705_1000120102 181
529 3300005445 Ga0070708_100002594 Ga0070708_1000025947 181
530 3300005445 Ga0070708_100059681 Ga0070708_1000596812 181
531 3300005467 Ga0070706_100042627 Ga0070706_1000426273 181
532 3300005468 Ga0070707_100002297 Ga0070707_1000022972 181
533 3300005518 Ga0070699_100003944 Ga0070699_1000039446 181
534 3300005536 Ga0070697_100049445 Ga0070697_1000494454 181
535 3300005536 Ga0070697_100116433 Ga0070697_1001164332 181
536 3300005539 Ga0068853_100419163 Ga0068853_1004191632 181
537 3300005545 Ga0070695_100144550 Ga0070695_1001445502 181
538 3300005546 Ga0070696_100181802 Ga0070696_1001818022 181
539 3300005546 Ga0070696_100349770 Ga0070696_1003497702 181
540 3300005564 Ga0070664_100015342 Ga0070664_1000153423 181
541 3300005577 Ga0068857_101028156 Ga0068857_1010281562 181
542 3300005618 Ga0068864_100016288 Ga0068864_1000162885 181
543 3300005841 Ga0068863_100168876 Ga0068863_1001688763 181
544 3300005937 Ga0081455_10047462 Ga0081455_100474625 181
545 3300005981 Ga0081538_10067306 Ga0081538_100673063 181
546 3300006844 Ga0075428_100005385 Ga0075428_10000538515 181
547 3300006847 Ga0075431_100013023 Ga0075431_10001302310 181
548 3300006871 Ga0075434_100003406 Ga0075434_1000034064 181
549 3300006914 Ga0075436_100032424 Ga0075436_1000324243 181
550 3300007076 Ga0075435_100185144 Ga0075435_1001851442 181
551 3300007076 Ga0075435_100286487 Ga0075435_1002864873 181
552 3300009101 Ga0105247_10820402 Ga0105247_108204021 181
553 3300009147 Ga0114129_10032491 Ga0114129_100324915 181
554 3300009147 Ga0114129_10088996 Ga0114129_100889966 181
555 3300009174 Ga0105241_10787753 Ga0105241_107877532 181
556 3300009177 Ga0105248_11891517 Ga0105248_118915171 181
557 3300013308 Ga0157375_10070463 Ga0157375_100704634 181
558 3300014325 Ga0163163_10026921 Ga0163163_100269213 181
559 3300014968 Ga0157379_10149548 Ga0157379_101495481 181
560 3300025321 Ga0207656_10451414 Ga0207656_104514141 181
561 3300025910 Ga0207684_10026040 Ga0207684_100260402 181
562 3300025910 Ga0207684_10411301 Ga0207684_104113012 181
563 3300025915 Ga0207693_10062567 Ga0207693_100625674 181
564 3300025916 Ga0207663_10186168 Ga0207663_101861682 181
565 3300025922 Ga0207646_10026635 Ga0207646_100266354 181
566 3300025933 Ga0207706_10249272 Ga0207706_102492722 181
567 3300025938 Ga0207704_10489588 Ga0207704_104895881 181
568 3300025945 Ga0207679_10009543 Ga0207679_100095435 181
569 3300025945 Ga0207679_10280425 Ga0207679_102804252 181
570 3300026041 Ga0207639_10544067 Ga0207639_105440672 181
571 3300026067 Ga0207678_10130704 Ga0207678_101307043 181
572 3300026088 Ga0207641_10027227 Ga0207641_100272272 181
573 3300026089 Ga0207648_10333426 Ga0207648_103334261 181
574 3300026095 Ga0207676_10006300 Ga0207676_100063005 181
575 3300026142 Ga0207698_10498510 Ga0207698_104985102 181
576 3300031548 Ga0307408_100287984 Ga0307408_1002879842 181
577 3300031731 Ga0307405_10033580 Ga0307405_100335803 181
578 3300031824 Ga0307413_10017314 Ga0307413_100173143 181
579 3300031824 Ga0307413_10059813 Ga0307413_100598132 181
580 3300031824 Ga0307413_10060053 Ga0307413_100600533 181
581 3300031824 Ga0307413_10099250 Ga0307413_100992502 181
582 3300031852 Ga0307410_10057586 Ga0307410_100575862 181
583 3300031852 Ga0307410_10585503 Ga0307410_105855032 181
584 3300031903 Ga0307407_10603569 Ga0307407_106035691 181
585 3300031911 Ga0307412_10154589 Ga0307412_101545892 181
586 3300031995 Ga0307409_100160884 Ga0307409_1001608841 181
587 3300032002 Ga0307416_100086280 Ga0307416_1000862802 181
588 3300032002 Ga0307416_100625476 Ga0307416_1006254762 181
589 3300032004 Ga0307414_10101065 Ga0307414_101010653 181
590 3300032004 Ga0307414_10228280 Ga0307414_102282802 181
591 3300032005 Ga0307411_10345284 Ga0307411_103452842 181
592 3300032005 Ga0307411_10770474 Ga0307411_107704742 181
593 3300032126 Ga0307415_100118496 Ga0307415_1001184962 181
594 3300032126 Ga0307415_100125838 Ga0307415_1001258382 181
595 3300032126 Ga0307415_100286558 Ga0307415_1002865582 181
596 3300035691 Ga0373931_0753738 Ga0373931_0753738_76_630 181
597 3300041406 Ga0439439_0000401 Ga0439439_0000401_2334_2888 181
598 3300041410 Ga0439461_0062326 Ga0439461_0062326_174_728 181
599 3300041997 Ga0439431_0045682 Ga0439431_0045682_397_951 181
600 3300042123 Ga0450921_004167 Ga0450921_004167_103_657 181
601 3300042133 Ga0450896_020819 Ga0450896_020819_207_761 181
602 3300042156 Ga0439446_0002474 Ga0439446_0002474_1229_1783 181
603 3300042435 Ga0439434_0031575 Ga0439434_0031575_109_666 181
604 3300042876 Ga0451577_0029171 Ga0451577_0029171_2508_3065 181
605 3300044673 Ga0453683_0450334 Ga0453683_0450334_69_623 181
606 3300044712 Ga0453684_1588892 Ga0453684_1588892_63_617 181
607 3300046455 Ga0495603_0224921 Ga0495603_0224921_495_1049 181
608 3300046472 Ga0495580_0425106 Ga0495580_0425106_230_784 181
609 3300046499 Ga0495594_0537573 Ga0495594_0537573_78_632 181
610 3300046557 Ga0495622_0235078 Ga0495622_0235078_110_664 181
611 3300046674 Ga0495588_0183907 Ga0495588_0183907_450_1004 181
612 3300046691 Ga0495670_0310980 Ga0495670_0310980_59_613 181
613 3300048904 Ga0496101_0445426 Ga0496101_0445426_306_860 181
614 3300048908 Ga0496105_0740195 Ga0496105_0740195_90_644 181
615 3300048909 Ga0496106_0895049 Ga0496106_0895049_18_572 181
616 3300048911 Ga0496108_0371112 Ga0496108_0371112_17_571 181
617 3300048911 Ga0496108_1015538 Ga0496108_1015538_113_667 181
618 3300048912 Ga0496109_1255686 Ga0496109_1255686_88_642 181
619 3300048913 Ga0496110_0888518 Ga0496110_0888518_99_653 181
620 3300049570 Ga0501033_0406181 Ga0501033_0406181_273_827 181
621 3300049572 Ga0501036_0330619 Ga0501036_0330619_585_1139 181
622 3300049573 Ga0501037_0319468 Ga0501037_0319468_433_987 181
623 3300049574 Ga0501038_0105018 Ga0501038_0105018_106_660 181
624 3300049574 Ga0501038_0574207 Ga0501038_0574207_137_691 181
625 3300049576 Ga0501040_0025937 Ga0501040_0025937_562_1116 181
626 3300049576 Ga0501040_0583164 Ga0501040_0583164_200_754 181
627 3300049577 Ga0501041_0509884 Ga0501041_0509884_69_623 181
628 3300049580 Ga0501046_0017035 Ga0501046_0017035_3795_4349 181
629 3300049582 Ga0501048_0065316 Ga0501048_0065316_69_623 181
630 3300049583 Ga0501067_0071434 Ga0501067_0071434_1315_1869 181
631 3300049585 Ga0501069_0106809 Ga0501069_0106809_208_762 181
632 3300049586 Ga0501070_0102547 Ga0501070_0102547_934_1488 181
633 3300049587 Ga0501071_0008957 Ga0501071_0008957_6011_6565 181
634 3300049587 Ga0501071_0271055 Ga0501071_0271055_30_584 181
635 3300049588 Ga0501072_0026418 Ga0501072_0026418_621_1175 181
636 3300049588 Ga0501072_0048033 Ga0501072_0048033_104_658 181
637 3300049588 Ga0501072_0730500 Ga0501072_0730500_95_649 181
638 3300049589 Ga0501073_0191313 Ga0501073_0191313_717_1271 181
639 3300049590 Ga0501074_0046206 Ga0501074_0046206_96_650 181
640 3300049590 Ga0501074_0157615 Ga0501074_0157615_451_1005 181
641 3300049591 Ga0501075_0010146 Ga0501075_0010146_5947_6501 181
642 3300049591 Ga0501075_0029007 Ga0501075_0029007_1616_2170 181
643 3300049591 Ga0501075_0297449 Ga0501075_0297449_55_609 181
644 3300049592 Ga0501076_0007418 Ga0501076_0007418_5899_6453 181
645 3300049592 Ga0501076_0410356 Ga0501076_0410356_101_655 181
646 3300049593 Ga0501077_0000260 Ga0501077_0000260_9278_9832 181
647 3300049593 Ga0501077_0045986 Ga0501077_0045986_100_654 181
648 3300049652 Ga0501202_089866 Ga0501202_089866_112_666 181
649 3300049660 Ga0501216_034690 Ga0501216_034690_73_627 181
650 3300049661 Ga0501217_019707 Ga0501217_019707_990_1544 181
651 3300049668 Ga0501233_010892 Ga0501233_010892_937_1491 181
652 3300049683 Ga0501253_030460 Ga0501253_030460_114_668 181
653 3300049686 Ga0501257_072002 Ga0501257_072002_253_807 181
654 3300049704 Ga0501221_011185 Ga0501221_011185_591_1145 181
655 3300049707 Ga0501234_025380 Ga0501234_025380_382_936 181
656 3300049741 Ga0501079_0006682 Ga0501079_0006682_5061_5615 181
657 3300049741 Ga0501079_0023522 Ga0501079_0023522_4121_4675 181
658 3300049742 Ga0501080_0127719 Ga0501080_0127719_1754_2308 181
659 3300049742 Ga0501080_0728523 Ga0501080_0728523_90_644 181
660 3300049743 Ga0501081_0060736 Ga0501081_0060736_193_747 181
661 3300049743 Ga0501081_0276618 Ga0501081_0276618_114_668 181
662 3300049767 Ga0501270_008297 Ga0501270_008297_96_650 181
663 3300049767 Ga0501270_029083 Ga0501270_029083_11_565 181
664 3300049824 Ga0501045_0012832 Ga0501045_0012832_4955_5509 181
665 3300049851 Ga0501212_014727 Ga0501212_014727_58_612 181
666 3300050507 nmdc:mga05p37_11492_c1 nmdc:mga05p37_11492_c1_9471_10025 181
667 3300050507 nmdc:mga05p37_138024_c1 nmdc:mga05p37_138024_c1_2388_2942 181
668 3300050507 nmdc:mga05p37_165311_c1 nmdc:mga05p37_165311_c1_2114_2671 181
669 3300050508 nmdc:mga09592_364767_c1 nmdc:mga09592_364767_c1_498_1055 181
670 3300050508 nmdc:mga09592_771467_c1 nmdc:mga09592_771467_c1_141_734 181
671 3300050509 nmdc:mga0qj67_459318_c1 nmdc:mga0qj67_459318_c1_78_635 181
672 3300050510 nmdc:mga06r32_58229_c1 nmdc:mga06r32_58229_c1_2855_3412 181
673 3300050510 nmdc:mga06r32_70819_c1 nmdc:mga06r32_70819_c1_159_713 181
674 3300050512 nmdc:mga0n895_2011_c1 nmdc:mga0n895_2011_c1_5475_6029 181
675 3300050513 nmdc:mga0rr50_243400_c1 nmdc:mga0rr50_243400_c1_883_1437 181
676 3300050513 nmdc:mga0rr50_365627_c1 nmdc:mga0rr50_365627_c1_520_1074 181
677 3300050514 nmdc:mga08x19_10821_c1 nmdc:mga08x19_10821_c1_3234_3788 181
678 3300054114 Ga0501084_0018137 Ga0501084_0018137_4218_4772 181
679 3300054114 Ga0501084_0032795 Ga0501084_0032795_101_655 181
680 3300059421 Ga0590071_014604 Ga0590071_014604_226_780 181
681 3300059423 Ga0590074_036714 Ga0590074_036714_291_845 181
682 3300059424 Ga0590075_004856 Ga0590075_004856_2071_2625 181
683 3300059424 Ga0590075_016974 Ga0590075_016974_698_1252 181
684 3300060353 Ga0501082_0023164 Ga0501082_0023164_630_1184 181
685 3300060353 Ga0501082_0048394 Ga0501082_0048394_1832_2386 181
686 3300061734 Ga0530510_0085130 Ga0530510_0085130_1283_1837 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

33

101

0.98

PF04545

Sigma70_r4

Sigma-70, region 4

128

177

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

122

175

0.95

PF07638

Sigma70_ECF

ECF sigma factor

13

185

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9728 121 171
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.9716 121 171
4lup-assembly2.cif.gz_C crystal structure of the complex formed by region of e. coli sigmae bound to its -10 element non template strand 0.9502 13 100
6eo2-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed 0.9402 128 171
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9389 121 177
ID Description Score Start End Superfamily
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9728 121 171 1.10.10.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9716 121 171 1.10.10.10
2o8xC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9688 121 171 1.10.10.10
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9628 121 176 1.10.10.10
4nqwA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9581 121 175 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9BAP8-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.724 9 136 GO:0006352
GO:0016987
AF-A0A7K1C7F9-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.6844 14 155 GO:0003677
GO:0006352
GO:0016987
AF-A0A7C1PVA3-F1-model_v4 deleted 0.6818 1 150
AF-A0A7C1PVA3-F1-model_v4 deleted 0.6606 1 150
AF-A0A1H2C9P8-F1-model_v4 deleted 0.6563 1 178

Feature Viewer

pLDDT pTM Quality
83.41 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map