F475161

General Info

Members Datasets Scaffolds Average Seq Length
685 388 673 75

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_1811764|Ga0501082_1811764_16_282
Length 88
Sequence VAKPTRVTNRIGELRAAIGLTQADLGDRIGVTRQTVNAIEGGKYSPSLDVAFRIAGVLGTSLEVVFQYDEVGRRARRSSAPDGEPAGS

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
4 2643221695 Lysobacter sp. Root494 Isolate Unclassified
5 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
6 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
7 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
8 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
9 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
10 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
11 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
12 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
13 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
202 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
203 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
204 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
205 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
215 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
216 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
217 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
218 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
260 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
261 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
265 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
266 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
267 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
268 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
269 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
270 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
271 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
272 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
273 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
274 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
275 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
276 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
277 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
278 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
279 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
280 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
281 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
282 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
283 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
290 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
340 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
341 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
342 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
346 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
347 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
367 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
368 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
369 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
370 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
371 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
372 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
373 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
374 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
375 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
376 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
381 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
382 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
383 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
384 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
385 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
386 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.44
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.6
Nodule 0
Rhizoplane 5.55
Rhizosphere 72.41
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000487 3300002737 Bacteria 30308
2 JGI25162J39368_1001151 3300002737 Bacteria 15806
3 JGI25162J39368_1008339 3300002737 Bacteria 1497
4 JGI25164J39214_1000193 3300002772 Bacteria 52696
5 JGI25164J39214_1000242 3300002772 Bacteria 41726
6 JGI25164J39214_1001125 3300002772 Bacteria 7616
7 JGI25406J46586_10008343 3300003203 Bacteria 4698
8 JGI25165J46597_1000269 3300003214 Bacteria 67008
9 JGI25165J46597_1000335 3300003214 Bacteria 55465
10 JGI25165J46597_1002787 3300003214 Bacteria 5070
11 JGI25160J50197_1058139 3300003354 Bacteria 784
12 Ga0055529_1005418 3300003763 Bacteria 1849
13 Ga0055526_1000961 3300003771 Bacteria 21281
14 Ga0055526_1067220 3300003771 Bacteria 740
15 Ga0055536_1000881 3300003781 Bacteria 19520
16 Ga0055534_1012732 3300003784 Bacteria 1649
17 Ga0055530_10000083 3300003791 Bacteria 81772
18 Ga0055530_10033459 3300003791 Bacteria 1325
19 Ga0055530_10036936 3300003791 Bacteria 1226
20 Ga0055531_10000316 3300003794 Bacteria 47444
21 Ga0055531_10000471 3300003794 Bacteria 37281
22 Ga0065707_10970854 3300005295 Bacteria 547
23 Ga0070658_10325314 3300005327 Bacteria 1313
24 Ga0070658_10639602 3300005327 Bacteria 923
25 Ga0070676_10647695 3300005328 Bacteria 766
26 Ga0070683_100510778 3300005329 Bacteria 1148
27 Ga0068869_100346121 3300005334 Bacteria 1211
28 Ga0068869_101009531 3300005334 Bacteria 725
29 Ga0068869_101591834 3300005334 Bacteria 582
30 Ga0070680_100300281 3300005336 Bacteria 1362
31 Ga0070682_100014692 3300005337 Bacteria 4527
32 Ga0070682_100198731 3300005337 Bacteria 1413
33 Ga0070682_100401525 3300005337 Bacteria 1037
34 Ga0070682_100922759 3300005337 Bacteria 719
35 Ga0070682_101217754 3300005337 Bacteria 636
36 Ga0070660_100313967 3300005339 Bacteria 1286
37 Ga0070687_100462486 3300005343 Bacteria 846
38 Ga0070668_100001537 3300005347 Bacteria 16641
39 Ga0070668_100308425 3300005347 Bacteria 1329
40 Ga0070675_101128337 3300005354 Bacteria 721
41 Ga0070675_102085755 3300005354 Bacteria 523
42 Ga0070671_100294218 3300005355 Bacteria 1382
43 Ga0070674_100215252 3300005356 Bacteria 1492
44 Ga0070659_100272920 3300005366 Bacteria 1405
45 Ga0070667_100746727 3300005367 Bacteria 907
46 Ga0070709_10479550 3300005434 Bacteria 941
47 Ga0070714_100131487 3300005435 Bacteria 2237
48 Ga0070714_100251451 3300005435 Bacteria 1634
49 Ga0070714_100262180 3300005435 Bacteria 1601
50 Ga0070714_100315078 3300005435 Bacteria 1462
51 Ga0070714_100667222 3300005435 Bacteria 1002
52 Ga0070714_102058694 3300005435 Bacteria 556
53 Ga0070713_100052825 3300005436 Bacteria 3365
54 Ga0070713_100783548 3300005436 Bacteria 913
55 Ga0070713_100936841 3300005436 Bacteria 834
56 Ga0070713_102038550 3300005436 Bacteria 556
57 Ga0070710_10219626 3300005437 Bacteria 1209
58 Ga0070711_100241133 3300005439 Bacteria 1413
59 Ga0070711_100390132 3300005439 Bacteria 1128
60 Ga0070711_101433367 3300005439 Bacteria 601
61 Ga0070694_100358186 3300005444 Bacteria 1132
62 Ga0070663_100979742 3300005455 Bacteria 734
63 Ga0070663_101953464 3300005455 Bacteria 527
64 Ga0070678_100143013 3300005456 Bacteria 1917
65 Ga0070678_100613431 3300005456 Bacteria 972
66 Ga0070678_101354907 3300005456 Bacteria 663
67 Ga0070681_10659586 3300005458 Bacteria 961
68 Ga0070681_10678629 3300005458 Bacteria 946
69 Ga0068867_101404169 3300005459 Bacteria 647
70 Ga0070685_11208280 3300005466 Bacteria 575
71 Ga0070706_100048867 3300005467 Bacteria 3904
72 Ga0070707_100044377 3300005468 Bacteria 4256
73 Ga0070698_100010358 3300005471 Bacteria 9955
74 Ga0070679_100115113 3300005530 Bacteria 2674
75 Ga0070684_101773228 3300005535 Unclassified 582
76 Ga0070697_100615900 3300005536 Bacteria 955
77 Ga0068853_100049917 3300005539 Bacteria 3598
78 Ga0068853_100273709 3300005539 Bacteria 1555
79 Ga0068853_100332802 3300005539 Bacteria 1409
80 Ga0068853_100438875 3300005539 Bacteria 1226
81 Ga0068853_100893245 3300005539 Bacteria 853
82 Ga0070672_100457746 3300005543 Bacteria 1099
83 Ga0070672_100739513 3300005543 Bacteria 863
84 Ga0070696_100151789 3300005546 Bacteria 1701
85 Ga0070693_100044703 3300005547 Bacteria 2506
86 Ga0070665_100000078 3300005548 Bacteria 188101
87 Ga0070704_100821138 3300005549 Bacteria 832
88 Ga0068855_100032327 3300005563 Bacteria 6248
89 Ga0068855_100526038 3300005563 Bacteria 1282
90 Ga0068857_100222158 3300005577 Bacteria 1726
91 Ga0068854_100149362 3300005578 Bacteria 1800
92 Ga0068854_100543281 3300005578 Bacteria 984
93 Ga0068854_100942091 3300005578 Bacteria 761
94 Ga0068854_101294313 3300005578 Bacteria 656
95 Ga0068854_101309118 3300005578 Bacteria 652
96 Ga0068856_100329500 3300005614 Bacteria 1544
97 Ga0068852_100167782 3300005616 Bacteria 2055
98 Ga0068852_102798712 3300005616 Bacteria 506
99 Ga0068859_101407770 3300005617 Bacteria 769
100 Ga0068859_101535234 3300005617 Bacteria 735
101 Ga0068864_101523652 3300005618 Bacteria 672
102 Ga0068861_102700909 3300005719 Bacteria 501
103 Ga0068851_10156768 3300005834 Bacteria 1248
104 Ga0068851_10872225 3300005834 Bacteria 562
105 Ga0068860_100264234 3300005843 Bacteria 1678
106 Ga0068862_100079586 3300005844 Bacteria 2841
107 Ga0081455_10690286 3300005937 Bacteria 652
108 Ga0081538_10010782 3300005981 Bacteria 7468
109 Ga0081538_10014870 3300005981 Bacteria 6064
110 Ga0081540_1333233 3300005983 Bacteria 520
111 Ga0081539_10000031 3300005985 Bacteria 313232
112 Ga0081539_10005625 3300005985 Bacteria 12608
113 Ga0070717_10058801 3300006028 Bacteria 3179
114 Ga0070717_10373130 3300006028 Bacteria 1278
115 Ga0070717_10629681 3300006028 Bacteria 973
116 Ga0070717_10647106 3300006028 Bacteria 959
117 Ga0070717_11174617 3300006028 Bacteria 698
118 Ga0075365_10087464 3300006038 Bacteria 2119
119 Ga0075363_100212596 3300006048 Bacteria 1107
120 Ga0075364_10000319 3300006051 Bacteria 23673
121 Ga0070715_10342781 3300006163 Bacteria 813
122 Ga0070716_100005185 3300006173 Bacteria 6300
123 Ga0070712_100014705 3300006175 Bacteria 5025
124 Ga0070712_100213341 3300006175 Bacteria 1524
125 Ga0070712_101482202 3300006175 Bacteria 593
126 Ga0075367_10352424 3300006178 Bacteria 929
127 Ga0097621_100136148 3300006237 Bacteria 2095
128 Ga0097621_101819940 3300006237 Bacteria 581
129 Ga0075370_10512175 3300006353 Bacteria 725
130 Ga0075370_11025219 3300006353 Bacteria 506
131 Ga0068871_101376272 3300006358 Bacteria 665
132 Ga0068871_101418701 3300006358 Bacteria 655
133 Ga0075428_100060805 3300006844 Bacteria 4137
134 Ga0075428_100296028 3300006844 Bacteria 1740
135 Ga0075428_101146007 3300006844 Bacteria 820
136 Ga0075430_100281133 3300006846 Bacteria 1377
137 Ga0075430_100281285 3300006846 Bacteria 1376
138 Ga0075430_100586297 3300006846 Bacteria 920
139 Ga0075431_100104479 3300006847 Bacteria 2923
140 Ga0075429_101623208 3300006880 Bacteria 562
141 Ga0097620_101407217 3300006931 Bacteria 769
142 Ga0097620_101535158 3300006931 Bacteria 735
143 Ga0075435_100203864 3300007076 Bacteria 1676
144 Ga0105240_10009760 3300009093 Bacteria 13555
145 Ga0105240_12744205 3300009093 Bacteria 507
146 Ga0111539_12062175 3300009094 Bacteria 662
147 Ga0105245_10825292 3300009098 Bacteria 966
148 Ga0105245_11145009 3300009098 Bacteria 825
149 Ga0105245_12622452 3300009098 Bacteria 557
150 Ga0105247_10901630 3300009101 Bacteria 683
151 Ga0114129_11287969 3300009147 Bacteria 906
152 Ga0105243_10087416 3300009148 Bacteria 2558
153 Ga0105243_12374845 3300009148 Bacteria 568
154 Ga0105243_13051614 3300009148 Bacteria 507
155 Ga0105241_10306021 3300009174 Bacteria 1365
156 Ga0105241_10331389 3300009174 Bacteria 1316
157 Ga0105241_10609471 3300009174 Bacteria 987
158 Ga0105242_11368600 3300009176 Bacteria 734
159 Ga0105248_13109645 3300009177 Bacteria 528
160 Ga0105237_10000105 3300009545 Bacteria 118218
161 Ga0105237_11035751 3300009545 Bacteria 827
162 Ga0105237_12230094 3300009545 Bacteria 557
163 Ga0105238_10228496 3300009551 Bacteria 1838
164 Ga0105238_10406366 3300009551 Bacteria 1355
165 Ga0105238_11746619 3300009551 Bacteria 654
166 Ga0105249_11315807 3300009553 Bacteria 794
167 Ga0105239_11030265 3300010375 Bacteria 947
168 Ga0105246_10335082 3300011119 Bacteria 1234
169 Ga0157373_11268285 3300013100 Bacteria 557
170 Ga0157371_10228588 3300013102 Bacteria 1337
171 Ga0157369_10839774 3300013105 Bacteria 943
172 Ga0157369_11550829 3300013105 Bacteria 674
173 Ga0157369_12193137 3300013105 Bacteria 560
174 Ga0157374_11836986 3300013296 Bacteria 631
175 Ga0157374_12744168 3300013296 Bacteria 520
176 Ga0157374_12981672 3300013296 Bacteria 500
177 Ga0157378_10451454 3300013297 Bacteria 1276
178 Ga0163162_13391211 3300013306 Bacteria 509
179 Ga0157372_10136012 3300013307 Bacteria 2830
180 Ga0157372_10477147 3300013307 Bacteria 1454
181 Ga0157372_10587320 3300013307 Bacteria 1298
182 Ga0157372_11079996 3300013307 Bacteria 929
183 Ga0157375_10367893 3300013308 Bacteria 1604
184 Ga0157375_10646286 3300013308 Bacteria 1214
185 Ga0157375_11298440 3300013308 Bacteria 855
186 Ga0163163_10537637 3300014325 Bacteria 1231
187 Ga0163163_10787261 3300014325 Bacteria 1014
188 Ga0163163_10822956 3300014325 Bacteria 992
189 Ga0163163_12223590 3300014325 Bacteria 608
190 Ga0157377_10919125 3300014745 Bacteria 656
191 Ga0182007_10003704 3300015262 Bacteria 7145
192 Ga0163161_12118946 3300017792 Bacteria 500
193 Ga0206356_11054920 3300020070 Bacteria 3228
194 Ga0206354_11349434 3300020081 Bacteria 1348
195 Ga0206353_11672713 3300020082 Bacteria 1532
196 Ga0213876_10002639 3300021384 Bacteria 10477
197 Ga0213875_10156232 3300021388 Bacteria 1070
198 Ga0213871_10318033 3300021441 Bacteria 505
199 Ga0207427_100054 3300025231 Bacteria 216315
200 Ga0207427_100117 3300025231 Bacteria 102251
201 Ga0207427_100178 3300025231 Bacteria 67956
202 Ga0209437_100240 3300025233 Bacteria 89740
203 Ga0209437_100304 3300025233 Bacteria 67955
204 Ga0209437_100642 3300025233 Bacteria 20416
205 Ga0207425_1000041 3300025245 Bacteria 210441
206 Ga0207425_1057180 3300025245 Bacteria 696
207 Ga0209646_1002600 3300025246 Bacteria 3895
208 Ga0209026_1000111 3300025250 Bacteria 140599
209 Ga0209129_1000977 3300025258 Bacteria 17189
210 Ga0209233_1000001 3300025261 Bacteria 2992747
211 Ga0209233_1000083 3300025261 Bacteria 336016
212 Ga0209233_1000287 3300025261 Bacteria 67956
213 Ga0209565_1001163 3300025263 Bacteria 12632
214 Ga0209565_1052632 3300025263 Bacteria 726
215 Ga0209455_1000211 3300025272 Bacteria 82660
216 Ga0209673_1026813 3300025273 Bacteria 1885
217 Ga0209675_1000190 3300025291 Bacteria 67514
218 Ga0209676_1000133 3300025292 Bacteria 184430
219 Ga0209676_1006028 3300025292 Bacteria 6115
220 Ga0209676_1012522 3300025292 Bacteria 3325
221 Ga0209676_1019508 3300025292 Bacteria 2332
222 Ga0209025_1000068 3300025294 Bacteria 294129
223 Ga0209025_1010719 3300025294 Bacteria 6165
224 Ga0209025_1148152 3300025294 Bacteria 652
225 Ga0209564_1000622 3300025295 Bacteria 53970
226 Ga0209758_1000004 3300025297 Bacteria 1375322
227 Ga0209758_1049652 3300025297 Bacteria 1479
228 Ga0209050_1000001 3300025298 Bacteria 3563507
229 Ga0209050_1000067 3300025298 Bacteria 304206
230 Ga0209050_1001738 3300025298 Bacteria 21673
231 Ga0209050_1010590 3300025298 Bacteria 4516
232 Ga0209050_1012591 3300025298 Bacteria 3859
233 Ga0207426_1036225 3300025302 Bacteria 1570
234 Ga0209051_1000191 3300025303 Bacteria 108763
235 Ga0209257_1000132 3300025304 Bacteria 210870
236 Ga0209257_1001893 3300025304 Bacteria 22618
237 Ga0209257_1001973 3300025304 Bacteria 22086
238 Ga0209257_1002895 3300025304 Bacteria 15900
239 Ga0207697_10559018 3300025315 Bacteria 503
240 Ga0207692_10083028 3300025898 Bacteria 1718
241 Ga0207692_10193017 3300025898 Bacteria 1193
242 Ga0207692_10441061 3300025898 Bacteria 818
243 Ga0207647_10411857 3300025904 Bacteria 761
244 Ga0207685_10018699 3300025905 Bacteria 2268
245 Ga0207699_10024767 3300025906 Bacteria 3285
246 Ga0207699_10111832 3300025906 Bacteria 1752
247 Ga0207645_10116341 3300025907 Bacteria 1733
248 Ga0207705_10367377 3300025909 Bacteria 1110
249 Ga0207705_11066321 3300025909 Bacteria 623
250 Ga0207654_11230431 3300025911 Bacteria 546
251 Ga0207707_10459635 3300025912 Bacteria 1089
252 Ga0207707_10751055 3300025912 Bacteria 816
253 Ga0207707_11302133 3300025912 Bacteria 584
254 Ga0207695_10001623 3300025913 Bacteria 36467
255 Ga0207671_10004557 3300025914 Bacteria 13165
256 Ga0207693_10074932 3300025915 Bacteria 2650
257 Ga0207663_10002596 3300025916 Bacteria 8691
258 Ga0207663_10141095 3300025916 Bacteria 1679
259 Ga0207663_10178568 3300025916 Bacteria 1514
260 Ga0207660_10283964 3300025917 Bacteria 1314
261 Ga0207662_11254655 3300025918 Bacteria 527
262 Ga0207657_10035367 3300025919 Bacteria 4480
263 Ga0207657_10164681 3300025919 Bacteria 1799
264 Ga0207649_10881004 3300025920 Bacteria 701
265 Ga0207649_11401016 3300025920 Bacteria 553
266 Ga0207652_10030206 3300025921 Bacteria 4536
267 Ga0207646_10070154 3300025922 Bacteria 3130
268 Ga0207694_10692513 3300025924 Bacteria 859
269 Ga0207694_11238840 3300025924 Bacteria 631
270 Ga0207694_11578562 3300025924 Bacteria 553
271 Ga0207650_10781690 3300025925 Bacteria 809
272 Ga0207687_10775048 3300025927 Bacteria 817
273 Ga0207700_10118124 3300025928 Bacteria 2145
274 Ga0207700_10251023 3300025928 Bacteria 1511
275 Ga0207700_10425100 3300025928 Bacteria 1168
276 Ga0207664_10050661 3300025929 Bacteria 3275
277 Ga0207664_10057619 3300025929 Bacteria 3088
278 Ga0207664_10072930 3300025929 Bacteria 2769
279 Ga0207664_11269803 3300025929 Bacteria 655
280 Ga0207664_12020098 3300025929 Bacteria 500
281 Ga0207644_10265936 3300025931 Bacteria 1373
282 Ga0207644_10617090 3300025931 Bacteria 901
283 Ga0207690_10741930 3300025932 Bacteria 809
284 Ga0207709_10700985 3300025935 Bacteria 810
285 Ga0207669_10074994 3300025937 Bacteria 2142
286 Ga0207669_10264549 3300025937 Bacteria 1288
287 Ga0207669_10871387 3300025937 Bacteria 751
288 Ga0207704_10362856 3300025938 Bacteria 1131
289 Ga0207665_10005367 3300025939 Bacteria 8557
290 Ga0207665_11587826 3300025939 Bacteria 519
291 Ga0207691_10079523 3300025940 Bacteria 2951
292 Ga0207711_11572865 3300025941 Bacteria 601
293 Ga0207661_11125549 3300025944 Bacteria 723
294 Ga0207661_11728885 3300025944 Bacteria 571
295 Ga0207679_10465506 3300025945 Bacteria 1123
296 Ga0207667_10297189 3300025949 Bacteria 1650
297 Ga0207667_11731711 3300025949 Bacteria 591
298 Ga0207668_10002726 3300025972 Bacteria 10331
299 Ga0207668_10122041 3300025972 Bacteria 1975
300 Ga0207668_10553277 3300025972 Bacteria 997
301 Ga0207640_10199242 3300025981 Bacteria 1516
302 Ga0207640_10257802 3300025981 Bacteria 1357
303 Ga0207677_10526855 3300026023 Bacteria 1026
304 Ga0207639_10194018 3300026041 Bacteria 1737
305 Ga0207639_10239950 3300026041 Bacteria 1575
306 Ga0207639_10319783 3300026041 Bacteria 1377
307 Ga0207639_10374248 3300026041 Bacteria 1277
308 Ga0207678_10115363 3300026067 Bacteria 2291
309 Ga0207678_10351367 3300026067 Bacteria 1271
310 Ga0207678_11930447 3300026067 Bacteria 515
311 Ga0207708_10873619 3300026075 Unclassified 777
312 Ga0207702_10461881 3300026078 Bacteria 1233
313 Ga0207702_10992056 3300026078 Bacteria 833
314 Ga0207648_10152652 3300026089 Bacteria 2038
315 Ga0207676_11784730 3300026095 Bacteria 614
316 Ga0207676_12320614 3300026095 Bacteria 534
317 Ga0207674_10237339 3300026116 Bacteria 1770
318 Ga0207674_11290391 3300026116 Bacteria 700
319 Ga0207675_100859877 3300026118 Bacteria 922
320 Ga0207683_10078463 3300026121 Bacteria 2926
321 Ga0207683_10082829 3300026121 Bacteria 2851
322 Ga0207683_11210987 3300026121 Bacteria 700
323 Ga0207683_11591408 3300026121 Bacteria 603
324 Ga0207698_10093412 3300026142 Bacteria 2470
325 Ga0207698_10234988 3300026142 Bacteria 1666
326 Ga0207698_11226901 3300026142 Bacteria 764
327 Ga0207698_11503320 3300026142 Bacteria 689
328 Ga0209974_10458078 3300027876 Bacteria 507
329 Ga0268266_10000131 3300028379 Bacteria 146628
330 Ga0268266_10191605 3300028379 Bacteria 1867
331 Ga0268266_10582547 3300028379 Bacteria 1074
332 Ga0268265_10128320 3300028380 Bacteria 2103
333 Ga0268264_10011270 3300028381 Bacteria 7387
334 Ga0268264_10529249 3300028381 Bacteria 1153
335 Ga0268264_12544760 3300028381 Bacteria 517
336 Ga0265337_1010536 3300028556 Bacteria 3235
337 Ga0265337_1012858 3300028556 Bacteria 2829
338 Ga0265334_10066814 3300028573 Bacteria 1345
339 Ga0307517_10100813 3300028786 Bacteria 2278
340 Ga0307515_10131481 3300028794 Bacteria 2753
341 Ga0307515_10266044 3300028794 Bacteria 1443
342 Ga0307515_10267568 3300028794 Bacteria 1435
343 Ga0307515_10471046 3300028794 Bacteria 869
344 Ga0307515_10703115 3300028794 Unclassified 627
345 Ga0307515_10739082 3300028794 Bacteria 602
346 Ga0265338_10014544 3300028800 Bacteria 8744
347 Ga0265338_10428339 3300028800 Unclassified 939
348 Ga0307512_10065896 3300030522 Bacteria 2740
349 Ga0316177_1074352 3300030731 Bacteria 11019
350 Ga0314311_1196854 3300030733 Bacteria 1018
351 Ga0316179_1070522 3300030734 Bacteria 666
352 Ga0316180_1192092 3300030736 Bacteria 858
353 Ga0265332_10038706 3300031238 Bacteria 2066
354 Ga0265320_10066844 3300031240 Bacteria 1703
355 Ga0265340_10046521 3300031247 Bacteria 2116
356 Ga0265331_10085819 3300031250 Bacteria 1458
357 Ga0307513_10039349 3300031456 Bacteria 5242
358 Ga0307513_10052583 3300031456 Bacteria 4385
359 Ga0307513_10057618 3300031456 Bacteria 4137
360 Ga0307513_10137835 3300031456 Bacteria 2372
361 Ga0307513_10404867 3300031456 Bacteria 1098
362 Ga0307508_10000982 3300031616 Bacteria 33131
363 Ga0307508_10006260 3300031616 Bacteria 11216
364 Ga0307508_10156710 3300031616 Bacteria 1881
365 Ga0307514_10058419 3300031649 Bacteria 2950
366 Ga0307514_10455589 3300031649 Bacteria 627
367 Ga0265314_10633917 3300031711 Bacteria 547
368 Ga0265342_10396499 3300031712 Bacteria 713
369 Ga0316576_10568221 3300031727 Bacteria 830
370 Ga0307405_10004380 3300031731 Bacteria 6666
371 Ga0307405_10730310 3300031731 Bacteria 823
372 Ga0307405_11200961 3300031731 Bacteria 656
373 Ga0307405_11427876 3300031731 Bacteria 606
374 Ga0307405_11726390 3300031731 Bacteria 555
375 Ga0307413_10321075 3300031824 Bacteria 1183
376 Ga0307413_10632019 3300031824 Bacteria 880
377 Ga0307413_11598422 3300031824 Bacteria 579
378 Ga0307518_10000363 3300031838 Bacteria 34524
379 Ga0307410_10276253 3300031852 Bacteria 1316
380 Ga0307406_10064232 3300031901 Bacteria 2381
381 Ga0307406_10357785 3300031901 Bacteria 1143
382 Ga0307406_10504645 3300031901 Bacteria 981
383 Ga0307406_10753036 3300031901 Bacteria 818
384 Ga0307406_11105207 3300031901 Bacteria 685
385 Ga0307406_11519107 3300031901 Bacteria 590
386 Ga0307406_11609747 3300031901 Bacteria 574
387 Ga0307407_10030591 3300031903 Bacteria 2906
388 Ga0307412_10340526 3300031911 Bacteria 1200
389 Ga0307409_100001766 3300031995 Bacteria 10925
390 Ga0307409_100169353 3300031995 Bacteria 1921
391 Ga0307409_100405283 3300031995 Bacteria 1304
392 Ga0307409_100460800 3300031995 Bacteria 1229
393 Ga0307409_100760076 3300031995 Bacteria 974
394 Ga0307416_100001803 3300032002 Bacteria 11893
395 Ga0307416_100093115 3300032002 Bacteria 2595
396 Ga0307416_100326028 3300032002 Bacteria 1541
397 Ga0307416_101698001 3300032002 Bacteria 736
398 Ga0307416_103348917 3300032002 Bacteria 536
399 Ga0307416_103893144 3300032002 Bacteria 500
400 Ga0307414_10739222 3300032004 Bacteria 893
401 Ga0307411_10095633 3300032005 Bacteria 2086
402 Ga0307411_10399589 3300032005 Bacteria 1136
403 Ga0307415_100000474 3300032126 Bacteria 17337
404 Ga0307415_100021712 3300032126 Bacteria 3952
405 Ga0307415_100045389 3300032126 Bacteria 2946
406 Ga0307415_100051999 3300032126 Bacteria 2784
407 Ga0307415_100388983 3300032126 Bacteria 1187
408 Ga0307415_100921916 3300032126 Bacteria 807
409 Ga0307415_101559439 3300032126 Bacteria 633
410 Ga0307415_102122116 3300032126 Bacteria 549
411 Ga0307507_10167399 3300033179 Bacteria 1607
412 Ga0307507_10180177 3300033179 Bacteria 1512
413 Ga0307507_10543021 3300033179 Bacteria 615
414 Ga0307510_10049951 3300033180 Bacteria 4443
415 Ga0373930_0108231 3300034816 Bacteria 667
416 Ga0373948_0028553 3300034817 Bacteria 1111
417 Ga0373950_0114526 3300034818 Bacteria 592
418 Ga0373938_0018605 3300034957 Bacteria 1380
419 Ga0373934_0475000 3300035086 Bacteria 525
420 Ga0373940_0025238 3300035088 Bacteria 1547
421 Ga0373944_0000077 3300035089 Bacteria 16846
422 Ga0373949_0098244 3300035090 Bacteria 799
423 Ga0373951_0043290 3300035091 Bacteria 1091
424 Ga0373952_0031345 3300035092 Bacteria 1182
425 Ga0373923_0089766 3300035111 Bacteria 1343
426 Ga0373932_0021233 3300035112 Bacteria 1713
427 Ga0373936_0216263 3300035113 Bacteria 849
428 Ga0373939_0093425 3300035114 Bacteria 1020
429 Ga0373941_0031995 3300035115 Bacteria 1572
430 Ga0373945_0392158 3300035116 Bacteria 607
431 Ga0373953_0032702 3300035117 Bacteria 2031
432 Ga0373942_0056356 3300035207 Bacteria 1115
433 Ga0373942_0079692 3300035207 Bacteria 970
434 Ga0373962_0050915 3300035242 Bacteria 1194
435 Ga0373931_0174036 3300035691 Bacteria 1270
436 Ga0373935_0986847 3300035692 Bacteria 625
437 Ga0373927_0122036 3300035695 Bacteria 1701
438 Ga0373933_0181516 3300035724 Bacteria 1342
439 Ga0373947_0549319 3300035725 Bacteria 786
440 Ga0373937_0277933 3300036401 Bacteria 1581
441 Ga0316584_0174426 3300036712 Bacteria 1593
442 Ga0373925_0224946 3300037068 Bacteria 1499
443 Ga0373925_1245752 3300037068 Bacteria 611
444 Ga0316581_0244265 3300037588 Bacteria 552
445 Ga0436364_0426719 3300037853 Bacteria 1152
446 Ga0237819_02012 3300038705 Bacteria 4528
447 Ga0400483_283032 3300039062 Bacteria 1437
448 Ga0237816_00962 3300039145 Bacteria 2361
449 Ga0436365_0260153 3300039437 Bacteria 649
450 Ga0436365_0354361 3300039437 Bacteria 622
451 Ga0436360_0757575 3300039438 Bacteria 814
452 Ga0436363_0345479 3300039450 Bacteria 782
453 Ga0436363_0434749 3300039450 Bacteria 965
454 Ga0436363_1235171 3300039450 Bacteria 758
455 Ga0436363_1291634 3300039450 Bacteria 1022
456 Ga0451791_0637026 3300041451 Bacteria 1754
457 Ga0451791_0649049 3300041451 Bacteria 514
458 Ga0451797_0512445 3300041453 Bacteria 602
459 Ga0451797_1286614 3300041453 Bacteria 569
460 Ga0451800_1361167 3300041459 Bacteria 1070
461 Ga0451802_0698271 3300041460 Bacteria 522
462 Ga0451802_0829211 3300041460 Bacteria 546
463 Ga0451804_0106901 3300041463 Bacteria 501
464 Ga0451807_2049489 3300041486 Bacteria 508
465 Ga0451807_2061218 3300041486 Bacteria 647
466 Ga0451807_2603260 3300041486 Bacteria 655
467 Ga0451807_2628185 3300041486 Bacteria 588
468 Ga0451837_0362053 3300041494 Bacteria 572
469 Ga0451837_0588667 3300041494 Bacteria 859
470 Ga0451841_1105605 3300041498 Bacteria 623
471 Ga0451845_0281309 3300041501 Bacteria 551
472 Ga0451853_2934718 3300041512 Bacteria 555
473 Ga0451853_3952303 3300041512 Bacteria 853
474 Ga0439443_034108 3300042003 Bacteria 849
475 Ga0439443_112236 3300042003 Bacteria 530
476 Ga0439448_0088988 3300042005 Bacteria 1042
477 Ga0439455_0128108 3300042012 Bacteria 714
478 Ga0439463_003783 3300042016 Bacteria 3814
479 Ga0450905_014976 3300042142 Bacteria 1109
480 Ga0439444_0007107 3300042437 Bacteria 1711
481 Ga0439460_0106062 3300042461 Bacteria 907
482 Ga0451577_0360951 3300042876 Bacteria 1318
483 Ga0451577_0533489 3300042876 Bacteria 1066
484 Ga0439440_0003715 3300042993 Bacteria 2964
485 Ga0439440_0004083 3300042993 Bacteria 2854
486 Ga0466972_0006222 3300044658 Bacteria 5998
487 Ga0466972_0034255 3300044658 Bacteria 2489
488 Ga0453683_0000060 3300044673 Bacteria 185920
489 Ga0466965_0004824 3300044683 Bacteria 6018
490 Ga0466965_0024589 3300044683 Bacteria 2914
491 Ga0466965_0080173 3300044683 Bacteria 1649
492 Ga0466964_0267678 3300044706 Bacteria 849
493 Ga0453684_0010987 3300044712 Bacteria 15303
494 Ga0453684_1498242 3300044712 Bacteria 696
495 Ga0453684_1795378 3300044712 Bacteria 624
496 Ga0466968_0348785 3300044735 Bacteria 719
497 Ga0466960_0002929 3300044901 Bacteria 6497
498 Ga0451576_0000001 3300045051 Bacteria 1802108
499 Ga0451576_1051167 3300045051 Bacteria 853
500 Ga0466958_0461230 3300045836 Bacteria 823
501 Ga0466958_0665711 3300045836 Bacteria 678
502 Ga0466967_0626685 3300045976 Bacteria 1062
503 Ga0495590_0000142 3300046457 Bacteria 43345
504 Ga0495590_0354702 3300046457 Bacteria 558
505 Ga0495638_0161366 3300046460 Bacteria 1293
506 Ga0495594_0030734 3300046499 Bacteria 2909
507 Ga0495630_0480809 3300046517 Bacteria 952
508 Ga0495632_0073382 3300046519 Bacteria 1641
509 Ga0495663_0016453 3300046525 Bacteria 2090
510 Ga0495652_0056439 3300046529 Bacteria 3335
511 Ga0495654_0024158 3300046530 Bacteria 3142
512 Ga0495667_0515082 3300046559 Bacteria 749
513 Ga0495668_0000076 3300046616 Bacteria 161826
514 Ga0495668_0519439 3300046616 Bacteria 657
515 Ga0495625_0000520 3300046660 Bacteria 56778
516 Ga0495625_0260011 3300046660 Bacteria 1123
517 Ga0495613_0007953 3300046689 Bacteria 7890
518 Ga0495604_0432622 3300047317 Bacteria 862
519 Ga0495674_0307055 3300047319 Bacteria 1295
520 Ga0495674_1162484 3300047319 Bacteria 585
521 Ga0495681_0273816 3300047470 Bacteria 660
522 Ga0495593_0201859 3300047673 Bacteria 999
523 Ga0496100_0334565 3300048903 Bacteria 1140
524 Ga0496101_0181641 3300048904 Bacteria 1620
525 Ga0496102_0325295 3300048905 Bacteria 1448
526 Ga0496103_0433247 3300048906 Bacteria 844
527 Ga0496104_0824352 3300048907 Bacteria 833
528 Ga0496104_0864123 3300048907 Bacteria 810
529 Ga0496105_0373456 3300048908 Bacteria 1136
530 Ga0496106_0620301 3300048909 Bacteria 865
531 Ga0496108_0050519 3300048911 Bacteria 3481
532 Ga0496108_0053263 3300048911 Bacteria 3393
533 Ga0496108_0552054 3300048911 Bacteria 1005
534 Ga0496109_0293673 3300048912 Bacteria 1532
535 Ga0496110_0657889 3300048913 Bacteria 948
536 Ga0496110_1259401 3300048913 Bacteria 649
537 Ga0496111_0275268 3300048914 Bacteria 1249
538 Ga0496111_0430298 3300048914 Bacteria 975
539 Ga0496112_0201159 3300048915 Bacteria 1951
540 Ga0496112_0732404 3300048915 Bacteria 916
541 Ga0496113_0423361 3300048916 Bacteria 1069
542 Ga0496113_0543808 3300048916 Bacteria 932
543 Ga0496114_0444466 3300048917 Bacteria 1148
544 Ga0496114_0471249 3300048917 Bacteria 1111
545 Ga0496114_0955217 3300048917 Bacteria 739
546 Ga0496114_1798236 3300048917 Bacteria 501
547 Ga0496115_0001384 3300048918 Bacteria 17323
548 Ga0496115_0262684 3300048918 Bacteria 1419
549 Ga0496126_0452888 3300048929 Bacteria 1033
550 Ga0496126_0466677 3300048929 Bacteria 1014
551 Ga0496126_0506616 3300048929 Bacteria 964
552 Ga0501031_0006336 3300049568 Bacteria 7716
553 Ga0501031_0130426 3300049568 Bacteria 1642
554 Ga0501031_0131485 3300049568 Bacteria 1635
555 Ga0501032_0007789 3300049569 Bacteria 7811
556 Ga0501032_0009497 3300049569 Bacteria 7048
557 Ga0501032_0100594 3300049569 Bacteria 1915
558 Ga0501032_0249123 3300049569 Bacteria 1153
559 Ga0501033_0004440 3300049570 Bacteria 11220
560 Ga0501033_0017619 3300049570 Bacteria 5395
561 Ga0501033_0032102 3300049570 Bacteria 3942
562 Ga0501033_0444829 3300049570 Bacteria 901
563 Ga0501034_0020575 3300049571 Bacteria 6739
564 Ga0501034_0022705 3300049571 Bacteria 6391
565 Ga0501034_0281500 3300049571 Bacteria 1602
566 Ga0501034_0623385 3300049571 Bacteria 982
567 Ga0501034_0662481 3300049571 Bacteria 945
568 Ga0501036_0007278 3300049572 Bacteria 9013
569 Ga0501036_0016024 3300049572 Bacteria 6262
570 Ga0501036_0388556 3300049572 Bacteria 1164
571 Ga0501037_0007234 3300049573 Bacteria 8110
572 Ga0501037_0010584 3300049573 Bacteria 6775
573 Ga0501037_0238034 3300049573 Bacteria 1276
574 Ga0501037_0473920 3300049573 Bacteria 852
575 Ga0501038_0002697 3300049574 Bacteria 16549
576 Ga0501038_0009560 3300049574 Bacteria 8894
577 Ga0501038_0317914 3300049574 Bacteria 1219
578 Ga0501038_0798481 3300049574 Bacteria 701
579 Ga0501039_0027494 3300049575 Bacteria 4374
580 Ga0501039_0036194 3300049575 Bacteria 3808
581 Ga0501039_0191013 3300049575 Bacteria 1610
582 Ga0501040_0270794 3300049576 Bacteria 1213
583 Ga0501043_0080171 3300049579 Bacteria 2564
584 Ga0501043_0189196 3300049579 Bacteria 1601
585 Ga0501043_0408169 3300049579 Bacteria 1025
586 Ga0501046_0066477 3300049580 Bacteria 2810
587 Ga0501046_0092688 3300049580 Bacteria 2322
588 Ga0501047_0048517 3300049581 Bacteria 4100
589 Ga0501047_0088657 3300049581 Bacteria 2970
590 Ga0501047_0410547 3300049581 Bacteria 1186
591 Ga0501047_0808682 3300049581 Bacteria 752
592 Ga0501047_0925820 3300049581 Bacteria 685
593 Ga0501048_0075041 3300049582 Bacteria 2385
594 Ga0501048_0588794 3300049582 Bacteria 798
595 Ga0501067_0236819 3300049583 Bacteria 1016
596 Ga0501068_0551553 3300049584 Bacteria 749
597 Ga0501069_0041447 3300049585 Bacteria 2545
598 Ga0501070_0047409 3300049586 Bacteria 3571
599 Ga0501070_0102945 3300049586 Bacteria 2361
600 Ga0501070_0258622 3300049586 Bacteria 1423
601 Ga0501070_0571612 3300049586 Bacteria 903
602 Ga0501070_1086066 3300049586 Bacteria 618
603 Ga0501071_0060455 3300049587 Bacteria 2743
604 Ga0501072_0408326 3300049588 Bacteria 1077
605 Ga0501073_0011736 3300049589 Bacteria 6398
606 Ga0501073_0082415 3300049589 Bacteria 2238
607 Ga0501073_0093284 3300049589 Bacteria 2092
608 Ga0501074_1240593 3300049590 Bacteria 523
609 Ga0501075_0409525 3300049591 Bacteria 1034
610 Ga0501076_1038267 3300049592 Bacteria 675
611 Ga0501076_1807293 3300049592 Bacteria 501
612 Ga0501238_001219 3300049671 Bacteria 2947
613 Ga0501079_0226637 3300049741 Bacteria 1460
614 Ga0501080_0005871 3300049742 Bacteria 10996
615 Ga0501262_088080 3300049759 Bacteria 525
616 Ga0501035_0005602 3300049822 Bacteria 11860
617 Ga0501035_0014674 3300049822 Bacteria 7233
618 Ga0501035_0095557 3300049822 Bacteria 2612
619 Ga0501035_0286355 3300049822 Bacteria 1391
620 Ga0501035_0621204 3300049822 Bacteria 879
621 Ga0501035_0750659 3300049822 Bacteria 783
622 Ga0501044_0021291 3300049823 Bacteria 6919
623 Ga0501044_0024125 3300049823 Bacteria 6461
624 Ga0501044_0058722 3300049823 Bacteria 3944
625 Ga0501044_0084557 3300049823 Bacteria 3207
626 Ga0501044_0137599 3300049823 Bacteria 2433
627 Ga0501044_0196719 3300049823 Bacteria 1975
628 Ga0501045_0301488 3300049824 Bacteria 1193
629 Ga0501045_1114076 3300049824 Bacteria 577
630 nmdc:mga03n38_249499_c1 3300050490 Bacteria 937
631 nmdc:mga03n38_347719_c1 3300050490 Bacteria 806
632 nmdc:mga00v17_23_c1 3300050491 Bacteria 43132
633 nmdc:mga0yw44_280811_c1 3300050492 Bacteria 1113
634 nmdc:mga06z11_144428_c1 3300050494 Bacteria 1347
635 nmdc:mga06z11_233351_c1 3300050494 Bacteria 1078
636 nmdc:mga07m45_622177_c1 3300050496 Bacteria 623
637 nmdc:mga05p37_377472_c1 3300050507 Bacteria 1662
638 nmdc:mga09592_1282733_c1 3300050508 Bacteria 603
639 nmdc:mga09592_279328_c1 3300050508 Bacteria 1448
640 nmdc:mga0qj67_1136031_c1 3300050509 Bacteria 609
641 nmdc:mga0qj67_614143_c1 3300050509 Bacteria 869
642 nmdc:mga06r32_12860_c1 3300050510 Bacteria 7565
643 nmdc:mga0rr50_1063637_c1 3300050513 Bacteria 689
644 Ga0500643_050329 3300053087 Bacteria 1192
645 Ga0500644_0416076 3300053088 Bacteria 587
646 Ga0500646_0000088 3300053090 Bacteria 26075
647 Ga0500646_0077659 3300053090 Bacteria 1007
648 Ga0500583_0006793 3300053092 Bacteria 3969
649 Ga0500641_0007308 3300053096 Bacteria 3937
650 Ga0500641_0434905 3300053096 Bacteria 509
651 Ga0500650_0347906 3300053098 Bacteria 649
652 Ga0500556_0367398 3300053104 Bacteria 555
653 Ga0500562_138111 3300053108 Bacteria 664
654 Ga0500592_010718 3300053116 Bacteria 1462
655 Ga0500592_043466 3300053116 Bacteria 728
656 Ga0500594_0072713 3300053118 Bacteria 1014
657 Ga0500642_0000002 3300053130 Bacteria 795093
658 Ga0500642_0436365 3300053130 Bacteria 565
659 Ga0500652_092173 3300053131 Bacteria 1265
660 Ga0500658_0014554 3300053134 Bacteria 2914
661 Ga0500658_0237611 3300053134 Bacteria 837
662 Ga0500568_0000579 3300053139 Bacteria 26786
663 Ga0500568_0001306 3300053139 Bacteria 16359
664 Ga0500568_0007771 3300053139 Bacteria 5227
665 Ga0500588_0008410 3300053146 Bacteria 2409
666 Ga0500616_0000483 3300053153 Bacteria 51655
667 Ga0500627_0000033 3300053158 Bacteria 82993
668 Ga0500630_212903 3300053159 Bacteria 735
669 Ga0500645_002050 3300053730 Bacteria 9379
670 Ga0500645_023936 3300053730 Bacteria 1870
671 Ga0500599_057531 3300053736 Bacteria 627
672 Ga0500587_002647 3300053739 Bacteria 2539
673 Ga0501082_1811764 3300060353 Unclassified 532

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2852653556 2852654369 66
2 3300049581 Ga0501047_0808682 Ga0501047_0808682_477_692 67
3 iso_pu_bacteria 2643221560 2643819779 67
4 iso_pu_bacteria 2852680915 2852684282 67
5 3300005295 Ga0065707_10970854 Ga0065707_109708541 68
6 3300048918 Ga0496115_0001384 Ga0496115_0001384_5712_5918 68
7 iso_pu_bacteria 2996221748 2996222565 68
8 3300006846 Ga0075430_100586297 Ga0075430_1005862972 69
9 3300006880 Ga0075429_101623208 Ga0075429_1016232082 69
10 3300026075 Ga0207708_10873619 Ga0207708_108736193 69
11 3300031901 Ga0307406_11609747 Ga0307406_116097471 69
12 3300032002 Ga0307416_103348917 Ga0307416_1033489172 69
13 3300041453 Ga0451797_0512445 Ga0451797_0512445_271_480 69
14 3300042993 Ga0439440_0004083 Ga0439440_0004083_2545_2754 69
15 3300050508 nmdc:mga09592_1282733_c1 nmdc:mga09592_1282733_c1_180_392 69
16 3300050509 nmdc:mga0qj67_1136031_c1 nmdc:mga0qj67_1136031_c1_148_360 69
17 iso_pu_bacteria 2643221695 2644529035 69
18 iso_pu_bacteria 2675903060 2676494832 69
19 iso_pu_bacteria 2751185734 2753069156 69
20 iso_pu_bacteria 2870721527 2870728384 69
21 3300002737 JGI25162J39368_1008339 JGI25162J39368_10083393 70
22 3300002772 JGI25164J39214_1001125 JGI25164J39214_10011255 70
23 3300003214 JGI25165J46597_1000269 JGI25165J46597_10002698 70
24 3300003354 JGI25160J50197_1058139 JGI25160J50197_10581392 70
25 3300003771 Ga0055526_1000961 Ga0055526_100096122 70
26 3300003771 Ga0055526_1067220 Ga0055526_10672201 70
27 3300003791 Ga0055530_10036936 Ga0055530_100369362 70
28 3300005327 Ga0070658_10639602 Ga0070658_106396022 70
29 3300005334 Ga0068869_101009531 Ga0068869_1010095312 70
30 3300005337 Ga0070682_100198731 Ga0070682_1001987313 70
31 3300005354 Ga0070675_101128337 Ga0070675_1011283371 70
32 3300005535 Ga0070684_101773228 Ga0070684_1017732282 70
33 3300005539 Ga0068853_100273709 Ga0068853_1002737093 70
34 3300005539 Ga0068853_100893245 Ga0068853_1008932452 70
35 3300005578 Ga0068854_101294313 Ga0068854_1012943132 70
36 3300005616 Ga0068852_102798712 Ga0068852_1027987122 70
37 3300005937 Ga0081455_10690286 Ga0081455_106902861 70
38 3300006175 Ga0070712_100213341 Ga0070712_1002133412 70
39 3300006847 Ga0075431_100104479 Ga0075431_1001044794 70
40 3300009094 Ga0111539_12062175 Ga0111539_120621752 70
41 3300009148 Ga0105243_13051614 Ga0105243_130516142 70
42 3300013105 Ga0157369_10839774 Ga0157369_108397743 70
43 3300013308 Ga0157375_10646286 Ga0157375_106462863 70
44 3300013308 Ga0157375_11298440 Ga0157375_112984402 70
45 3300014745 Ga0157377_10919125 Ga0157377_109191252 70
46 3300025231 Ga0207427_100054 Ga0207427_100054147 70
47 3300025233 Ga0209437_100642 Ga0209437_1006426 70
48 3300025245 Ga0207425_1000041 Ga0207425_100004117 70
49 3300025258 Ga0209129_1000977 Ga0209129_10009777 70
50 3300025261 Ga0209233_1000001 Ga0209233_10000011024 70
51 3300025263 Ga0209565_1001163 Ga0209565_10011632 70
52 3300025273 Ga0209673_1026813 Ga0209673_10268133 70
53 3300025292 Ga0209676_1006028 Ga0209676_10060289 70
54 3300025292 Ga0209676_1012522 Ga0209676_10125227 70
55 3300025294 Ga0209025_1000068 Ga0209025_1000068186 70
56 3300025295 Ga0209564_1000622 Ga0209564_100062219 70
57 3300025297 Ga0209758_1000004 Ga0209758_100000485 70
58 3300025298 Ga0209050_1000001 Ga0209050_10000012016 70
59 3300025298 Ga0209050_1010590 Ga0209050_10105908 70
60 3300025298 Ga0209050_1012591 Ga0209050_10125918 70
61 3300025302 Ga0207426_1036225 Ga0207426_10362253 70
62 3300025303 Ga0209051_1000191 Ga0209051_100019153 70
63 3300025304 Ga0209257_1001893 Ga0209257_100189326 70
64 3300025304 Ga0209257_1002895 Ga0209257_10028953 70
65 3300025909 Ga0207705_11066321 Ga0207705_110663212 70
66 3300025972 Ga0207668_10122041 Ga0207668_101220413 70
67 3300026041 Ga0207639_10194018 Ga0207639_101940183 70
68 3300026095 Ga0207676_11784730 Ga0207676_117847301 70
69 3300026142 Ga0207698_11226901 Ga0207698_112269012 70
70 3300026142 Ga0207698_11503320 Ga0207698_115033201 70
71 3300027876 Ga0209974_10458078 Ga0209974_104580781 70
72 3300031731 Ga0307405_11200961 Ga0307405_112009612 70
73 3300031731 Ga0307405_11726390 Ga0307405_117263902 70
74 3300031838 Ga0307518_10000363 Ga0307518_1000036321 70
75 3300031901 Ga0307406_10357785 Ga0307406_103577852 70
76 3300031901 Ga0307406_10753036 Ga0307406_107530362 70
77 3300031901 Ga0307406_11105207 Ga0307406_111052072 70
78 3300031995 Ga0307409_100169353 Ga0307409_1001693534 70
79 3300031995 Ga0307409_100405283 Ga0307409_1004052832 70
80 3300031995 Ga0307409_100460800 Ga0307409_1004608003 70
81 3300032002 Ga0307416_100093115 Ga0307416_1000931151 70
82 3300032002 Ga0307416_101698001 Ga0307416_1016980011 70
83 3300032126 Ga0307415_100045389 Ga0307415_1000453893 70
84 3300032126 Ga0307415_100921916 Ga0307415_1009219162 70
85 3300032126 Ga0307415_101559439 Ga0307415_1015594392 70
86 3300036712 Ga0316584_0174426 Ga0316584_0174426_1251_1472 70
87 3300038705 Ga0237819_02012 Ga0237819_02012_495_707 70
88 3300039062 Ga0400483_283032 Ga0400483_283032_399_611 70
89 3300039145 Ga0237816_00962 Ga0237816_00962_709_921 70
90 3300039437 Ga0436365_0260153 Ga0436365_0260153_36_251 70
91 3300041451 Ga0451791_0637026 Ga0451791_0637026_950_1165 70
92 3300041453 Ga0451797_1286614 Ga0451797_1286614_192_407 70
93 3300041460 Ga0451802_0829211 Ga0451802_0829211_213_431 70
94 3300041486 Ga0451807_2049489 Ga0451807_2049489_85_300 70
95 3300041486 Ga0451807_2061218 Ga0451807_2061218_365_577 70
96 3300041494 Ga0451837_0588667 Ga0451837_0588667_138_356 70
97 3300041498 Ga0451841_1105605 Ga0451841_1105605_305_523 70
98 3300041512 Ga0451853_2934718 Ga0451853_2934718_214_429 70
99 3300041512 Ga0451853_3952303 Ga0451853_3952303_377_595 70
100 3300042003 Ga0439443_034108 Ga0439443_034108_133_345 70
101 3300042142 Ga0450905_014976 Ga0450905_014976_209_421 70
102 3300048905 Ga0496102_0325295 Ga0496102_0325295_1186_1398 70
103 3300048907 Ga0496104_0864123 Ga0496104_0864123_512_727 70
104 3300048913 Ga0496110_1259401 Ga0496110_1259401_23_238 70
105 3300048914 Ga0496111_0430298 Ga0496111_0430298_603_818 70
106 3300048916 Ga0496113_0543808 Ga0496113_0543808_604_819 70
107 3300048917 Ga0496114_0444466 Ga0496114_0444466_838_1053 70
108 3300048929 Ga0496126_0452888 Ga0496126_0452888_702_914 70
109 3300049592 Ga0501076_1807293 Ga0501076_1807293_13_231 70
110 3300049671 Ga0501238_001219 Ga0501238_001219_1297_1512 70
111 3300049822 Ga0501035_0621204 Ga0501035_0621204_230_442 70
112 3300049824 Ga0501045_1114076 Ga0501045_1114076_149_379 70
113 3300050491 nmdc:mga00v17_23_c1 nmdc:mga00v17_23_c1_19806_20018 70
114 3300050510 nmdc:mga06r32_12860_c1 nmdc:mga06r32_12860_c1_6236_6454 70
115 3300053096 Ga0500641_0007308 Ga0500641_0007308_2583_2795 70
116 3300053104 Ga0500556_0367398 Ga0500556_0367398_294_506 70
117 3300053108 Ga0500562_138111 Ga0500562_138111_239_451 70
118 3300053118 Ga0500594_0072713 Ga0500594_0072713_705_917 70
119 3300053730 Ga0500645_002050 Ga0500645_002050_50_262 70
120 3300053730 Ga0500645_023936 Ga0500645_023936_155_367 70
121 3300053736 Ga0500599_057531 Ga0500599_057531_356_568 70
122 iso_pu_bacteria 2558860280 2559424523 70
123 iso_pu_bacteria 2582581314 2585315162 70
124 iso_pu_bacteria 2791354901 2791914452 70
125 3300003791 Ga0055530_10033459 Ga0055530_100334593 71
126 3300005334 Ga0068869_100346121 Ga0068869_1003461213 71
127 3300005334 Ga0068869_101591834 Ga0068869_1015918342 71
128 3300005337 Ga0070682_100922759 Ga0070682_1009227592 71
129 3300005455 Ga0070663_100979742 Ga0070663_1009797422 71
130 3300005539 Ga0068853_100438875 Ga0068853_1004388753 71
131 3300005543 Ga0070672_100457746 Ga0070672_1004577462 71
132 3300005548 Ga0070665_100000078 Ga0070665_10000007863 71
133 3300005617 Ga0068859_101535234 Ga0068859_1015352342 71
134 3300005834 Ga0068851_10872225 Ga0068851_108722252 71
135 3300005843 Ga0068860_100264234 Ga0068860_1002642344 71
136 3300006038 Ga0075365_10087464 Ga0075365_100874643 71
137 3300006048 Ga0075363_100212596 Ga0075363_1002125962 71
138 3300006353 Ga0075370_11025219 Ga0075370_110252191 71
139 3300006358 Ga0068871_101376272 Ga0068871_1013762723 71
140 3300006931 Ga0097620_101535158 Ga0097620_1015351582 71
141 3300009098 Ga0105245_11145009 Ga0105245_111450092 71
142 3300013100 Ga0157373_11268285 Ga0157373_112682852 71
143 3300013296 Ga0157374_12981672 Ga0157374_129816722 71
144 3300014325 Ga0163163_12223590 Ga0163163_122235902 71
145 3300017792 Ga0163161_12118946 Ga0163161_121189462 71
146 3300021384 Ga0213876_10002639 Ga0213876_100026398 71
147 3300025263 Ga0209565_1052632 Ga0209565_10526322 71
148 3300025292 Ga0209676_1019508 Ga0209676_10195082 71
149 3300025294 Ga0209025_1148152 Ga0209025_11481521 71
150 3300025298 Ga0209050_1001738 Ga0209050_100173822 71
151 3300025304 Ga0209257_1001973 Ga0209257_10019737 71
152 3300025315 Ga0207697_10559018 Ga0207697_105590182 71
153 3300025920 Ga0207649_11401016 Ga0207649_114010162 71
154 3300025927 Ga0207687_10775048 Ga0207687_107750482 71
155 3300025931 Ga0207644_10617090 Ga0207644_106170902 71
156 3300025935 Ga0207709_10700985 Ga0207709_107009852 71
157 3300025944 Ga0207661_11125549 Ga0207661_111255492 71
158 3300025944 Ga0207661_11728885 Ga0207661_117288852 71
159 3300025945 Ga0207679_10465506 Ga0207679_104655062 71
160 3300026041 Ga0207639_10374248 Ga0207639_103742482 71
161 3300028379 Ga0268266_10000131 Ga0268266_10000131114 71
162 3300028381 Ga0268264_10011270 Ga0268264_100112704 71
163 3300028556 Ga0265337_1010536 Ga0265337_10105364 71
164 3300028794 Ga0307515_10739082 Ga0307515_107390821 71
165 3300031456 Ga0307513_10404867 Ga0307513_104048672 71
166 3300031649 Ga0307514_10058419 Ga0307514_100584194 71
167 3300031824 Ga0307413_11598422 Ga0307413_115984222 71
168 3300031901 Ga0307406_10504645 Ga0307406_105046452 71
169 3300031911 Ga0307412_10340526 Ga0307412_103405264 71
170 3300032004 Ga0307414_10739222 Ga0307414_107392222 71
171 3300032126 Ga0307415_102122116 Ga0307415_1021221161 71
172 3300033180 Ga0307510_10049951 Ga0307510_100499515 71
173 3300035086 Ga0373934_0475000 Ga0373934_0475000_86_304 71
174 3300035111 Ga0373923_0089766 Ga0373923_0089766_1101_1319 71
175 3300035113 Ga0373936_0216263 Ga0373936_0216263_263_478 71
176 3300035117 Ga0373953_0032702 Ga0373953_0032702_379_597 71
177 3300035724 Ga0373933_0181516 Ga0373933_0181516_254_472 71
178 3300036401 Ga0373937_0277933 Ga0373937_0277933_1216_1434 71
179 3300037068 Ga0373925_0224946 Ga0373925_0224946_1070_1288 71
180 3300039437 Ga0436365_0354361 Ga0436365_0354361_359_574 71
181 3300039450 Ga0436363_0345479 Ga0436363_0345479_221_436 71
182 3300039450 Ga0436363_1291634 Ga0436363_1291634_47_262 71
183 3300041451 Ga0451791_0649049 Ga0451791_0649049_236_451 71
184 3300041460 Ga0451802_0698271 Ga0451802_0698271_38_256 71
185 3300041463 Ga0451804_0106901 Ga0451804_0106901_82_297 71
186 3300041486 Ga0451807_2603260 Ga0451807_2603260_366_587 71
187 3300041486 Ga0451807_2628185 Ga0451807_2628185_246_467 71
188 3300042876 Ga0451577_0533489 Ga0451577_0533489_246_470 71
189 3300044673 Ga0453683_0000060 Ga0453683_0000060_161644_161868 71
190 3300044712 Ga0453684_0010987 Ga0453684_0010987_4136_4360 71
191 3300045051 Ga0451576_0000001 Ga0451576_0000001_1185888_1186112 71
192 3300046499 Ga0495594_0030734 Ga0495594_0030734_483_707 71
193 3300046517 Ga0495630_0480809 Ga0495630_0480809_469_687 71
194 3300046525 Ga0495663_0016453 Ga0495663_0016453_1442_1663 71
195 3300046530 Ga0495654_0024158 Ga0495654_0024158_1323_1538 71
196 3300046616 Ga0495668_0519439 Ga0495668_0519439_178_393 71
197 3300046660 Ga0495625_0000520 Ga0495625_0000520_4712_4933 71
198 3300046660 Ga0495625_0260011 Ga0495625_0260011_819_1034 71
199 3300047317 Ga0495604_0432622 Ga0495604_0432622_366_584 71
200 3300047319 Ga0495674_0307055 Ga0495674_0307055_662_880 71
201 3300047470 Ga0495681_0273816 Ga0495681_0273816_91_306 71
202 3300047673 Ga0495593_0201859 Ga0495593_0201859_159_377 71
203 3300048915 Ga0496112_0732404 Ga0496112_0732404_341_559 71
204 3300048917 Ga0496114_0471249 Ga0496114_0471249_721_936 71
205 3300048929 Ga0496126_0466677 Ga0496126_0466677_132_347 71
206 3300048929 Ga0496126_0506616 Ga0496126_0506616_254_469 71
207 3300049568 Ga0501031_0131485 Ga0501031_0131485_503_718 71
208 3300049569 Ga0501032_0009497 Ga0501032_0009497_4397_4612 71
209 3300049569 Ga0501032_0249123 Ga0501032_0249123_323_538 71
210 3300049570 Ga0501033_0017619 Ga0501033_0017619_4150_4365 71
211 3300049570 Ga0501033_0444829 Ga0501033_0444829_524_739 71
212 3300049571 Ga0501034_0022705 Ga0501034_0022705_1606_1821 71
213 3300049571 Ga0501034_0281500 Ga0501034_0281500_241_456 71
214 3300049571 Ga0501034_0623385 Ga0501034_0623385_609_824 71
215 3300049572 Ga0501036_0007278 Ga0501036_0007278_302_517 71
216 3300049573 Ga0501037_0010584 Ga0501037_0010584_178_393 71
217 3300049574 Ga0501038_0009560 Ga0501038_0009560_5321_5536 71
218 3300049575 Ga0501039_0027494 Ga0501039_0027494_2455_2670 71
219 3300049579 Ga0501043_0189196 Ga0501043_0189196_509_724 71
220 3300049580 Ga0501046_0066477 Ga0501046_0066477_2494_2709 71
221 3300049581 Ga0501047_0048517 Ga0501047_0048517_696_911 71
222 3300049581 Ga0501047_0925820 Ga0501047_0925820_375_590 71
223 3300049582 Ga0501048_0588794 Ga0501048_0588794_196_411 71
224 3300049585 Ga0501069_0041447 Ga0501069_0041447_321_536 71
225 3300049586 Ga0501070_0102945 Ga0501070_0102945_693_908 71
226 3300049586 Ga0501070_0571612 Ga0501070_0571612_101_316 71
227 3300049590 Ga0501074_1240593 Ga0501074_1240593_115_336 71
228 3300049759 Ga0501262_088080 Ga0501262_088080_279_494 71
229 3300049822 Ga0501035_0014674 Ga0501035_0014674_2791_3006 71
230 3300049822 Ga0501035_0286355 Ga0501035_0286355_1139_1354 71
231 3300049822 Ga0501035_0750659 Ga0501035_0750659_132_347 71
232 3300049823 Ga0501044_0024125 Ga0501044_0024125_1573_1788 71
233 3300049823 Ga0501044_0058722 Ga0501044_0058722_2187_2402 71
234 3300049823 Ga0501044_0137599 Ga0501044_0137599_982_1197 71
235 3300050490 nmdc:mga03n38_249499_c1 nmdc:mga03n38_249499_c1_321_539 71
236 3300050490 nmdc:mga03n38_347719_c1 nmdc:mga03n38_347719_c1_444_662 71
237 3300050492 nmdc:mga0yw44_280811_c1 nmdc:mga0yw44_280811_c1_256_474 71
238 3300050494 nmdc:mga06z11_144428_c1 nmdc:mga06z11_144428_c1_184_405 71
239 3300053087 Ga0500643_050329 Ga0500643_050329_638_859 71
240 3300053090 Ga0500646_0077659 Ga0500646_0077659_635_850 71
241 3300053096 Ga0500641_0434905 Ga0500641_0434905_56_271 71
242 3300053116 Ga0500592_010718 Ga0500592_010718_613_828 71
243 3300053116 Ga0500592_043466 Ga0500592_043466_22_243 71
244 3300053130 Ga0500642_0000002 Ga0500642_0000002_701413_701634 71
245 3300053134 Ga0500658_0014554 Ga0500658_0014554_1378_1599 71
246 3300053134 Ga0500658_0237611 Ga0500658_0237611_499_717 71
247 3300053139 Ga0500568_0000579 Ga0500568_0000579_13685_13900 71
248 3300053139 Ga0500568_0001306 Ga0500568_0001306_3674_3895 71
249 3300053153 Ga0500616_0000483 Ga0500616_0000483_33197_33412 71
250 3300053158 Ga0500627_0000033 Ga0500627_0000033_30403_30618 71
251 3300053739 Ga0500587_002647 Ga0500587_002647_1097_1312 71
252 3300060353 Ga0501082_1811764 Ga0501082_1811764_16_282 71
253 iso_pu_bacteria 8055066027 8055071622 71
254 3300002737 JGI25162J39368_1001151 JGI25162J39368_100115116 72
255 3300002772 JGI25164J39214_1000193 JGI25164J39214_10001933 72
256 3300003203 JGI25406J46586_10008343 JGI25406J46586_100083432 72
257 3300003214 JGI25165J46597_1002787 JGI25165J46597_10027872 72
258 3300003781 Ga0055536_1000881 Ga0055536_100088113 72
259 3300003784 Ga0055534_1012732 Ga0055534_10127323 72
260 3300003791 Ga0055530_10000083 Ga0055530_1000008338 72
261 3300003794 Ga0055531_10000316 Ga0055531_1000031623 72
262 3300003794 Ga0055531_10000471 Ga0055531_1000047113 72
263 3300005328 Ga0070676_10647695 Ga0070676_106476951 72
264 3300005329 Ga0070683_100510778 Ga0070683_1005107782 72
265 3300005337 Ga0070682_101217754 Ga0070682_1012177542 72
266 3300005354 Ga0070675_102085755 Ga0070675_1020857551 72
267 3300005356 Ga0070674_100215252 Ga0070674_1002152522 72
268 3300005366 Ga0070659_100272920 Ga0070659_1002729202 72
269 3300005455 Ga0070663_101953464 Ga0070663_1019534642 72
270 3300005456 Ga0070678_100613431 Ga0070678_1006134312 72
271 3300005459 Ga0068867_101404169 Ga0068867_1014041692 72
272 3300005466 Ga0070685_11208280 Ga0070685_112082801 72
273 3300005539 Ga0068853_100332802 Ga0068853_1003328022 72
274 3300005543 Ga0070672_100739513 Ga0070672_1007395132 72
275 3300005563 Ga0068855_100526038 Ga0068855_1005260382 72
276 3300005577 Ga0068857_100222158 Ga0068857_1002221582 72
277 3300005578 Ga0068854_100149362 Ga0068854_1001493622 72
278 3300005614 Ga0068856_100329500 Ga0068856_1003295002 72
279 3300005616 Ga0068852_100167782 Ga0068852_1001677822 72
280 3300005618 Ga0068864_101523652 Ga0068864_1015236522 72
281 3300005834 Ga0068851_10156768 Ga0068851_101567682 72
282 3300005981 Ga0081538_10010782 Ga0081538_100107826 72
283 3300005981 Ga0081538_10014870 Ga0081538_100148703 72
284 3300005983 Ga0081540_1333233 Ga0081540_13332331 72
285 3300005985 Ga0081539_10000031 Ga0081539_1000003161 72
286 3300005985 Ga0081539_10005625 Ga0081539_1000562510 72
287 3300006028 Ga0070717_10373130 Ga0070717_103731303 72
288 3300006237 Ga0097621_101819940 Ga0097621_1018199402 72
289 3300006358 Ga0068871_101418701 Ga0068871_1014187012 72
290 3300006844 Ga0075428_100060805 Ga0075428_1000608056 72
291 3300006844 Ga0075428_100296028 Ga0075428_1002960282 72
292 3300006844 Ga0075428_101146007 Ga0075428_1011460071 72
293 3300006846 Ga0075430_100281133 Ga0075430_1002811333 72
294 3300006846 Ga0075430_100281285 Ga0075430_1002812852 72
295 3300009093 Ga0105240_12744205 Ga0105240_127442052 72
296 3300009098 Ga0105245_10825292 Ga0105245_108252922 72
297 3300009147 Ga0114129_11287969 Ga0114129_112879692 72
298 3300009148 Ga0105243_12374845 Ga0105243_123748452 72
299 3300009174 Ga0105241_10306021 Ga0105241_103060212 72
300 3300009177 Ga0105248_13109645 Ga0105248_131096452 72
301 3300009545 Ga0105237_12230094 Ga0105237_122300941 72
302 3300009551 Ga0105238_11746619 Ga0105238_117466192 72
303 3300009553 Ga0105249_11315807 Ga0105249_113158072 72
304 3300010375 Ga0105239_11030265 Ga0105239_110302652 72
305 3300011119 Ga0105246_10335082 Ga0105246_103350822 72
306 3300013102 Ga0157371_10228588 Ga0157371_102285882 72
307 3300013296 Ga0157374_11836986 Ga0157374_118369862 72
308 3300013297 Ga0157378_10451454 Ga0157378_104514542 72
309 3300013306 Ga0163162_13391211 Ga0163162_133912112 72
310 3300013307 Ga0157372_10477147 Ga0157372_104771472 72
311 3300014325 Ga0163163_10537637 Ga0163163_105376372 72
312 3300014325 Ga0163163_10822956 Ga0163163_108229562 72
313 3300025231 Ga0207427_100117 Ga0207427_10011748 72
314 3300025233 Ga0209437_100240 Ga0209437_10024064 72
315 3300025245 Ga0207425_1057180 Ga0207425_10571802 72
316 3300025261 Ga0209233_1000083 Ga0209233_1000083271 72
317 3300025291 Ga0209675_1000190 Ga0209675_100019055 72
318 3300025292 Ga0209676_1000133 Ga0209676_100013376 72
319 3300025294 Ga0209025_1010719 Ga0209025_10107192 72
320 3300025297 Ga0209758_1049652 Ga0209758_10496522 72
321 3300025298 Ga0209050_1000067 Ga0209050_100006770 72
322 3300025304 Ga0209257_1000132 Ga0209257_1000132111 72
323 3300025904 Ga0207647_10411857 Ga0207647_104118572 72
324 3300025907 Ga0207645_10116341 Ga0207645_101163413 72
325 3300025909 Ga0207705_10367377 Ga0207705_103673772 72
326 3300025919 Ga0207657_10035367 Ga0207657_100353672 72
327 3300025920 Ga0207649_10881004 Ga0207649_108810041 72
328 3300025924 Ga0207694_11238840 Ga0207694_112388402 72
329 3300025925 Ga0207650_10781690 Ga0207650_107816902 72
330 3300025932 Ga0207690_10741930 Ga0207690_107419302 72
331 3300025937 Ga0207669_10074994 Ga0207669_100749943 72
332 3300025937 Ga0207669_10264549 Ga0207669_102645492 72
333 3300025938 Ga0207704_10362856 Ga0207704_103628563 72
334 3300025940 Ga0207691_10079523 Ga0207691_100795233 72
335 3300025941 Ga0207711_11572865 Ga0207711_115728652 72
336 3300025981 Ga0207640_10199242 Ga0207640_101992422 72
337 3300026023 Ga0207677_10526855 Ga0207677_105268553 72
338 3300026041 Ga0207639_10319783 Ga0207639_103197832 72
339 3300026067 Ga0207678_10351367 Ga0207678_103513672 72
340 3300026078 Ga0207702_10461881 Ga0207702_104618812 72
341 3300026089 Ga0207648_10152652 Ga0207648_101526522 72
342 3300026116 Ga0207674_10237339 Ga0207674_102373392 72
343 3300026121 Ga0207683_10078463 Ga0207683_100784633 72
344 3300026121 Ga0207683_11591408 Ga0207683_115914082 72
345 3300026142 Ga0207698_10234988 Ga0207698_102349882 72
346 3300028379 Ga0268266_10582547 Ga0268266_105825472 72
347 3300028794 Ga0307515_10266044 Ga0307515_102660443 72
348 3300031456 Ga0307513_10039349 Ga0307513_100393492 72
349 3300031456 Ga0307513_10057618 Ga0307513_100576182 72
350 3300031649 Ga0307514_10455589 Ga0307514_104555892 72
351 3300031731 Ga0307405_10004380 Ga0307405_100043803 72
352 3300031824 Ga0307413_10632019 Ga0307413_106320192 72
353 3300031852 Ga0307410_10276253 Ga0307410_102762532 72
354 3300031901 Ga0307406_10064232 Ga0307406_100642323 72
355 3300031903 Ga0307407_10030591 Ga0307407_100305913 72
356 3300031995 Ga0307409_100001766 Ga0307409_1000017664 72
357 3300031995 Ga0307409_100760076 Ga0307409_1007600763 72
358 3300032002 Ga0307416_100001803 Ga0307416_1000018039 72
359 3300032002 Ga0307416_103893144 Ga0307416_1038931441 72
360 3300032005 Ga0307411_10095633 Ga0307411_100956333 72
361 3300032126 Ga0307415_100000474 Ga0307415_10000047414 72
362 3300032126 Ga0307415_100021712 Ga0307415_1000217124 72
363 3300033179 Ga0307507_10180177 Ga0307507_101801772 72
364 3300034816 Ga0373930_0108231 Ga0373930_0108231_388_612 72
365 3300034818 Ga0373950_0114526 Ga0373950_0114526_328_552 72
366 3300035090 Ga0373949_0098244 Ga0373949_0098244_38_262 72
367 3300035091 Ga0373951_0043290 Ga0373951_0043290_688_912 72
368 3300035207 Ga0373942_0056356 Ga0373942_0056356_14_238 72
369 3300035691 Ga0373931_0174036 Ga0373931_0174036_560_784 72
370 3300041494 Ga0451837_0362053 Ga0451837_0362053_239_463 72
371 3300042003 Ga0439443_112236 Ga0439443_112236_287_511 72
372 3300042005 Ga0439448_0088988 Ga0439448_0088988_459_680 72
373 3300042012 Ga0439455_0128108 Ga0439455_0128108_455_679 72
374 3300042016 Ga0439463_003783 Ga0439463_003783_91_315 72
375 3300042437 Ga0439444_0007107 Ga0439444_0007107_218_439 72
376 3300042993 Ga0439440_0003715 Ga0439440_0003715_2025_2249 72
377 3300044712 Ga0453684_1795378 Ga0453684_1795378_163_387 72
378 3300048911 Ga0496108_0552054 Ga0496108_0552054_546_770 72
379 3300048917 Ga0496114_1798236 Ga0496114_1798236_23_247 72
380 3300049586 Ga0501070_1086066 Ga0501070_1086066_89_313 72
381 3300050507 nmdc:mga05p37_377472_c1 nmdc:mga05p37_377472_c1_95_319 72
382 3300050508 nmdc:mga09592_279328_c1 nmdc:mga09592_279328_c1_873_1097 72
383 3300050509 nmdc:mga0qj67_614143_c1 nmdc:mga0qj67_614143_c1_560_784 72
384 3300053139 Ga0500568_0007771 Ga0500568_0007771_4304_4528 72
385 3300005337 Ga0070682_100401525 Ga0070682_1004015252 73
386 3300005434 Ga0070709_10479550 Ga0070709_104795502 73
387 3300005435 Ga0070714_100667222 Ga0070714_1006672222 73
388 3300005435 Ga0070714_102058694 Ga0070714_1020586942 73
389 3300005436 Ga0070713_102038550 Ga0070713_1020385502 73
390 3300005439 Ga0070711_101433367 Ga0070711_1014333672 73
391 3300005458 Ga0070681_10659586 Ga0070681_106595862 73
392 3300005539 Ga0068853_100049917 Ga0068853_1000499175 73
393 3300005578 Ga0068854_100942091 Ga0068854_1009420912 73
394 3300006028 Ga0070717_11174617 Ga0070717_111746172 73
395 3300006163 Ga0070715_10342781 Ga0070715_103427812 73
396 3300006178 Ga0075367_10352424 Ga0075367_103524243 73
397 3300006237 Ga0097621_100136148 Ga0097621_1001361483 73
398 3300009148 Ga0105243_10087416 Ga0105243_100874163 73
399 3300009551 Ga0105238_10406366 Ga0105238_104063663 73
400 3300013296 Ga0157374_12744168 Ga0157374_127441682 73
401 3300025231 Ga0207427_100178 Ga0207427_10017824 73
402 3300025233 Ga0209437_100304 Ga0209437_10030424 73
403 3300025261 Ga0209233_1000287 Ga0209233_100028754 73
404 3300025906 Ga0207699_10111832 Ga0207699_101118322 73
405 3300025912 Ga0207707_10751055 Ga0207707_107510552 73
406 3300025924 Ga0207694_11578562 Ga0207694_115785622 73
407 3300026041 Ga0207639_10239950 Ga0207639_102399503 73
408 3300026095 Ga0207676_12320614 Ga0207676_123206142 73
409 3300026118 Ga0207675_100859877 Ga0207675_1008598772 73
410 3300026142 Ga0207698_10093412 Ga0207698_100934121 73
411 3300028379 Ga0268266_10191605 Ga0268266_101916052 73
412 3300028794 Ga0307515_10131481 Ga0307515_101314813 73
413 3300030731 Ga0316177_1074352 Ga0316177_10743526 73
414 3300030733 Ga0314311_1196854 Ga0314311_11968542 73
415 3300030734 Ga0316179_1070522 Ga0316179_10705222 73
416 3300030736 Ga0316180_1192092 Ga0316180_11920922 73
417 3300031238 Ga0265332_10038706 Ga0265332_100387062 73
418 3300031616 Ga0307508_10000982 Ga0307508_100009824 73
419 3300031616 Ga0307508_10156710 Ga0307508_101567103 73
420 3300031727 Ga0316576_10568221 Ga0316576_105682212 73
421 3300031901 Ga0307406_11519107 Ga0307406_115191072 73
422 3300032126 Ga0307415_100388983 Ga0307415_1003889833 73
423 3300033179 Ga0307507_10167399 Ga0307507_101673993 73
424 3300033179 Ga0307507_10543021 Ga0307507_105430212 73
425 3300034817 Ga0373948_0028553 Ga0373948_0028553_647_874 73
426 3300035116 Ga0373945_0392158 Ga0373945_0392158_195_422 73
427 3300035692 Ga0373935_0986847 Ga0373935_0986847_73_300 73
428 3300035695 Ga0373927_0122036 Ga0373927_0122036_75_302 73
429 3300035725 Ga0373947_0549319 Ga0373947_0549319_489_716 73
430 3300041459 Ga0451800_1361167 Ga0451800_1361167_128_352 73
431 3300041501 Ga0451845_0281309 Ga0451845_0281309_229_462 73
432 3300042461 Ga0439460_0106062 Ga0439460_0106062_155_385 73
433 3300044658 Ga0466972_0006222 Ga0466972_0006222_4933_5157 73
434 3300044658 Ga0466972_0034255 Ga0466972_0034255_407_631 73
435 3300044683 Ga0466965_0004824 Ga0466965_0004824_4409_4633 73
436 3300044683 Ga0466965_0024589 Ga0466965_0024589_1599_1823 73
437 3300044683 Ga0466965_0080173 Ga0466965_0080173_335_559 73
438 3300044735 Ga0466968_0348785 Ga0466968_0348785_473_697 73
439 3300044901 Ga0466960_0002929 Ga0466960_0002929_4989_5213 73
440 3300045836 Ga0466958_0665711 Ga0466958_0665711_375_596 73
441 3300046529 Ga0495652_0056439 Ga0495652_0056439_1673_1930 73
442 3300046559 Ga0495667_0515082 Ga0495667_0515082_183_410 73
443 3300046616 Ga0495668_0000076 Ga0495668_0000076_87255_87482 73
444 3300046689 Ga0495613_0007953 Ga0495613_0007953_6630_6887 73
445 3300048911 Ga0496108_0050519 Ga0496108_0050519_2328_2555 73
446 3300049568 Ga0501031_0006336 Ga0501031_0006336_818_1039 73
447 3300049569 Ga0501032_0007789 Ga0501032_0007789_6082_6309 73
448 3300049571 Ga0501034_0020575 Ga0501034_0020575_5538_5759 73
449 3300049572 Ga0501036_0016024 Ga0501036_0016024_1958_2179 73
450 3300049573 Ga0501037_0007234 Ga0501037_0007234_1804_2025 73
451 3300049574 Ga0501038_0002697 Ga0501038_0002697_1406_1627 73
452 3300049575 Ga0501039_0036194 Ga0501039_0036194_3253_3474 73
453 3300049579 Ga0501043_0408169 Ga0501043_0408169_208_429 73
454 3300049581 Ga0501047_0410547 Ga0501047_0410547_93_314 73
455 3300049584 Ga0501068_0551553 Ga0501068_0551553_180_401 73
456 3300049586 Ga0501070_0047409 Ga0501070_0047409_2470_2691 73
457 3300049587 Ga0501071_0060455 Ga0501071_0060455_275_496 73
458 3300049589 Ga0501073_0093284 Ga0501073_0093284_313_534 73
459 3300049741 Ga0501079_0226637 Ga0501079_0226637_37_264 73
460 3300049742 Ga0501080_0005871 Ga0501080_0005871_9895_10116 73
461 3300049822 Ga0501035_0005602 Ga0501035_0005602_9854_10075 73
462 3300049823 Ga0501044_0021291 Ga0501044_0021291_5728_5949 73
463 3300050494 nmdc:mga06z11_233351_c1 nmdc:mga06z11_233351_c1_243_479 73
464 3300053159 Ga0500630_212903 Ga0500630_212903_161_388 73
465 3300005435 Ga0070714_100251451 Ga0070714_1002514512 74
466 3300005436 Ga0070713_100783548 Ga0070713_1007835482 74
467 3300006028 Ga0070717_10647106 Ga0070717_106471062 74
468 3300006353 Ga0075370_10512175 Ga0075370_105121752 74
469 3300013105 Ga0157369_11550829 Ga0157369_115508292 74
470 3300013307 Ga0157372_11079996 Ga0157372_110799962 74
471 3300025937 Ga0207669_10871387 Ga0207669_108713872 74
472 3300028381 Ga0268264_12544760 Ga0268264_125447601 74
473 3300035089 Ga0373944_0000077 Ga0373944_0000077_154_384 74
474 3300037068 Ga0373925_1245752 Ga0373925_1245752_132_362 74
475 3300042876 Ga0451577_0360951 Ga0451577_0360951_1044_1274 74
476 3300044712 Ga0453684_1498242 Ga0453684_1498242_98_328 74
477 3300045051 Ga0451576_1051167 Ga0451576_1051167_12_242 74
478 3300046457 Ga0495590_0000142 Ga0495590_0000142_22115_22345 74
479 3300047319 Ga0495674_1162484 Ga0495674_1162484_291_521 74
480 3300049591 Ga0501075_0409525 Ga0501075_0409525_241_474 74
481 3300050496 nmdc:mga07m45_622177_c1 nmdc:mga07m45_622177_c1_202_432 74
482 3300005347 Ga0070668_100001537 Ga0070668_1000015373 75
483 3300005355 Ga0070671_100294218 Ga0070671_1002942182 75
484 3300005367 Ga0070667_100746727 Ga0070667_1007467272 75
485 3300005435 Ga0070714_100131487 Ga0070714_1001314873 75
486 3300005435 Ga0070714_100262180 Ga0070714_1002621801 75
487 3300005435 Ga0070714_100315078 Ga0070714_1003150782 75
488 3300005436 Ga0070713_100052825 Ga0070713_1000528253 75
489 3300005436 Ga0070713_100936841 Ga0070713_1009368412 75
490 3300005437 Ga0070710_10219626 Ga0070710_102196262 75
491 3300005439 Ga0070711_100390132 Ga0070711_1003901322 75
492 3300005444 Ga0070694_100358186 Ga0070694_1003581862 75
493 3300005456 Ga0070678_100143013 Ga0070678_1001430133 75
494 3300005458 Ga0070681_10678629 Ga0070681_106786291 75
495 3300005467 Ga0070706_100048867 Ga0070706_1000488678 75
496 3300005468 Ga0070707_100044377 Ga0070707_1000443777 75
497 3300005471 Ga0070698_100010358 Ga0070698_10001035810 75
498 3300005536 Ga0070697_100615900 Ga0070697_1006159002 75
499 3300005549 Ga0070704_100821138 Ga0070704_1008211381 75
500 3300005617 Ga0068859_101407770 Ga0068859_1014077702 75
501 3300005719 Ga0068861_102700909 Ga0068861_1027009091 75
502 3300005844 Ga0068862_100079586 Ga0068862_1000795863 75
503 3300006028 Ga0070717_10629681 Ga0070717_106296812 75
504 3300006051 Ga0075364_10000319 Ga0075364_100003192 75
505 3300006175 Ga0070712_101482202 Ga0070712_1014822022 75
506 3300006931 Ga0097620_101407217 Ga0097620_1014072172 75
507 3300007076 Ga0075435_100203864 Ga0075435_1002038644 75
508 3300009098 Ga0105245_12622452 Ga0105245_126224522 75
509 3300009101 Ga0105247_10901630 Ga0105247_109016302 75
510 3300009174 Ga0105241_10609471 Ga0105241_106094712 75
511 3300009176 Ga0105242_11368600 Ga0105242_113686002 75
512 3300009545 Ga0105237_11035751 Ga0105237_110357511 75
513 3300013308 Ga0157375_10367893 Ga0157375_103678933 75
514 3300014325 Ga0163163_10787261 Ga0163163_107872612 75
515 3300021388 Ga0213875_10156232 Ga0213875_101562322 75
516 3300021441 Ga0213871_10318033 Ga0213871_103180331 75
517 3300025898 Ga0207692_10083028 Ga0207692_100830282 75
518 3300025898 Ga0207692_10193017 Ga0207692_101930172 75
519 3300025905 Ga0207685_10018699 Ga0207685_100186992 75
520 3300025906 Ga0207699_10024767 Ga0207699_100247672 75
521 3300025911 Ga0207654_11230431 Ga0207654_112304312 75
522 3300025912 Ga0207707_11302133 Ga0207707_113021332 75
523 3300025916 Ga0207663_10002596 Ga0207663_100025962 75
524 3300025916 Ga0207663_10141095 Ga0207663_101410952 75
525 3300025922 Ga0207646_10070154 Ga0207646_100701546 75
526 3300025928 Ga0207700_10118124 Ga0207700_101181243 75
527 3300025928 Ga0207700_10251023 Ga0207700_102510232 75
528 3300025928 Ga0207700_10425100 Ga0207700_104251003 75
529 3300025929 Ga0207664_10050661 Ga0207664_100506615 75
530 3300025929 Ga0207664_10057619 Ga0207664_100576194 75
531 3300025929 Ga0207664_11269803 Ga0207664_112698032 75
532 3300025929 Ga0207664_12020098 Ga0207664_120200982 75
533 3300025931 Ga0207644_10265936 Ga0207644_102659362 75
534 3300025972 Ga0207668_10002726 Ga0207668_100027267 75
535 3300026078 Ga0207702_10992056 Ga0207702_109920562 75
536 3300026121 Ga0207683_10082829 Ga0207683_100828293 75
537 3300028380 Ga0268265_10128320 Ga0268265_101283203 75
538 3300028381 Ga0268264_10529249 Ga0268264_105292492 75
539 3300028556 Ga0265337_1012858 Ga0265337_10128583 75
540 3300028573 Ga0265334_10066814 Ga0265334_100668142 75
541 3300028786 Ga0307517_10100813 Ga0307517_101008133 75
542 3300028794 Ga0307515_10267568 Ga0307515_102675682 75
543 3300028800 Ga0265338_10014544 Ga0265338_100145442 75
544 3300030522 Ga0307512_10065896 Ga0307512_100658965 75
545 3300031240 Ga0265320_10066844 Ga0265320_100668442 75
546 3300031247 Ga0265340_10046521 Ga0265340_100465212 75
547 3300031456 Ga0307513_10052583 Ga0307513_100525834 75
548 3300031456 Ga0307513_10137835 Ga0307513_101378354 75
549 3300031616 Ga0307508_10006260 Ga0307508_1000626012 75
550 3300031711 Ga0265314_10633917 Ga0265314_106339172 75
551 3300031712 Ga0265342_10396499 Ga0265342_103964992 75
552 3300031731 Ga0307405_10730310 Ga0307405_107303102 75
553 3300031731 Ga0307405_11427876 Ga0307405_114278761 75
554 3300031824 Ga0307413_10321075 Ga0307413_103210752 75
555 3300032002 Ga0307416_100326028 Ga0307416_1003260283 75
556 3300032005 Ga0307411_10399589 Ga0307411_103995892 75
557 3300032126 Ga0307415_100051999 Ga0307415_1000519993 75
558 3300034957 Ga0373938_0018605 Ga0373938_0018605_544_777 75
559 3300035088 Ga0373940_0025238 Ga0373940_0025238_1126_1359 75
560 3300035092 Ga0373952_0031345 Ga0373952_0031345_376_609 75
561 3300035112 Ga0373932_0021233 Ga0373932_0021233_50_283 75
562 3300035114 Ga0373939_0093425 Ga0373939_0093425_334_567 75
563 3300035115 Ga0373941_0031995 Ga0373941_0031995_223_456 75
564 3300035207 Ga0373942_0079692 Ga0373942_0079692_589_822 75
565 3300035242 Ga0373962_0050915 Ga0373962_0050915_489_722 75
566 3300037853 Ga0436364_0426719 Ga0436364_0426719_425_658 75
567 3300039438 Ga0436360_0757575 Ga0436360_0757575_320_553 75
568 3300044706 Ga0466964_0267678 Ga0466964_0267678_155_388 75
569 3300045836 Ga0466958_0461230 Ga0466958_0461230_576_809 75
570 3300045976 Ga0466967_0626685 Ga0466967_0626685_783_1016 75
571 3300046457 Ga0495590_0354702 Ga0495590_0354702_301_534 75
572 3300046460 Ga0495638_0161366 Ga0495638_0161366_609_842 75
573 3300046519 Ga0495632_0073382 Ga0495632_0073382_448_681 75
574 3300048903 Ga0496100_0334565 Ga0496100_0334565_823_1056 75
575 3300048904 Ga0496101_0181641 Ga0496101_0181641_1238_1471 75
576 3300048906 Ga0496103_0433247 Ga0496103_0433247_236_469 75
577 3300048907 Ga0496104_0824352 Ga0496104_0824352_571_804 75
578 3300048908 Ga0496105_0373456 Ga0496105_0373456_643_876 75
579 3300048909 Ga0496106_0620301 Ga0496106_0620301_566_799 75
580 3300048911 Ga0496108_0053263 Ga0496108_0053263_1625_1858 75
581 3300048912 Ga0496109_0293673 Ga0496109_0293673_791_1024 75
582 3300048914 Ga0496111_0275268 Ga0496111_0275268_285_518 75
583 3300048915 Ga0496112_0201159 Ga0496112_0201159_836_1069 75
584 3300048916 Ga0496113_0423361 Ga0496113_0423361_462_695 75
585 3300048917 Ga0496114_0955217 Ga0496114_0955217_232_465 75
586 3300048918 Ga0496115_0262684 Ga0496115_0262684_452_685 75
587 3300050513 nmdc:mga0rr50_1063637_c1 nmdc:mga0rr50_1063637_c1_74_307 75
588 3300053088 Ga0500644_0416076 Ga0500644_0416076_243_476 75
589 3300053090 Ga0500646_0000088 Ga0500646_0000088_11204_11437 75
590 3300053092 Ga0500583_0006793 Ga0500583_0006793_1182_1415 75
591 3300053098 Ga0500650_0347906 Ga0500650_0347906_141_374 75
592 3300053130 Ga0500642_0436365 Ga0500642_0436365_28_261 75
593 3300053131 Ga0500652_092173 Ga0500652_092173_498_731 75
594 3300053146 Ga0500588_0008410 Ga0500588_0008410_1866_2099 75
595 3300005343 Ga0070687_100462486 Ga0070687_1004624862 76
596 3300005347 Ga0070668_100308425 Ga0070668_1003084252 76
597 3300005456 Ga0070678_101354907 Ga0070678_1013549072 76
598 3300025918 Ga0207662_11254655 Ga0207662_112546552 76
599 3300025939 Ga0207665_11587826 Ga0207665_115878262 76
600 3300025972 Ga0207668_10553277 Ga0207668_105532772 76
601 3300026121 Ga0207683_11210987 Ga0207683_112109872 76
602 3300039450 Ga0436363_1235171 Ga0436363_1235171_237_476 76
603 3300048913 Ga0496110_0657889 Ga0496110_0657889_79_312 76
604 3300049823 Ga0501044_0084557 Ga0501044_0084557_2436_2681 76
605 3300005439 Ga0070711_100241133 Ga0070711_1002411332 77
606 3300006028 Ga0070717_10058801 Ga0070717_100588016 77
607 3300006173 Ga0070716_100005185 Ga0070716_1000051855 77
608 3300006175 Ga0070712_100014705 Ga0070712_1000147054 77
609 3300025898 Ga0207692_10441061 Ga0207692_104410612 77
610 3300025915 Ga0207693_10074932 Ga0207693_100749326 77
611 3300025916 Ga0207663_10178568 Ga0207663_101785682 77
612 3300025929 Ga0207664_10072930 Ga0207664_100729306 77
613 3300025939 Ga0207665_10005367 Ga0207665_100053679 77
614 3300028794 Ga0307515_10471046 Ga0307515_104710462 77
615 3300028794 Ga0307515_10703115 Ga0307515_107031152 77
616 3300037588 Ga0316581_0244265 Ga0316581_0244265_122_385 77
617 3300049573 Ga0501037_0473920 Ga0501037_0473920_334_573 77
618 3300049574 Ga0501038_0798481 Ga0501038_0798481_132_371 77
619 3300049583 Ga0501067_0236819 Ga0501067_0236819_221_460 77
620 3300049588 Ga0501072_0408326 Ga0501072_0408326_652_891 77
621 3300049589 Ga0501073_0011736 Ga0501073_0011736_5922_6161 77
622 3300049592 Ga0501076_1038267 Ga0501076_1038267_212_451 77
623 3300002737 JGI25162J39368_1000487 JGI25162J39368_100048712 78
624 3300002772 JGI25164J39214_1000242 JGI25164J39214_100024212 78
625 3300003214 JGI25165J46597_1000335 JGI25165J46597_100033512 78
626 3300003763 Ga0055529_1005418 Ga0055529_10054182 78
627 3300005327 Ga0070658_10325314 Ga0070658_103253141 78
628 3300005336 Ga0070680_100300281 Ga0070680_1003002813 78
629 3300005337 Ga0070682_100014692 Ga0070682_1000146924 78
630 3300005339 Ga0070660_100313967 Ga0070660_1003139672 78
631 3300005530 Ga0070679_100115113 Ga0070679_1001151131 78
632 3300005546 Ga0070696_100151789 Ga0070696_1001517892 78
633 3300005547 Ga0070693_100044703 Ga0070693_1000447032 78
634 3300005563 Ga0068855_100032327 Ga0068855_1000323272 78
635 3300005578 Ga0068854_100543281 Ga0068854_1005432812 78
636 3300005578 Ga0068854_101309118 Ga0068854_1013091182 78
637 3300009093 Ga0105240_10009760 Ga0105240_100097609 78
638 3300009174 Ga0105241_10331389 Ga0105241_103313893 78
639 3300009545 Ga0105237_10000105 Ga0105237_1000010593 78
640 3300009551 Ga0105238_10228496 Ga0105238_102284963 78
641 3300013105 Ga0157369_12193137 Ga0157369_121931372 78
642 3300013307 Ga0157372_10136012 Ga0157372_101360126 78
643 3300013307 Ga0157372_10587320 Ga0157372_105873203 78
644 3300015262 Ga0182007_10003704 Ga0182007_100037044 78
645 3300020070 Ga0206356_11054920 Ga0206356_110549207 78
646 3300020081 Ga0206354_11349434 Ga0206354_113494342 78
647 3300020082 Ga0206353_11672713 Ga0206353_116727132 78
648 3300025246 Ga0209646_1002600 Ga0209646_10026002 78
649 3300025250 Ga0209026_1000111 Ga0209026_100011124 78
650 3300025272 Ga0209455_1000211 Ga0209455_100021110 78
651 3300025912 Ga0207707_10459635 Ga0207707_104596352 78
652 3300025913 Ga0207695_10001623 Ga0207695_100016238 78
653 3300025914 Ga0207671_10004557 Ga0207671_1000455715 78
654 3300025917 Ga0207660_10283964 Ga0207660_102839641 78
655 3300025919 Ga0207657_10164681 Ga0207657_101646812 78
656 3300025921 Ga0207652_10030206 Ga0207652_100302063 78
657 3300025924 Ga0207694_10692513 Ga0207694_106925132 78
658 3300025949 Ga0207667_10297189 Ga0207667_102971892 78
659 3300025949 Ga0207667_11731711 Ga0207667_117317112 78
660 3300025981 Ga0207640_10257802 Ga0207640_102578022 78
661 3300026067 Ga0207678_10115363 Ga0207678_101153635 78
662 3300026067 Ga0207678_11930447 Ga0207678_119304471 78
663 3300026116 Ga0207674_11290391 Ga0207674_112903911 78
664 3300028800 Ga0265338_10428339 Ga0265338_104283392 78
665 3300031250 Ga0265331_10085819 Ga0265331_100858193 78
666 3300039450 Ga0436363_0434749 Ga0436363_0434749_200_445 78
667 3300049568 Ga0501031_0130426 Ga0501031_0130426_793_1044 78
668 3300049569 Ga0501032_0100594 Ga0501032_0100594_69_320 78
669 3300049570 Ga0501033_0004440 Ga0501033_0004440_4052_4303 78
670 3300049570 Ga0501033_0032102 Ga0501033_0032102_3521_3772 78
671 3300049571 Ga0501034_0662481 Ga0501034_0662481_167_418 78
672 3300049572 Ga0501036_0388556 Ga0501036_0388556_41_292 78
673 3300049573 Ga0501037_0238034 Ga0501037_0238034_131_382 78
674 3300049574 Ga0501038_0317914 Ga0501038_0317914_952_1203 78
675 3300049575 Ga0501039_0191013 Ga0501039_0191013_447_698 78
676 3300049576 Ga0501040_0270794 Ga0501040_0270794_670_921 78
677 3300049579 Ga0501043_0080171 Ga0501043_0080171_1475_1726 78
678 3300049580 Ga0501046_0092688 Ga0501046_0092688_611_862 78
679 3300049581 Ga0501047_0088657 Ga0501047_0088657_1615_1866 78
680 3300049582 Ga0501048_0075041 Ga0501048_0075041_1753_2004 78
681 3300049586 Ga0501070_0258622 Ga0501070_0258622_198_449 78
682 3300049589 Ga0501073_0082415 Ga0501073_0082415_1544_1795 78
683 3300049822 Ga0501035_0095557 Ga0501035_0095557_747_998 78
684 3300049823 Ga0501044_0196719 Ga0501044_0196719_1252_1503 78
685 3300049824 Ga0501045_0301488 Ga0501045_0301488_102_353 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

11

65

0.96

PF13560

HTH_31

Helix-turn-helix domain

7

65

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.9643 10 63
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9509 6 70
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9502 6 70
2lyk-assembly1.cif.gz_B noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) 0.941 6 70
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9393 8 70
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9745 7 70 1.10.260.40
2lykB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.941 6 70 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9366 10 63 1.10.260.40
3u3wB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.932 9 62 1.10.260.40
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9314 7 70 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A525HFM6-F1-model_v4 Transcriptional regulator 1.004 5 70 GO:0003677
AF-A0A6S6FY68-F1-model_v4 XRE family transcriptional regulator 1.001 6 70 GO:0003677
AF-A0A7G5HXA0-F1-model_v4 deleted 1.001 5 69
AF-A0A1I0DGC6-F1-model_v4 Putative transcriptional regulator 1 5 69 GO:0003677
AF-A0A1I2L6P6-F1-model_v4 Putative transcriptional regulator 0.9992 6 68 GO:0003677

Feature Viewer

pLDDT pTM Quality
88.6 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map