F475161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 685 | 388 | 673 | 75 |
Family's Representative Sequence
| Representative Sequence | 3300060353|Ga0501082_1811764|Ga0501082_1811764_16_282 |
| Length | 88 |
| Sequence | VAKPTRVTNRIGELRAAIGLTQADLGDRIGVTRQTVNAIEGGKYSPSLDVAFRIAGVLGTSLEVVFQYDEVGRRARRSSAPDGEPAGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 3 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 4 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 5 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 6 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 7 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 8 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 9 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 10 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 11 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 12 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 202 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 203 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 204 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 205 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 258 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 259 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 260 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 261 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 265 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 271 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 272 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 273 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 276 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 277 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 278 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 279 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 280 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 281 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 282 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 283 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 290 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 367 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 369 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 370 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 371 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 372 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 374 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 376 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 381 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 384 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.81 |
| Metatranscriptomes | 0.44 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.6 |
| Nodule | 0 |
| Rhizoplane | 5.55 |
| Rhizosphere | 72.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000487 | 3300002737 | Bacteria | 30308 |
| 2 | JGI25162J39368_1001151 | 3300002737 | Bacteria | 15806 |
| 3 | JGI25162J39368_1008339 | 3300002737 | Bacteria | 1497 |
| 4 | JGI25164J39214_1000193 | 3300002772 | Bacteria | 52696 |
| 5 | JGI25164J39214_1000242 | 3300002772 | Bacteria | 41726 |
| 6 | JGI25164J39214_1001125 | 3300002772 | Bacteria | 7616 |
| 7 | JGI25406J46586_10008343 | 3300003203 | Bacteria | 4698 |
| 8 | JGI25165J46597_1000269 | 3300003214 | Bacteria | 67008 |
| 9 | JGI25165J46597_1000335 | 3300003214 | Bacteria | 55465 |
| 10 | JGI25165J46597_1002787 | 3300003214 | Bacteria | 5070 |
| 11 | JGI25160J50197_1058139 | 3300003354 | Bacteria | 784 |
| 12 | Ga0055529_1005418 | 3300003763 | Bacteria | 1849 |
| 13 | Ga0055526_1000961 | 3300003771 | Bacteria | 21281 |
| 14 | Ga0055526_1067220 | 3300003771 | Bacteria | 740 |
| 15 | Ga0055536_1000881 | 3300003781 | Bacteria | 19520 |
| 16 | Ga0055534_1012732 | 3300003784 | Bacteria | 1649 |
| 17 | Ga0055530_10000083 | 3300003791 | Bacteria | 81772 |
| 18 | Ga0055530_10033459 | 3300003791 | Bacteria | 1325 |
| 19 | Ga0055530_10036936 | 3300003791 | Bacteria | 1226 |
| 20 | Ga0055531_10000316 | 3300003794 | Bacteria | 47444 |
| 21 | Ga0055531_10000471 | 3300003794 | Bacteria | 37281 |
| 22 | Ga0065707_10970854 | 3300005295 | Bacteria | 547 |
| 23 | Ga0070658_10325314 | 3300005327 | Bacteria | 1313 |
| 24 | Ga0070658_10639602 | 3300005327 | Bacteria | 923 |
| 25 | Ga0070676_10647695 | 3300005328 | Bacteria | 766 |
| 26 | Ga0070683_100510778 | 3300005329 | Bacteria | 1148 |
| 27 | Ga0068869_100346121 | 3300005334 | Bacteria | 1211 |
| 28 | Ga0068869_101009531 | 3300005334 | Bacteria | 725 |
| 29 | Ga0068869_101591834 | 3300005334 | Bacteria | 582 |
| 30 | Ga0070680_100300281 | 3300005336 | Bacteria | 1362 |
| 31 | Ga0070682_100014692 | 3300005337 | Bacteria | 4527 |
| 32 | Ga0070682_100198731 | 3300005337 | Bacteria | 1413 |
| 33 | Ga0070682_100401525 | 3300005337 | Bacteria | 1037 |
| 34 | Ga0070682_100922759 | 3300005337 | Bacteria | 719 |
| 35 | Ga0070682_101217754 | 3300005337 | Bacteria | 636 |
| 36 | Ga0070660_100313967 | 3300005339 | Bacteria | 1286 |
| 37 | Ga0070687_100462486 | 3300005343 | Bacteria | 846 |
| 38 | Ga0070668_100001537 | 3300005347 | Bacteria | 16641 |
| 39 | Ga0070668_100308425 | 3300005347 | Bacteria | 1329 |
| 40 | Ga0070675_101128337 | 3300005354 | Bacteria | 721 |
| 41 | Ga0070675_102085755 | 3300005354 | Bacteria | 523 |
| 42 | Ga0070671_100294218 | 3300005355 | Bacteria | 1382 |
| 43 | Ga0070674_100215252 | 3300005356 | Bacteria | 1492 |
| 44 | Ga0070659_100272920 | 3300005366 | Bacteria | 1405 |
| 45 | Ga0070667_100746727 | 3300005367 | Bacteria | 907 |
| 46 | Ga0070709_10479550 | 3300005434 | Bacteria | 941 |
| 47 | Ga0070714_100131487 | 3300005435 | Bacteria | 2237 |
| 48 | Ga0070714_100251451 | 3300005435 | Bacteria | 1634 |
| 49 | Ga0070714_100262180 | 3300005435 | Bacteria | 1601 |
| 50 | Ga0070714_100315078 | 3300005435 | Bacteria | 1462 |
| 51 | Ga0070714_100667222 | 3300005435 | Bacteria | 1002 |
| 52 | Ga0070714_102058694 | 3300005435 | Bacteria | 556 |
| 53 | Ga0070713_100052825 | 3300005436 | Bacteria | 3365 |
| 54 | Ga0070713_100783548 | 3300005436 | Bacteria | 913 |
| 55 | Ga0070713_100936841 | 3300005436 | Bacteria | 834 |
| 56 | Ga0070713_102038550 | 3300005436 | Bacteria | 556 |
| 57 | Ga0070710_10219626 | 3300005437 | Bacteria | 1209 |
| 58 | Ga0070711_100241133 | 3300005439 | Bacteria | 1413 |
| 59 | Ga0070711_100390132 | 3300005439 | Bacteria | 1128 |
| 60 | Ga0070711_101433367 | 3300005439 | Bacteria | 601 |
| 61 | Ga0070694_100358186 | 3300005444 | Bacteria | 1132 |
| 62 | Ga0070663_100979742 | 3300005455 | Bacteria | 734 |
| 63 | Ga0070663_101953464 | 3300005455 | Bacteria | 527 |
| 64 | Ga0070678_100143013 | 3300005456 | Bacteria | 1917 |
| 65 | Ga0070678_100613431 | 3300005456 | Bacteria | 972 |
| 66 | Ga0070678_101354907 | 3300005456 | Bacteria | 663 |
| 67 | Ga0070681_10659586 | 3300005458 | Bacteria | 961 |
| 68 | Ga0070681_10678629 | 3300005458 | Bacteria | 946 |
| 69 | Ga0068867_101404169 | 3300005459 | Bacteria | 647 |
| 70 | Ga0070685_11208280 | 3300005466 | Bacteria | 575 |
| 71 | Ga0070706_100048867 | 3300005467 | Bacteria | 3904 |
| 72 | Ga0070707_100044377 | 3300005468 | Bacteria | 4256 |
| 73 | Ga0070698_100010358 | 3300005471 | Bacteria | 9955 |
| 74 | Ga0070679_100115113 | 3300005530 | Bacteria | 2674 |
| 75 | Ga0070684_101773228 | 3300005535 | Unclassified | 582 |
| 76 | Ga0070697_100615900 | 3300005536 | Bacteria | 955 |
| 77 | Ga0068853_100049917 | 3300005539 | Bacteria | 3598 |
| 78 | Ga0068853_100273709 | 3300005539 | Bacteria | 1555 |
| 79 | Ga0068853_100332802 | 3300005539 | Bacteria | 1409 |
| 80 | Ga0068853_100438875 | 3300005539 | Bacteria | 1226 |
| 81 | Ga0068853_100893245 | 3300005539 | Bacteria | 853 |
| 82 | Ga0070672_100457746 | 3300005543 | Bacteria | 1099 |
| 83 | Ga0070672_100739513 | 3300005543 | Bacteria | 863 |
| 84 | Ga0070696_100151789 | 3300005546 | Bacteria | 1701 |
| 85 | Ga0070693_100044703 | 3300005547 | Bacteria | 2506 |
| 86 | Ga0070665_100000078 | 3300005548 | Bacteria | 188101 |
| 87 | Ga0070704_100821138 | 3300005549 | Bacteria | 832 |
| 88 | Ga0068855_100032327 | 3300005563 | Bacteria | 6248 |
| 89 | Ga0068855_100526038 | 3300005563 | Bacteria | 1282 |
| 90 | Ga0068857_100222158 | 3300005577 | Bacteria | 1726 |
| 91 | Ga0068854_100149362 | 3300005578 | Bacteria | 1800 |
| 92 | Ga0068854_100543281 | 3300005578 | Bacteria | 984 |
| 93 | Ga0068854_100942091 | 3300005578 | Bacteria | 761 |
| 94 | Ga0068854_101294313 | 3300005578 | Bacteria | 656 |
| 95 | Ga0068854_101309118 | 3300005578 | Bacteria | 652 |
| 96 | Ga0068856_100329500 | 3300005614 | Bacteria | 1544 |
| 97 | Ga0068852_100167782 | 3300005616 | Bacteria | 2055 |
| 98 | Ga0068852_102798712 | 3300005616 | Bacteria | 506 |
| 99 | Ga0068859_101407770 | 3300005617 | Bacteria | 769 |
| 100 | Ga0068859_101535234 | 3300005617 | Bacteria | 735 |
| 101 | Ga0068864_101523652 | 3300005618 | Bacteria | 672 |
| 102 | Ga0068861_102700909 | 3300005719 | Bacteria | 501 |
| 103 | Ga0068851_10156768 | 3300005834 | Bacteria | 1248 |
| 104 | Ga0068851_10872225 | 3300005834 | Bacteria | 562 |
| 105 | Ga0068860_100264234 | 3300005843 | Bacteria | 1678 |
| 106 | Ga0068862_100079586 | 3300005844 | Bacteria | 2841 |
| 107 | Ga0081455_10690286 | 3300005937 | Bacteria | 652 |
| 108 | Ga0081538_10010782 | 3300005981 | Bacteria | 7468 |
| 109 | Ga0081538_10014870 | 3300005981 | Bacteria | 6064 |
| 110 | Ga0081540_1333233 | 3300005983 | Bacteria | 520 |
| 111 | Ga0081539_10000031 | 3300005985 | Bacteria | 313232 |
| 112 | Ga0081539_10005625 | 3300005985 | Bacteria | 12608 |
| 113 | Ga0070717_10058801 | 3300006028 | Bacteria | 3179 |
| 114 | Ga0070717_10373130 | 3300006028 | Bacteria | 1278 |
| 115 | Ga0070717_10629681 | 3300006028 | Bacteria | 973 |
| 116 | Ga0070717_10647106 | 3300006028 | Bacteria | 959 |
| 117 | Ga0070717_11174617 | 3300006028 | Bacteria | 698 |
| 118 | Ga0075365_10087464 | 3300006038 | Bacteria | 2119 |
| 119 | Ga0075363_100212596 | 3300006048 | Bacteria | 1107 |
| 120 | Ga0075364_10000319 | 3300006051 | Bacteria | 23673 |
| 121 | Ga0070715_10342781 | 3300006163 | Bacteria | 813 |
| 122 | Ga0070716_100005185 | 3300006173 | Bacteria | 6300 |
| 123 | Ga0070712_100014705 | 3300006175 | Bacteria | 5025 |
| 124 | Ga0070712_100213341 | 3300006175 | Bacteria | 1524 |
| 125 | Ga0070712_101482202 | 3300006175 | Bacteria | 593 |
| 126 | Ga0075367_10352424 | 3300006178 | Bacteria | 929 |
| 127 | Ga0097621_100136148 | 3300006237 | Bacteria | 2095 |
| 128 | Ga0097621_101819940 | 3300006237 | Bacteria | 581 |
| 129 | Ga0075370_10512175 | 3300006353 | Bacteria | 725 |
| 130 | Ga0075370_11025219 | 3300006353 | Bacteria | 506 |
| 131 | Ga0068871_101376272 | 3300006358 | Bacteria | 665 |
| 132 | Ga0068871_101418701 | 3300006358 | Bacteria | 655 |
| 133 | Ga0075428_100060805 | 3300006844 | Bacteria | 4137 |
| 134 | Ga0075428_100296028 | 3300006844 | Bacteria | 1740 |
| 135 | Ga0075428_101146007 | 3300006844 | Bacteria | 820 |
| 136 | Ga0075430_100281133 | 3300006846 | Bacteria | 1377 |
| 137 | Ga0075430_100281285 | 3300006846 | Bacteria | 1376 |
| 138 | Ga0075430_100586297 | 3300006846 | Bacteria | 920 |
| 139 | Ga0075431_100104479 | 3300006847 | Bacteria | 2923 |
| 140 | Ga0075429_101623208 | 3300006880 | Bacteria | 562 |
| 141 | Ga0097620_101407217 | 3300006931 | Bacteria | 769 |
| 142 | Ga0097620_101535158 | 3300006931 | Bacteria | 735 |
| 143 | Ga0075435_100203864 | 3300007076 | Bacteria | 1676 |
| 144 | Ga0105240_10009760 | 3300009093 | Bacteria | 13555 |
| 145 | Ga0105240_12744205 | 3300009093 | Bacteria | 507 |
| 146 | Ga0111539_12062175 | 3300009094 | Bacteria | 662 |
| 147 | Ga0105245_10825292 | 3300009098 | Bacteria | 966 |
| 148 | Ga0105245_11145009 | 3300009098 | Bacteria | 825 |
| 149 | Ga0105245_12622452 | 3300009098 | Bacteria | 557 |
| 150 | Ga0105247_10901630 | 3300009101 | Bacteria | 683 |
| 151 | Ga0114129_11287969 | 3300009147 | Bacteria | 906 |
| 152 | Ga0105243_10087416 | 3300009148 | Bacteria | 2558 |
| 153 | Ga0105243_12374845 | 3300009148 | Bacteria | 568 |
| 154 | Ga0105243_13051614 | 3300009148 | Bacteria | 507 |
| 155 | Ga0105241_10306021 | 3300009174 | Bacteria | 1365 |
| 156 | Ga0105241_10331389 | 3300009174 | Bacteria | 1316 |
| 157 | Ga0105241_10609471 | 3300009174 | Bacteria | 987 |
| 158 | Ga0105242_11368600 | 3300009176 | Bacteria | 734 |
| 159 | Ga0105248_13109645 | 3300009177 | Bacteria | 528 |
| 160 | Ga0105237_10000105 | 3300009545 | Bacteria | 118218 |
| 161 | Ga0105237_11035751 | 3300009545 | Bacteria | 827 |
| 162 | Ga0105237_12230094 | 3300009545 | Bacteria | 557 |
| 163 | Ga0105238_10228496 | 3300009551 | Bacteria | 1838 |
| 164 | Ga0105238_10406366 | 3300009551 | Bacteria | 1355 |
| 165 | Ga0105238_11746619 | 3300009551 | Bacteria | 654 |
| 166 | Ga0105249_11315807 | 3300009553 | Bacteria | 794 |
| 167 | Ga0105239_11030265 | 3300010375 | Bacteria | 947 |
| 168 | Ga0105246_10335082 | 3300011119 | Bacteria | 1234 |
| 169 | Ga0157373_11268285 | 3300013100 | Bacteria | 557 |
| 170 | Ga0157371_10228588 | 3300013102 | Bacteria | 1337 |
| 171 | Ga0157369_10839774 | 3300013105 | Bacteria | 943 |
| 172 | Ga0157369_11550829 | 3300013105 | Bacteria | 674 |
| 173 | Ga0157369_12193137 | 3300013105 | Bacteria | 560 |
| 174 | Ga0157374_11836986 | 3300013296 | Bacteria | 631 |
| 175 | Ga0157374_12744168 | 3300013296 | Bacteria | 520 |
| 176 | Ga0157374_12981672 | 3300013296 | Bacteria | 500 |
| 177 | Ga0157378_10451454 | 3300013297 | Bacteria | 1276 |
| 178 | Ga0163162_13391211 | 3300013306 | Bacteria | 509 |
| 179 | Ga0157372_10136012 | 3300013307 | Bacteria | 2830 |
| 180 | Ga0157372_10477147 | 3300013307 | Bacteria | 1454 |
| 181 | Ga0157372_10587320 | 3300013307 | Bacteria | 1298 |
| 182 | Ga0157372_11079996 | 3300013307 | Bacteria | 929 |
| 183 | Ga0157375_10367893 | 3300013308 | Bacteria | 1604 |
| 184 | Ga0157375_10646286 | 3300013308 | Bacteria | 1214 |
| 185 | Ga0157375_11298440 | 3300013308 | Bacteria | 855 |
| 186 | Ga0163163_10537637 | 3300014325 | Bacteria | 1231 |
| 187 | Ga0163163_10787261 | 3300014325 | Bacteria | 1014 |
| 188 | Ga0163163_10822956 | 3300014325 | Bacteria | 992 |
| 189 | Ga0163163_12223590 | 3300014325 | Bacteria | 608 |
| 190 | Ga0157377_10919125 | 3300014745 | Bacteria | 656 |
| 191 | Ga0182007_10003704 | 3300015262 | Bacteria | 7145 |
| 192 | Ga0163161_12118946 | 3300017792 | Bacteria | 500 |
| 193 | Ga0206356_11054920 | 3300020070 | Bacteria | 3228 |
| 194 | Ga0206354_11349434 | 3300020081 | Bacteria | 1348 |
| 195 | Ga0206353_11672713 | 3300020082 | Bacteria | 1532 |
| 196 | Ga0213876_10002639 | 3300021384 | Bacteria | 10477 |
| 197 | Ga0213875_10156232 | 3300021388 | Bacteria | 1070 |
| 198 | Ga0213871_10318033 | 3300021441 | Bacteria | 505 |
| 199 | Ga0207427_100054 | 3300025231 | Bacteria | 216315 |
| 200 | Ga0207427_100117 | 3300025231 | Bacteria | 102251 |
| 201 | Ga0207427_100178 | 3300025231 | Bacteria | 67956 |
| 202 | Ga0209437_100240 | 3300025233 | Bacteria | 89740 |
| 203 | Ga0209437_100304 | 3300025233 | Bacteria | 67955 |
| 204 | Ga0209437_100642 | 3300025233 | Bacteria | 20416 |
| 205 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 206 | Ga0207425_1057180 | 3300025245 | Bacteria | 696 |
| 207 | Ga0209646_1002600 | 3300025246 | Bacteria | 3895 |
| 208 | Ga0209026_1000111 | 3300025250 | Bacteria | 140599 |
| 209 | Ga0209129_1000977 | 3300025258 | Bacteria | 17189 |
| 210 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 211 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 212 | Ga0209233_1000287 | 3300025261 | Bacteria | 67956 |
| 213 | Ga0209565_1001163 | 3300025263 | Bacteria | 12632 |
| 214 | Ga0209565_1052632 | 3300025263 | Bacteria | 726 |
| 215 | Ga0209455_1000211 | 3300025272 | Bacteria | 82660 |
| 216 | Ga0209673_1026813 | 3300025273 | Bacteria | 1885 |
| 217 | Ga0209675_1000190 | 3300025291 | Bacteria | 67514 |
| 218 | Ga0209676_1000133 | 3300025292 | Bacteria | 184430 |
| 219 | Ga0209676_1006028 | 3300025292 | Bacteria | 6115 |
| 220 | Ga0209676_1012522 | 3300025292 | Bacteria | 3325 |
| 221 | Ga0209676_1019508 | 3300025292 | Bacteria | 2332 |
| 222 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 223 | Ga0209025_1010719 | 3300025294 | Bacteria | 6165 |
| 224 | Ga0209025_1148152 | 3300025294 | Bacteria | 652 |
| 225 | Ga0209564_1000622 | 3300025295 | Bacteria | 53970 |
| 226 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 227 | Ga0209758_1049652 | 3300025297 | Bacteria | 1479 |
| 228 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 229 | Ga0209050_1000067 | 3300025298 | Bacteria | 304206 |
| 230 | Ga0209050_1001738 | 3300025298 | Bacteria | 21673 |
| 231 | Ga0209050_1010590 | 3300025298 | Bacteria | 4516 |
| 232 | Ga0209050_1012591 | 3300025298 | Bacteria | 3859 |
| 233 | Ga0207426_1036225 | 3300025302 | Bacteria | 1570 |
| 234 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 235 | Ga0209257_1000132 | 3300025304 | Bacteria | 210870 |
| 236 | Ga0209257_1001893 | 3300025304 | Bacteria | 22618 |
| 237 | Ga0209257_1001973 | 3300025304 | Bacteria | 22086 |
| 238 | Ga0209257_1002895 | 3300025304 | Bacteria | 15900 |
| 239 | Ga0207697_10559018 | 3300025315 | Bacteria | 503 |
| 240 | Ga0207692_10083028 | 3300025898 | Bacteria | 1718 |
| 241 | Ga0207692_10193017 | 3300025898 | Bacteria | 1193 |
| 242 | Ga0207692_10441061 | 3300025898 | Bacteria | 818 |
| 243 | Ga0207647_10411857 | 3300025904 | Bacteria | 761 |
| 244 | Ga0207685_10018699 | 3300025905 | Bacteria | 2268 |
| 245 | Ga0207699_10024767 | 3300025906 | Bacteria | 3285 |
| 246 | Ga0207699_10111832 | 3300025906 | Bacteria | 1752 |
| 247 | Ga0207645_10116341 | 3300025907 | Bacteria | 1733 |
| 248 | Ga0207705_10367377 | 3300025909 | Bacteria | 1110 |
| 249 | Ga0207705_11066321 | 3300025909 | Bacteria | 623 |
| 250 | Ga0207654_11230431 | 3300025911 | Bacteria | 546 |
| 251 | Ga0207707_10459635 | 3300025912 | Bacteria | 1089 |
| 252 | Ga0207707_10751055 | 3300025912 | Bacteria | 816 |
| 253 | Ga0207707_11302133 | 3300025912 | Bacteria | 584 |
| 254 | Ga0207695_10001623 | 3300025913 | Bacteria | 36467 |
| 255 | Ga0207671_10004557 | 3300025914 | Bacteria | 13165 |
| 256 | Ga0207693_10074932 | 3300025915 | Bacteria | 2650 |
| 257 | Ga0207663_10002596 | 3300025916 | Bacteria | 8691 |
| 258 | Ga0207663_10141095 | 3300025916 | Bacteria | 1679 |
| 259 | Ga0207663_10178568 | 3300025916 | Bacteria | 1514 |
| 260 | Ga0207660_10283964 | 3300025917 | Bacteria | 1314 |
| 261 | Ga0207662_11254655 | 3300025918 | Bacteria | 527 |
| 262 | Ga0207657_10035367 | 3300025919 | Bacteria | 4480 |
| 263 | Ga0207657_10164681 | 3300025919 | Bacteria | 1799 |
| 264 | Ga0207649_10881004 | 3300025920 | Bacteria | 701 |
| 265 | Ga0207649_11401016 | 3300025920 | Bacteria | 553 |
| 266 | Ga0207652_10030206 | 3300025921 | Bacteria | 4536 |
| 267 | Ga0207646_10070154 | 3300025922 | Bacteria | 3130 |
| 268 | Ga0207694_10692513 | 3300025924 | Bacteria | 859 |
| 269 | Ga0207694_11238840 | 3300025924 | Bacteria | 631 |
| 270 | Ga0207694_11578562 | 3300025924 | Bacteria | 553 |
| 271 | Ga0207650_10781690 | 3300025925 | Bacteria | 809 |
| 272 | Ga0207687_10775048 | 3300025927 | Bacteria | 817 |
| 273 | Ga0207700_10118124 | 3300025928 | Bacteria | 2145 |
| 274 | Ga0207700_10251023 | 3300025928 | Bacteria | 1511 |
| 275 | Ga0207700_10425100 | 3300025928 | Bacteria | 1168 |
| 276 | Ga0207664_10050661 | 3300025929 | Bacteria | 3275 |
| 277 | Ga0207664_10057619 | 3300025929 | Bacteria | 3088 |
| 278 | Ga0207664_10072930 | 3300025929 | Bacteria | 2769 |
| 279 | Ga0207664_11269803 | 3300025929 | Bacteria | 655 |
| 280 | Ga0207664_12020098 | 3300025929 | Bacteria | 500 |
| 281 | Ga0207644_10265936 | 3300025931 | Bacteria | 1373 |
| 282 | Ga0207644_10617090 | 3300025931 | Bacteria | 901 |
| 283 | Ga0207690_10741930 | 3300025932 | Bacteria | 809 |
| 284 | Ga0207709_10700985 | 3300025935 | Bacteria | 810 |
| 285 | Ga0207669_10074994 | 3300025937 | Bacteria | 2142 |
| 286 | Ga0207669_10264549 | 3300025937 | Bacteria | 1288 |
| 287 | Ga0207669_10871387 | 3300025937 | Bacteria | 751 |
| 288 | Ga0207704_10362856 | 3300025938 | Bacteria | 1131 |
| 289 | Ga0207665_10005367 | 3300025939 | Bacteria | 8557 |
| 290 | Ga0207665_11587826 | 3300025939 | Bacteria | 519 |
| 291 | Ga0207691_10079523 | 3300025940 | Bacteria | 2951 |
| 292 | Ga0207711_11572865 | 3300025941 | Bacteria | 601 |
| 293 | Ga0207661_11125549 | 3300025944 | Bacteria | 723 |
| 294 | Ga0207661_11728885 | 3300025944 | Bacteria | 571 |
| 295 | Ga0207679_10465506 | 3300025945 | Bacteria | 1123 |
| 296 | Ga0207667_10297189 | 3300025949 | Bacteria | 1650 |
| 297 | Ga0207667_11731711 | 3300025949 | Bacteria | 591 |
| 298 | Ga0207668_10002726 | 3300025972 | Bacteria | 10331 |
| 299 | Ga0207668_10122041 | 3300025972 | Bacteria | 1975 |
| 300 | Ga0207668_10553277 | 3300025972 | Bacteria | 997 |
| 301 | Ga0207640_10199242 | 3300025981 | Bacteria | 1516 |
| 302 | Ga0207640_10257802 | 3300025981 | Bacteria | 1357 |
| 303 | Ga0207677_10526855 | 3300026023 | Bacteria | 1026 |
| 304 | Ga0207639_10194018 | 3300026041 | Bacteria | 1737 |
| 305 | Ga0207639_10239950 | 3300026041 | Bacteria | 1575 |
| 306 | Ga0207639_10319783 | 3300026041 | Bacteria | 1377 |
| 307 | Ga0207639_10374248 | 3300026041 | Bacteria | 1277 |
| 308 | Ga0207678_10115363 | 3300026067 | Bacteria | 2291 |
| 309 | Ga0207678_10351367 | 3300026067 | Bacteria | 1271 |
| 310 | Ga0207678_11930447 | 3300026067 | Bacteria | 515 |
| 311 | Ga0207708_10873619 | 3300026075 | Unclassified | 777 |
| 312 | Ga0207702_10461881 | 3300026078 | Bacteria | 1233 |
| 313 | Ga0207702_10992056 | 3300026078 | Bacteria | 833 |
| 314 | Ga0207648_10152652 | 3300026089 | Bacteria | 2038 |
| 315 | Ga0207676_11784730 | 3300026095 | Bacteria | 614 |
| 316 | Ga0207676_12320614 | 3300026095 | Bacteria | 534 |
| 317 | Ga0207674_10237339 | 3300026116 | Bacteria | 1770 |
| 318 | Ga0207674_11290391 | 3300026116 | Bacteria | 700 |
| 319 | Ga0207675_100859877 | 3300026118 | Bacteria | 922 |
| 320 | Ga0207683_10078463 | 3300026121 | Bacteria | 2926 |
| 321 | Ga0207683_10082829 | 3300026121 | Bacteria | 2851 |
| 322 | Ga0207683_11210987 | 3300026121 | Bacteria | 700 |
| 323 | Ga0207683_11591408 | 3300026121 | Bacteria | 603 |
| 324 | Ga0207698_10093412 | 3300026142 | Bacteria | 2470 |
| 325 | Ga0207698_10234988 | 3300026142 | Bacteria | 1666 |
| 326 | Ga0207698_11226901 | 3300026142 | Bacteria | 764 |
| 327 | Ga0207698_11503320 | 3300026142 | Bacteria | 689 |
| 328 | Ga0209974_10458078 | 3300027876 | Bacteria | 507 |
| 329 | Ga0268266_10000131 | 3300028379 | Bacteria | 146628 |
| 330 | Ga0268266_10191605 | 3300028379 | Bacteria | 1867 |
| 331 | Ga0268266_10582547 | 3300028379 | Bacteria | 1074 |
| 332 | Ga0268265_10128320 | 3300028380 | Bacteria | 2103 |
| 333 | Ga0268264_10011270 | 3300028381 | Bacteria | 7387 |
| 334 | Ga0268264_10529249 | 3300028381 | Bacteria | 1153 |
| 335 | Ga0268264_12544760 | 3300028381 | Bacteria | 517 |
| 336 | Ga0265337_1010536 | 3300028556 | Bacteria | 3235 |
| 337 | Ga0265337_1012858 | 3300028556 | Bacteria | 2829 |
| 338 | Ga0265334_10066814 | 3300028573 | Bacteria | 1345 |
| 339 | Ga0307517_10100813 | 3300028786 | Bacteria | 2278 |
| 340 | Ga0307515_10131481 | 3300028794 | Bacteria | 2753 |
| 341 | Ga0307515_10266044 | 3300028794 | Bacteria | 1443 |
| 342 | Ga0307515_10267568 | 3300028794 | Bacteria | 1435 |
| 343 | Ga0307515_10471046 | 3300028794 | Bacteria | 869 |
| 344 | Ga0307515_10703115 | 3300028794 | Unclassified | 627 |
| 345 | Ga0307515_10739082 | 3300028794 | Bacteria | 602 |
| 346 | Ga0265338_10014544 | 3300028800 | Bacteria | 8744 |
| 347 | Ga0265338_10428339 | 3300028800 | Unclassified | 939 |
| 348 | Ga0307512_10065896 | 3300030522 | Bacteria | 2740 |
| 349 | Ga0316177_1074352 | 3300030731 | Bacteria | 11019 |
| 350 | Ga0314311_1196854 | 3300030733 | Bacteria | 1018 |
| 351 | Ga0316179_1070522 | 3300030734 | Bacteria | 666 |
| 352 | Ga0316180_1192092 | 3300030736 | Bacteria | 858 |
| 353 | Ga0265332_10038706 | 3300031238 | Bacteria | 2066 |
| 354 | Ga0265320_10066844 | 3300031240 | Bacteria | 1703 |
| 355 | Ga0265340_10046521 | 3300031247 | Bacteria | 2116 |
| 356 | Ga0265331_10085819 | 3300031250 | Bacteria | 1458 |
| 357 | Ga0307513_10039349 | 3300031456 | Bacteria | 5242 |
| 358 | Ga0307513_10052583 | 3300031456 | Bacteria | 4385 |
| 359 | Ga0307513_10057618 | 3300031456 | Bacteria | 4137 |
| 360 | Ga0307513_10137835 | 3300031456 | Bacteria | 2372 |
| 361 | Ga0307513_10404867 | 3300031456 | Bacteria | 1098 |
| 362 | Ga0307508_10000982 | 3300031616 | Bacteria | 33131 |
| 363 | Ga0307508_10006260 | 3300031616 | Bacteria | 11216 |
| 364 | Ga0307508_10156710 | 3300031616 | Bacteria | 1881 |
| 365 | Ga0307514_10058419 | 3300031649 | Bacteria | 2950 |
| 366 | Ga0307514_10455589 | 3300031649 | Bacteria | 627 |
| 367 | Ga0265314_10633917 | 3300031711 | Bacteria | 547 |
| 368 | Ga0265342_10396499 | 3300031712 | Bacteria | 713 |
| 369 | Ga0316576_10568221 | 3300031727 | Bacteria | 830 |
| 370 | Ga0307405_10004380 | 3300031731 | Bacteria | 6666 |
| 371 | Ga0307405_10730310 | 3300031731 | Bacteria | 823 |
| 372 | Ga0307405_11200961 | 3300031731 | Bacteria | 656 |
| 373 | Ga0307405_11427876 | 3300031731 | Bacteria | 606 |
| 374 | Ga0307405_11726390 | 3300031731 | Bacteria | 555 |
| 375 | Ga0307413_10321075 | 3300031824 | Bacteria | 1183 |
| 376 | Ga0307413_10632019 | 3300031824 | Bacteria | 880 |
| 377 | Ga0307413_11598422 | 3300031824 | Bacteria | 579 |
| 378 | Ga0307518_10000363 | 3300031838 | Bacteria | 34524 |
| 379 | Ga0307410_10276253 | 3300031852 | Bacteria | 1316 |
| 380 | Ga0307406_10064232 | 3300031901 | Bacteria | 2381 |
| 381 | Ga0307406_10357785 | 3300031901 | Bacteria | 1143 |
| 382 | Ga0307406_10504645 | 3300031901 | Bacteria | 981 |
| 383 | Ga0307406_10753036 | 3300031901 | Bacteria | 818 |
| 384 | Ga0307406_11105207 | 3300031901 | Bacteria | 685 |
| 385 | Ga0307406_11519107 | 3300031901 | Bacteria | 590 |
| 386 | Ga0307406_11609747 | 3300031901 | Bacteria | 574 |
| 387 | Ga0307407_10030591 | 3300031903 | Bacteria | 2906 |
| 388 | Ga0307412_10340526 | 3300031911 | Bacteria | 1200 |
| 389 | Ga0307409_100001766 | 3300031995 | Bacteria | 10925 |
| 390 | Ga0307409_100169353 | 3300031995 | Bacteria | 1921 |
| 391 | Ga0307409_100405283 | 3300031995 | Bacteria | 1304 |
| 392 | Ga0307409_100460800 | 3300031995 | Bacteria | 1229 |
| 393 | Ga0307409_100760076 | 3300031995 | Bacteria | 974 |
| 394 | Ga0307416_100001803 | 3300032002 | Bacteria | 11893 |
| 395 | Ga0307416_100093115 | 3300032002 | Bacteria | 2595 |
| 396 | Ga0307416_100326028 | 3300032002 | Bacteria | 1541 |
| 397 | Ga0307416_101698001 | 3300032002 | Bacteria | 736 |
| 398 | Ga0307416_103348917 | 3300032002 | Bacteria | 536 |
| 399 | Ga0307416_103893144 | 3300032002 | Bacteria | 500 |
| 400 | Ga0307414_10739222 | 3300032004 | Bacteria | 893 |
| 401 | Ga0307411_10095633 | 3300032005 | Bacteria | 2086 |
| 402 | Ga0307411_10399589 | 3300032005 | Bacteria | 1136 |
| 403 | Ga0307415_100000474 | 3300032126 | Bacteria | 17337 |
| 404 | Ga0307415_100021712 | 3300032126 | Bacteria | 3952 |
| 405 | Ga0307415_100045389 | 3300032126 | Bacteria | 2946 |
| 406 | Ga0307415_100051999 | 3300032126 | Bacteria | 2784 |
| 407 | Ga0307415_100388983 | 3300032126 | Bacteria | 1187 |
| 408 | Ga0307415_100921916 | 3300032126 | Bacteria | 807 |
| 409 | Ga0307415_101559439 | 3300032126 | Bacteria | 633 |
| 410 | Ga0307415_102122116 | 3300032126 | Bacteria | 549 |
| 411 | Ga0307507_10167399 | 3300033179 | Bacteria | 1607 |
| 412 | Ga0307507_10180177 | 3300033179 | Bacteria | 1512 |
| 413 | Ga0307507_10543021 | 3300033179 | Bacteria | 615 |
| 414 | Ga0307510_10049951 | 3300033180 | Bacteria | 4443 |
| 415 | Ga0373930_0108231 | 3300034816 | Bacteria | 667 |
| 416 | Ga0373948_0028553 | 3300034817 | Bacteria | 1111 |
| 417 | Ga0373950_0114526 | 3300034818 | Bacteria | 592 |
| 418 | Ga0373938_0018605 | 3300034957 | Bacteria | 1380 |
| 419 | Ga0373934_0475000 | 3300035086 | Bacteria | 525 |
| 420 | Ga0373940_0025238 | 3300035088 | Bacteria | 1547 |
| 421 | Ga0373944_0000077 | 3300035089 | Bacteria | 16846 |
| 422 | Ga0373949_0098244 | 3300035090 | Bacteria | 799 |
| 423 | Ga0373951_0043290 | 3300035091 | Bacteria | 1091 |
| 424 | Ga0373952_0031345 | 3300035092 | Bacteria | 1182 |
| 425 | Ga0373923_0089766 | 3300035111 | Bacteria | 1343 |
| 426 | Ga0373932_0021233 | 3300035112 | Bacteria | 1713 |
| 427 | Ga0373936_0216263 | 3300035113 | Bacteria | 849 |
| 428 | Ga0373939_0093425 | 3300035114 | Bacteria | 1020 |
| 429 | Ga0373941_0031995 | 3300035115 | Bacteria | 1572 |
| 430 | Ga0373945_0392158 | 3300035116 | Bacteria | 607 |
| 431 | Ga0373953_0032702 | 3300035117 | Bacteria | 2031 |
| 432 | Ga0373942_0056356 | 3300035207 | Bacteria | 1115 |
| 433 | Ga0373942_0079692 | 3300035207 | Bacteria | 970 |
| 434 | Ga0373962_0050915 | 3300035242 | Bacteria | 1194 |
| 435 | Ga0373931_0174036 | 3300035691 | Bacteria | 1270 |
| 436 | Ga0373935_0986847 | 3300035692 | Bacteria | 625 |
| 437 | Ga0373927_0122036 | 3300035695 | Bacteria | 1701 |
| 438 | Ga0373933_0181516 | 3300035724 | Bacteria | 1342 |
| 439 | Ga0373947_0549319 | 3300035725 | Bacteria | 786 |
| 440 | Ga0373937_0277933 | 3300036401 | Bacteria | 1581 |
| 441 | Ga0316584_0174426 | 3300036712 | Bacteria | 1593 |
| 442 | Ga0373925_0224946 | 3300037068 | Bacteria | 1499 |
| 443 | Ga0373925_1245752 | 3300037068 | Bacteria | 611 |
| 444 | Ga0316581_0244265 | 3300037588 | Bacteria | 552 |
| 445 | Ga0436364_0426719 | 3300037853 | Bacteria | 1152 |
| 446 | Ga0237819_02012 | 3300038705 | Bacteria | 4528 |
| 447 | Ga0400483_283032 | 3300039062 | Bacteria | 1437 |
| 448 | Ga0237816_00962 | 3300039145 | Bacteria | 2361 |
| 449 | Ga0436365_0260153 | 3300039437 | Bacteria | 649 |
| 450 | Ga0436365_0354361 | 3300039437 | Bacteria | 622 |
| 451 | Ga0436360_0757575 | 3300039438 | Bacteria | 814 |
| 452 | Ga0436363_0345479 | 3300039450 | Bacteria | 782 |
| 453 | Ga0436363_0434749 | 3300039450 | Bacteria | 965 |
| 454 | Ga0436363_1235171 | 3300039450 | Bacteria | 758 |
| 455 | Ga0436363_1291634 | 3300039450 | Bacteria | 1022 |
| 456 | Ga0451791_0637026 | 3300041451 | Bacteria | 1754 |
| 457 | Ga0451791_0649049 | 3300041451 | Bacteria | 514 |
| 458 | Ga0451797_0512445 | 3300041453 | Bacteria | 602 |
| 459 | Ga0451797_1286614 | 3300041453 | Bacteria | 569 |
| 460 | Ga0451800_1361167 | 3300041459 | Bacteria | 1070 |
| 461 | Ga0451802_0698271 | 3300041460 | Bacteria | 522 |
| 462 | Ga0451802_0829211 | 3300041460 | Bacteria | 546 |
| 463 | Ga0451804_0106901 | 3300041463 | Bacteria | 501 |
| 464 | Ga0451807_2049489 | 3300041486 | Bacteria | 508 |
| 465 | Ga0451807_2061218 | 3300041486 | Bacteria | 647 |
| 466 | Ga0451807_2603260 | 3300041486 | Bacteria | 655 |
| 467 | Ga0451807_2628185 | 3300041486 | Bacteria | 588 |
| 468 | Ga0451837_0362053 | 3300041494 | Bacteria | 572 |
| 469 | Ga0451837_0588667 | 3300041494 | Bacteria | 859 |
| 470 | Ga0451841_1105605 | 3300041498 | Bacteria | 623 |
| 471 | Ga0451845_0281309 | 3300041501 | Bacteria | 551 |
| 472 | Ga0451853_2934718 | 3300041512 | Bacteria | 555 |
| 473 | Ga0451853_3952303 | 3300041512 | Bacteria | 853 |
| 474 | Ga0439443_034108 | 3300042003 | Bacteria | 849 |
| 475 | Ga0439443_112236 | 3300042003 | Bacteria | 530 |
| 476 | Ga0439448_0088988 | 3300042005 | Bacteria | 1042 |
| 477 | Ga0439455_0128108 | 3300042012 | Bacteria | 714 |
| 478 | Ga0439463_003783 | 3300042016 | Bacteria | 3814 |
| 479 | Ga0450905_014976 | 3300042142 | Bacteria | 1109 |
| 480 | Ga0439444_0007107 | 3300042437 | Bacteria | 1711 |
| 481 | Ga0439460_0106062 | 3300042461 | Bacteria | 907 |
| 482 | Ga0451577_0360951 | 3300042876 | Bacteria | 1318 |
| 483 | Ga0451577_0533489 | 3300042876 | Bacteria | 1066 |
| 484 | Ga0439440_0003715 | 3300042993 | Bacteria | 2964 |
| 485 | Ga0439440_0004083 | 3300042993 | Bacteria | 2854 |
| 486 | Ga0466972_0006222 | 3300044658 | Bacteria | 5998 |
| 487 | Ga0466972_0034255 | 3300044658 | Bacteria | 2489 |
| 488 | Ga0453683_0000060 | 3300044673 | Bacteria | 185920 |
| 489 | Ga0466965_0004824 | 3300044683 | Bacteria | 6018 |
| 490 | Ga0466965_0024589 | 3300044683 | Bacteria | 2914 |
| 491 | Ga0466965_0080173 | 3300044683 | Bacteria | 1649 |
| 492 | Ga0466964_0267678 | 3300044706 | Bacteria | 849 |
| 493 | Ga0453684_0010987 | 3300044712 | Bacteria | 15303 |
| 494 | Ga0453684_1498242 | 3300044712 | Bacteria | 696 |
| 495 | Ga0453684_1795378 | 3300044712 | Bacteria | 624 |
| 496 | Ga0466968_0348785 | 3300044735 | Bacteria | 719 |
| 497 | Ga0466960_0002929 | 3300044901 | Bacteria | 6497 |
| 498 | Ga0451576_0000001 | 3300045051 | Bacteria | 1802108 |
| 499 | Ga0451576_1051167 | 3300045051 | Bacteria | 853 |
| 500 | Ga0466958_0461230 | 3300045836 | Bacteria | 823 |
| 501 | Ga0466958_0665711 | 3300045836 | Bacteria | 678 |
| 502 | Ga0466967_0626685 | 3300045976 | Bacteria | 1062 |
| 503 | Ga0495590_0000142 | 3300046457 | Bacteria | 43345 |
| 504 | Ga0495590_0354702 | 3300046457 | Bacteria | 558 |
| 505 | Ga0495638_0161366 | 3300046460 | Bacteria | 1293 |
| 506 | Ga0495594_0030734 | 3300046499 | Bacteria | 2909 |
| 507 | Ga0495630_0480809 | 3300046517 | Bacteria | 952 |
| 508 | Ga0495632_0073382 | 3300046519 | Bacteria | 1641 |
| 509 | Ga0495663_0016453 | 3300046525 | Bacteria | 2090 |
| 510 | Ga0495652_0056439 | 3300046529 | Bacteria | 3335 |
| 511 | Ga0495654_0024158 | 3300046530 | Bacteria | 3142 |
| 512 | Ga0495667_0515082 | 3300046559 | Bacteria | 749 |
| 513 | Ga0495668_0000076 | 3300046616 | Bacteria | 161826 |
| 514 | Ga0495668_0519439 | 3300046616 | Bacteria | 657 |
| 515 | Ga0495625_0000520 | 3300046660 | Bacteria | 56778 |
| 516 | Ga0495625_0260011 | 3300046660 | Bacteria | 1123 |
| 517 | Ga0495613_0007953 | 3300046689 | Bacteria | 7890 |
| 518 | Ga0495604_0432622 | 3300047317 | Bacteria | 862 |
| 519 | Ga0495674_0307055 | 3300047319 | Bacteria | 1295 |
| 520 | Ga0495674_1162484 | 3300047319 | Bacteria | 585 |
| 521 | Ga0495681_0273816 | 3300047470 | Bacteria | 660 |
| 522 | Ga0495593_0201859 | 3300047673 | Bacteria | 999 |
| 523 | Ga0496100_0334565 | 3300048903 | Bacteria | 1140 |
| 524 | Ga0496101_0181641 | 3300048904 | Bacteria | 1620 |
| 525 | Ga0496102_0325295 | 3300048905 | Bacteria | 1448 |
| 526 | Ga0496103_0433247 | 3300048906 | Bacteria | 844 |
| 527 | Ga0496104_0824352 | 3300048907 | Bacteria | 833 |
| 528 | Ga0496104_0864123 | 3300048907 | Bacteria | 810 |
| 529 | Ga0496105_0373456 | 3300048908 | Bacteria | 1136 |
| 530 | Ga0496106_0620301 | 3300048909 | Bacteria | 865 |
| 531 | Ga0496108_0050519 | 3300048911 | Bacteria | 3481 |
| 532 | Ga0496108_0053263 | 3300048911 | Bacteria | 3393 |
| 533 | Ga0496108_0552054 | 3300048911 | Bacteria | 1005 |
| 534 | Ga0496109_0293673 | 3300048912 | Bacteria | 1532 |
| 535 | Ga0496110_0657889 | 3300048913 | Bacteria | 948 |
| 536 | Ga0496110_1259401 | 3300048913 | Bacteria | 649 |
| 537 | Ga0496111_0275268 | 3300048914 | Bacteria | 1249 |
| 538 | Ga0496111_0430298 | 3300048914 | Bacteria | 975 |
| 539 | Ga0496112_0201159 | 3300048915 | Bacteria | 1951 |
| 540 | Ga0496112_0732404 | 3300048915 | Bacteria | 916 |
| 541 | Ga0496113_0423361 | 3300048916 | Bacteria | 1069 |
| 542 | Ga0496113_0543808 | 3300048916 | Bacteria | 932 |
| 543 | Ga0496114_0444466 | 3300048917 | Bacteria | 1148 |
| 544 | Ga0496114_0471249 | 3300048917 | Bacteria | 1111 |
| 545 | Ga0496114_0955217 | 3300048917 | Bacteria | 739 |
| 546 | Ga0496114_1798236 | 3300048917 | Bacteria | 501 |
| 547 | Ga0496115_0001384 | 3300048918 | Bacteria | 17323 |
| 548 | Ga0496115_0262684 | 3300048918 | Bacteria | 1419 |
| 549 | Ga0496126_0452888 | 3300048929 | Bacteria | 1033 |
| 550 | Ga0496126_0466677 | 3300048929 | Bacteria | 1014 |
| 551 | Ga0496126_0506616 | 3300048929 | Bacteria | 964 |
| 552 | Ga0501031_0006336 | 3300049568 | Bacteria | 7716 |
| 553 | Ga0501031_0130426 | 3300049568 | Bacteria | 1642 |
| 554 | Ga0501031_0131485 | 3300049568 | Bacteria | 1635 |
| 555 | Ga0501032_0007789 | 3300049569 | Bacteria | 7811 |
| 556 | Ga0501032_0009497 | 3300049569 | Bacteria | 7048 |
| 557 | Ga0501032_0100594 | 3300049569 | Bacteria | 1915 |
| 558 | Ga0501032_0249123 | 3300049569 | Bacteria | 1153 |
| 559 | Ga0501033_0004440 | 3300049570 | Bacteria | 11220 |
| 560 | Ga0501033_0017619 | 3300049570 | Bacteria | 5395 |
| 561 | Ga0501033_0032102 | 3300049570 | Bacteria | 3942 |
| 562 | Ga0501033_0444829 | 3300049570 | Bacteria | 901 |
| 563 | Ga0501034_0020575 | 3300049571 | Bacteria | 6739 |
| 564 | Ga0501034_0022705 | 3300049571 | Bacteria | 6391 |
| 565 | Ga0501034_0281500 | 3300049571 | Bacteria | 1602 |
| 566 | Ga0501034_0623385 | 3300049571 | Bacteria | 982 |
| 567 | Ga0501034_0662481 | 3300049571 | Bacteria | 945 |
| 568 | Ga0501036_0007278 | 3300049572 | Bacteria | 9013 |
| 569 | Ga0501036_0016024 | 3300049572 | Bacteria | 6262 |
| 570 | Ga0501036_0388556 | 3300049572 | Bacteria | 1164 |
| 571 | Ga0501037_0007234 | 3300049573 | Bacteria | 8110 |
| 572 | Ga0501037_0010584 | 3300049573 | Bacteria | 6775 |
| 573 | Ga0501037_0238034 | 3300049573 | Bacteria | 1276 |
| 574 | Ga0501037_0473920 | 3300049573 | Bacteria | 852 |
| 575 | Ga0501038_0002697 | 3300049574 | Bacteria | 16549 |
| 576 | Ga0501038_0009560 | 3300049574 | Bacteria | 8894 |
| 577 | Ga0501038_0317914 | 3300049574 | Bacteria | 1219 |
| 578 | Ga0501038_0798481 | 3300049574 | Bacteria | 701 |
| 579 | Ga0501039_0027494 | 3300049575 | Bacteria | 4374 |
| 580 | Ga0501039_0036194 | 3300049575 | Bacteria | 3808 |
| 581 | Ga0501039_0191013 | 3300049575 | Bacteria | 1610 |
| 582 | Ga0501040_0270794 | 3300049576 | Bacteria | 1213 |
| 583 | Ga0501043_0080171 | 3300049579 | Bacteria | 2564 |
| 584 | Ga0501043_0189196 | 3300049579 | Bacteria | 1601 |
| 585 | Ga0501043_0408169 | 3300049579 | Bacteria | 1025 |
| 586 | Ga0501046_0066477 | 3300049580 | Bacteria | 2810 |
| 587 | Ga0501046_0092688 | 3300049580 | Bacteria | 2322 |
| 588 | Ga0501047_0048517 | 3300049581 | Bacteria | 4100 |
| 589 | Ga0501047_0088657 | 3300049581 | Bacteria | 2970 |
| 590 | Ga0501047_0410547 | 3300049581 | Bacteria | 1186 |
| 591 | Ga0501047_0808682 | 3300049581 | Bacteria | 752 |
| 592 | Ga0501047_0925820 | 3300049581 | Bacteria | 685 |
| 593 | Ga0501048_0075041 | 3300049582 | Bacteria | 2385 |
| 594 | Ga0501048_0588794 | 3300049582 | Bacteria | 798 |
| 595 | Ga0501067_0236819 | 3300049583 | Bacteria | 1016 |
| 596 | Ga0501068_0551553 | 3300049584 | Bacteria | 749 |
| 597 | Ga0501069_0041447 | 3300049585 | Bacteria | 2545 |
| 598 | Ga0501070_0047409 | 3300049586 | Bacteria | 3571 |
| 599 | Ga0501070_0102945 | 3300049586 | Bacteria | 2361 |
| 600 | Ga0501070_0258622 | 3300049586 | Bacteria | 1423 |
| 601 | Ga0501070_0571612 | 3300049586 | Bacteria | 903 |
| 602 | Ga0501070_1086066 | 3300049586 | Bacteria | 618 |
| 603 | Ga0501071_0060455 | 3300049587 | Bacteria | 2743 |
| 604 | Ga0501072_0408326 | 3300049588 | Bacteria | 1077 |
| 605 | Ga0501073_0011736 | 3300049589 | Bacteria | 6398 |
| 606 | Ga0501073_0082415 | 3300049589 | Bacteria | 2238 |
| 607 | Ga0501073_0093284 | 3300049589 | Bacteria | 2092 |
| 608 | Ga0501074_1240593 | 3300049590 | Bacteria | 523 |
| 609 | Ga0501075_0409525 | 3300049591 | Bacteria | 1034 |
| 610 | Ga0501076_1038267 | 3300049592 | Bacteria | 675 |
| 611 | Ga0501076_1807293 | 3300049592 | Bacteria | 501 |
| 612 | Ga0501238_001219 | 3300049671 | Bacteria | 2947 |
| 613 | Ga0501079_0226637 | 3300049741 | Bacteria | 1460 |
| 614 | Ga0501080_0005871 | 3300049742 | Bacteria | 10996 |
| 615 | Ga0501262_088080 | 3300049759 | Bacteria | 525 |
| 616 | Ga0501035_0005602 | 3300049822 | Bacteria | 11860 |
| 617 | Ga0501035_0014674 | 3300049822 | Bacteria | 7233 |
| 618 | Ga0501035_0095557 | 3300049822 | Bacteria | 2612 |
| 619 | Ga0501035_0286355 | 3300049822 | Bacteria | 1391 |
| 620 | Ga0501035_0621204 | 3300049822 | Bacteria | 879 |
| 621 | Ga0501035_0750659 | 3300049822 | Bacteria | 783 |
| 622 | Ga0501044_0021291 | 3300049823 | Bacteria | 6919 |
| 623 | Ga0501044_0024125 | 3300049823 | Bacteria | 6461 |
| 624 | Ga0501044_0058722 | 3300049823 | Bacteria | 3944 |
| 625 | Ga0501044_0084557 | 3300049823 | Bacteria | 3207 |
| 626 | Ga0501044_0137599 | 3300049823 | Bacteria | 2433 |
| 627 | Ga0501044_0196719 | 3300049823 | Bacteria | 1975 |
| 628 | Ga0501045_0301488 | 3300049824 | Bacteria | 1193 |
| 629 | Ga0501045_1114076 | 3300049824 | Bacteria | 577 |
| 630 | nmdc:mga03n38_249499_c1 | 3300050490 | Bacteria | 937 |
| 631 | nmdc:mga03n38_347719_c1 | 3300050490 | Bacteria | 806 |
| 632 | nmdc:mga00v17_23_c1 | 3300050491 | Bacteria | 43132 |
| 633 | nmdc:mga0yw44_280811_c1 | 3300050492 | Bacteria | 1113 |
| 634 | nmdc:mga06z11_144428_c1 | 3300050494 | Bacteria | 1347 |
| 635 | nmdc:mga06z11_233351_c1 | 3300050494 | Bacteria | 1078 |
| 636 | nmdc:mga07m45_622177_c1 | 3300050496 | Bacteria | 623 |
| 637 | nmdc:mga05p37_377472_c1 | 3300050507 | Bacteria | 1662 |
| 638 | nmdc:mga09592_1282733_c1 | 3300050508 | Bacteria | 603 |
| 639 | nmdc:mga09592_279328_c1 | 3300050508 | Bacteria | 1448 |
| 640 | nmdc:mga0qj67_1136031_c1 | 3300050509 | Bacteria | 609 |
| 641 | nmdc:mga0qj67_614143_c1 | 3300050509 | Bacteria | 869 |
| 642 | nmdc:mga06r32_12860_c1 | 3300050510 | Bacteria | 7565 |
| 643 | nmdc:mga0rr50_1063637_c1 | 3300050513 | Bacteria | 689 |
| 644 | Ga0500643_050329 | 3300053087 | Bacteria | 1192 |
| 645 | Ga0500644_0416076 | 3300053088 | Bacteria | 587 |
| 646 | Ga0500646_0000088 | 3300053090 | Bacteria | 26075 |
| 647 | Ga0500646_0077659 | 3300053090 | Bacteria | 1007 |
| 648 | Ga0500583_0006793 | 3300053092 | Bacteria | 3969 |
| 649 | Ga0500641_0007308 | 3300053096 | Bacteria | 3937 |
| 650 | Ga0500641_0434905 | 3300053096 | Bacteria | 509 |
| 651 | Ga0500650_0347906 | 3300053098 | Bacteria | 649 |
| 652 | Ga0500556_0367398 | 3300053104 | Bacteria | 555 |
| 653 | Ga0500562_138111 | 3300053108 | Bacteria | 664 |
| 654 | Ga0500592_010718 | 3300053116 | Bacteria | 1462 |
| 655 | Ga0500592_043466 | 3300053116 | Bacteria | 728 |
| 656 | Ga0500594_0072713 | 3300053118 | Bacteria | 1014 |
| 657 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 658 | Ga0500642_0436365 | 3300053130 | Bacteria | 565 |
| 659 | Ga0500652_092173 | 3300053131 | Bacteria | 1265 |
| 660 | Ga0500658_0014554 | 3300053134 | Bacteria | 2914 |
| 661 | Ga0500658_0237611 | 3300053134 | Bacteria | 837 |
| 662 | Ga0500568_0000579 | 3300053139 | Bacteria | 26786 |
| 663 | Ga0500568_0001306 | 3300053139 | Bacteria | 16359 |
| 664 | Ga0500568_0007771 | 3300053139 | Bacteria | 5227 |
| 665 | Ga0500588_0008410 | 3300053146 | Bacteria | 2409 |
| 666 | Ga0500616_0000483 | 3300053153 | Bacteria | 51655 |
| 667 | Ga0500627_0000033 | 3300053158 | Bacteria | 82993 |
| 668 | Ga0500630_212903 | 3300053159 | Bacteria | 735 |
| 669 | Ga0500645_002050 | 3300053730 | Bacteria | 9379 |
| 670 | Ga0500645_023936 | 3300053730 | Bacteria | 1870 |
| 671 | Ga0500599_057531 | 3300053736 | Bacteria | 627 |
| 672 | Ga0500587_002647 | 3300053739 | Bacteria | 2539 |
| 673 | Ga0501082_1811764 | 3300060353 | Unclassified | 532 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2852653556 | 2852654369 | 66 |
| 2 | 3300049581 | Ga0501047_0808682 | Ga0501047_0808682_477_692 | 67 |
| 3 | iso_pu_bacteria | 2643221560 | 2643819779 | 67 |
| 4 | iso_pu_bacteria | 2852680915 | 2852684282 | 67 |
| 5 | 3300005295 | Ga0065707_10970854 | Ga0065707_109708541 | 68 |
| 6 | 3300048918 | Ga0496115_0001384 | Ga0496115_0001384_5712_5918 | 68 |
| 7 | iso_pu_bacteria | 2996221748 | 2996222565 | 68 |
| 8 | 3300006846 | Ga0075430_100586297 | Ga0075430_1005862972 | 69 |
| 9 | 3300006880 | Ga0075429_101623208 | Ga0075429_1016232082 | 69 |
| 10 | 3300026075 | Ga0207708_10873619 | Ga0207708_108736193 | 69 |
| 11 | 3300031901 | Ga0307406_11609747 | Ga0307406_116097471 | 69 |
| 12 | 3300032002 | Ga0307416_103348917 | Ga0307416_1033489172 | 69 |
| 13 | 3300041453 | Ga0451797_0512445 | Ga0451797_0512445_271_480 | 69 |
| 14 | 3300042993 | Ga0439440_0004083 | Ga0439440_0004083_2545_2754 | 69 |
| 15 | 3300050508 | nmdc:mga09592_1282733_c1 | nmdc:mga09592_1282733_c1_180_392 | 69 |
| 16 | 3300050509 | nmdc:mga0qj67_1136031_c1 | nmdc:mga0qj67_1136031_c1_148_360 | 69 |
| 17 | iso_pu_bacteria | 2643221695 | 2644529035 | 69 |
| 18 | iso_pu_bacteria | 2675903060 | 2676494832 | 69 |
| 19 | iso_pu_bacteria | 2751185734 | 2753069156 | 69 |
| 20 | iso_pu_bacteria | 2870721527 | 2870728384 | 69 |
| 21 | 3300002737 | JGI25162J39368_1008339 | JGI25162J39368_10083393 | 70 |
| 22 | 3300002772 | JGI25164J39214_1001125 | JGI25164J39214_10011255 | 70 |
| 23 | 3300003214 | JGI25165J46597_1000269 | JGI25165J46597_10002698 | 70 |
| 24 | 3300003354 | JGI25160J50197_1058139 | JGI25160J50197_10581392 | 70 |
| 25 | 3300003771 | Ga0055526_1000961 | Ga0055526_100096122 | 70 |
| 26 | 3300003771 | Ga0055526_1067220 | Ga0055526_10672201 | 70 |
| 27 | 3300003791 | Ga0055530_10036936 | Ga0055530_100369362 | 70 |
| 28 | 3300005327 | Ga0070658_10639602 | Ga0070658_106396022 | 70 |
| 29 | 3300005334 | Ga0068869_101009531 | Ga0068869_1010095312 | 70 |
| 30 | 3300005337 | Ga0070682_100198731 | Ga0070682_1001987313 | 70 |
| 31 | 3300005354 | Ga0070675_101128337 | Ga0070675_1011283371 | 70 |
| 32 | 3300005535 | Ga0070684_101773228 | Ga0070684_1017732282 | 70 |
| 33 | 3300005539 | Ga0068853_100273709 | Ga0068853_1002737093 | 70 |
| 34 | 3300005539 | Ga0068853_100893245 | Ga0068853_1008932452 | 70 |
| 35 | 3300005578 | Ga0068854_101294313 | Ga0068854_1012943132 | 70 |
| 36 | 3300005616 | Ga0068852_102798712 | Ga0068852_1027987122 | 70 |
| 37 | 3300005937 | Ga0081455_10690286 | Ga0081455_106902861 | 70 |
| 38 | 3300006175 | Ga0070712_100213341 | Ga0070712_1002133412 | 70 |
| 39 | 3300006847 | Ga0075431_100104479 | Ga0075431_1001044794 | 70 |
| 40 | 3300009094 | Ga0111539_12062175 | Ga0111539_120621752 | 70 |
| 41 | 3300009148 | Ga0105243_13051614 | Ga0105243_130516142 | 70 |
| 42 | 3300013105 | Ga0157369_10839774 | Ga0157369_108397743 | 70 |
| 43 | 3300013308 | Ga0157375_10646286 | Ga0157375_106462863 | 70 |
| 44 | 3300013308 | Ga0157375_11298440 | Ga0157375_112984402 | 70 |
| 45 | 3300014745 | Ga0157377_10919125 | Ga0157377_109191252 | 70 |
| 46 | 3300025231 | Ga0207427_100054 | Ga0207427_100054147 | 70 |
| 47 | 3300025233 | Ga0209437_100642 | Ga0209437_1006426 | 70 |
| 48 | 3300025245 | Ga0207425_1000041 | Ga0207425_100004117 | 70 |
| 49 | 3300025258 | Ga0209129_1000977 | Ga0209129_10009777 | 70 |
| 50 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011024 | 70 |
| 51 | 3300025263 | Ga0209565_1001163 | Ga0209565_10011632 | 70 |
| 52 | 3300025273 | Ga0209673_1026813 | Ga0209673_10268133 | 70 |
| 53 | 3300025292 | Ga0209676_1006028 | Ga0209676_10060289 | 70 |
| 54 | 3300025292 | Ga0209676_1012522 | Ga0209676_10125227 | 70 |
| 55 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068186 | 70 |
| 56 | 3300025295 | Ga0209564_1000622 | Ga0209564_100062219 | 70 |
| 57 | 3300025297 | Ga0209758_1000004 | Ga0209758_100000485 | 70 |
| 58 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012016 | 70 |
| 59 | 3300025298 | Ga0209050_1010590 | Ga0209050_10105908 | 70 |
| 60 | 3300025298 | Ga0209050_1012591 | Ga0209050_10125918 | 70 |
| 61 | 3300025302 | Ga0207426_1036225 | Ga0207426_10362253 | 70 |
| 62 | 3300025303 | Ga0209051_1000191 | Ga0209051_100019153 | 70 |
| 63 | 3300025304 | Ga0209257_1001893 | Ga0209257_100189326 | 70 |
| 64 | 3300025304 | Ga0209257_1002895 | Ga0209257_10028953 | 70 |
| 65 | 3300025909 | Ga0207705_11066321 | Ga0207705_110663212 | 70 |
| 66 | 3300025972 | Ga0207668_10122041 | Ga0207668_101220413 | 70 |
| 67 | 3300026041 | Ga0207639_10194018 | Ga0207639_101940183 | 70 |
| 68 | 3300026095 | Ga0207676_11784730 | Ga0207676_117847301 | 70 |
| 69 | 3300026142 | Ga0207698_11226901 | Ga0207698_112269012 | 70 |
| 70 | 3300026142 | Ga0207698_11503320 | Ga0207698_115033201 | 70 |
| 71 | 3300027876 | Ga0209974_10458078 | Ga0209974_104580781 | 70 |
| 72 | 3300031731 | Ga0307405_11200961 | Ga0307405_112009612 | 70 |
| 73 | 3300031731 | Ga0307405_11726390 | Ga0307405_117263902 | 70 |
| 74 | 3300031838 | Ga0307518_10000363 | Ga0307518_1000036321 | 70 |
| 75 | 3300031901 | Ga0307406_10357785 | Ga0307406_103577852 | 70 |
| 76 | 3300031901 | Ga0307406_10753036 | Ga0307406_107530362 | 70 |
| 77 | 3300031901 | Ga0307406_11105207 | Ga0307406_111052072 | 70 |
| 78 | 3300031995 | Ga0307409_100169353 | Ga0307409_1001693534 | 70 |
| 79 | 3300031995 | Ga0307409_100405283 | Ga0307409_1004052832 | 70 |
| 80 | 3300031995 | Ga0307409_100460800 | Ga0307409_1004608003 | 70 |
| 81 | 3300032002 | Ga0307416_100093115 | Ga0307416_1000931151 | 70 |
| 82 | 3300032002 | Ga0307416_101698001 | Ga0307416_1016980011 | 70 |
| 83 | 3300032126 | Ga0307415_100045389 | Ga0307415_1000453893 | 70 |
| 84 | 3300032126 | Ga0307415_100921916 | Ga0307415_1009219162 | 70 |
| 85 | 3300032126 | Ga0307415_101559439 | Ga0307415_1015594392 | 70 |
| 86 | 3300036712 | Ga0316584_0174426 | Ga0316584_0174426_1251_1472 | 70 |
| 87 | 3300038705 | Ga0237819_02012 | Ga0237819_02012_495_707 | 70 |
| 88 | 3300039062 | Ga0400483_283032 | Ga0400483_283032_399_611 | 70 |
| 89 | 3300039145 | Ga0237816_00962 | Ga0237816_00962_709_921 | 70 |
| 90 | 3300039437 | Ga0436365_0260153 | Ga0436365_0260153_36_251 | 70 |
| 91 | 3300041451 | Ga0451791_0637026 | Ga0451791_0637026_950_1165 | 70 |
| 92 | 3300041453 | Ga0451797_1286614 | Ga0451797_1286614_192_407 | 70 |
| 93 | 3300041460 | Ga0451802_0829211 | Ga0451802_0829211_213_431 | 70 |
| 94 | 3300041486 | Ga0451807_2049489 | Ga0451807_2049489_85_300 | 70 |
| 95 | 3300041486 | Ga0451807_2061218 | Ga0451807_2061218_365_577 | 70 |
| 96 | 3300041494 | Ga0451837_0588667 | Ga0451837_0588667_138_356 | 70 |
| 97 | 3300041498 | Ga0451841_1105605 | Ga0451841_1105605_305_523 | 70 |
| 98 | 3300041512 | Ga0451853_2934718 | Ga0451853_2934718_214_429 | 70 |
| 99 | 3300041512 | Ga0451853_3952303 | Ga0451853_3952303_377_595 | 70 |
| 100 | 3300042003 | Ga0439443_034108 | Ga0439443_034108_133_345 | 70 |
| 101 | 3300042142 | Ga0450905_014976 | Ga0450905_014976_209_421 | 70 |
| 102 | 3300048905 | Ga0496102_0325295 | Ga0496102_0325295_1186_1398 | 70 |
| 103 | 3300048907 | Ga0496104_0864123 | Ga0496104_0864123_512_727 | 70 |
| 104 | 3300048913 | Ga0496110_1259401 | Ga0496110_1259401_23_238 | 70 |
| 105 | 3300048914 | Ga0496111_0430298 | Ga0496111_0430298_603_818 | 70 |
| 106 | 3300048916 | Ga0496113_0543808 | Ga0496113_0543808_604_819 | 70 |
| 107 | 3300048917 | Ga0496114_0444466 | Ga0496114_0444466_838_1053 | 70 |
| 108 | 3300048929 | Ga0496126_0452888 | Ga0496126_0452888_702_914 | 70 |
| 109 | 3300049592 | Ga0501076_1807293 | Ga0501076_1807293_13_231 | 70 |
| 110 | 3300049671 | Ga0501238_001219 | Ga0501238_001219_1297_1512 | 70 |
| 111 | 3300049822 | Ga0501035_0621204 | Ga0501035_0621204_230_442 | 70 |
| 112 | 3300049824 | Ga0501045_1114076 | Ga0501045_1114076_149_379 | 70 |
| 113 | 3300050491 | nmdc:mga00v17_23_c1 | nmdc:mga00v17_23_c1_19806_20018 | 70 |
| 114 | 3300050510 | nmdc:mga06r32_12860_c1 | nmdc:mga06r32_12860_c1_6236_6454 | 70 |
| 115 | 3300053096 | Ga0500641_0007308 | Ga0500641_0007308_2583_2795 | 70 |
| 116 | 3300053104 | Ga0500556_0367398 | Ga0500556_0367398_294_506 | 70 |
| 117 | 3300053108 | Ga0500562_138111 | Ga0500562_138111_239_451 | 70 |
| 118 | 3300053118 | Ga0500594_0072713 | Ga0500594_0072713_705_917 | 70 |
| 119 | 3300053730 | Ga0500645_002050 | Ga0500645_002050_50_262 | 70 |
| 120 | 3300053730 | Ga0500645_023936 | Ga0500645_023936_155_367 | 70 |
| 121 | 3300053736 | Ga0500599_057531 | Ga0500599_057531_356_568 | 70 |
| 122 | iso_pu_bacteria | 2558860280 | 2559424523 | 70 |
| 123 | iso_pu_bacteria | 2582581314 | 2585315162 | 70 |
| 124 | iso_pu_bacteria | 2791354901 | 2791914452 | 70 |
| 125 | 3300003791 | Ga0055530_10033459 | Ga0055530_100334593 | 71 |
| 126 | 3300005334 | Ga0068869_100346121 | Ga0068869_1003461213 | 71 |
| 127 | 3300005334 | Ga0068869_101591834 | Ga0068869_1015918342 | 71 |
| 128 | 3300005337 | Ga0070682_100922759 | Ga0070682_1009227592 | 71 |
| 129 | 3300005455 | Ga0070663_100979742 | Ga0070663_1009797422 | 71 |
| 130 | 3300005539 | Ga0068853_100438875 | Ga0068853_1004388753 | 71 |
| 131 | 3300005543 | Ga0070672_100457746 | Ga0070672_1004577462 | 71 |
| 132 | 3300005548 | Ga0070665_100000078 | Ga0070665_10000007863 | 71 |
| 133 | 3300005617 | Ga0068859_101535234 | Ga0068859_1015352342 | 71 |
| 134 | 3300005834 | Ga0068851_10872225 | Ga0068851_108722252 | 71 |
| 135 | 3300005843 | Ga0068860_100264234 | Ga0068860_1002642344 | 71 |
| 136 | 3300006038 | Ga0075365_10087464 | Ga0075365_100874643 | 71 |
| 137 | 3300006048 | Ga0075363_100212596 | Ga0075363_1002125962 | 71 |
| 138 | 3300006353 | Ga0075370_11025219 | Ga0075370_110252191 | 71 |
| 139 | 3300006358 | Ga0068871_101376272 | Ga0068871_1013762723 | 71 |
| 140 | 3300006931 | Ga0097620_101535158 | Ga0097620_1015351582 | 71 |
| 141 | 3300009098 | Ga0105245_11145009 | Ga0105245_111450092 | 71 |
| 142 | 3300013100 | Ga0157373_11268285 | Ga0157373_112682852 | 71 |
| 143 | 3300013296 | Ga0157374_12981672 | Ga0157374_129816722 | 71 |
| 144 | 3300014325 | Ga0163163_12223590 | Ga0163163_122235902 | 71 |
| 145 | 3300017792 | Ga0163161_12118946 | Ga0163161_121189462 | 71 |
| 146 | 3300021384 | Ga0213876_10002639 | Ga0213876_100026398 | 71 |
| 147 | 3300025263 | Ga0209565_1052632 | Ga0209565_10526322 | 71 |
| 148 | 3300025292 | Ga0209676_1019508 | Ga0209676_10195082 | 71 |
| 149 | 3300025294 | Ga0209025_1148152 | Ga0209025_11481521 | 71 |
| 150 | 3300025298 | Ga0209050_1001738 | Ga0209050_100173822 | 71 |
| 151 | 3300025304 | Ga0209257_1001973 | Ga0209257_10019737 | 71 |
| 152 | 3300025315 | Ga0207697_10559018 | Ga0207697_105590182 | 71 |
| 153 | 3300025920 | Ga0207649_11401016 | Ga0207649_114010162 | 71 |
| 154 | 3300025927 | Ga0207687_10775048 | Ga0207687_107750482 | 71 |
| 155 | 3300025931 | Ga0207644_10617090 | Ga0207644_106170902 | 71 |
| 156 | 3300025935 | Ga0207709_10700985 | Ga0207709_107009852 | 71 |
| 157 | 3300025944 | Ga0207661_11125549 | Ga0207661_111255492 | 71 |
| 158 | 3300025944 | Ga0207661_11728885 | Ga0207661_117288852 | 71 |
| 159 | 3300025945 | Ga0207679_10465506 | Ga0207679_104655062 | 71 |
| 160 | 3300026041 | Ga0207639_10374248 | Ga0207639_103742482 | 71 |
| 161 | 3300028379 | Ga0268266_10000131 | Ga0268266_10000131114 | 71 |
| 162 | 3300028381 | Ga0268264_10011270 | Ga0268264_100112704 | 71 |
| 163 | 3300028556 | Ga0265337_1010536 | Ga0265337_10105364 | 71 |
| 164 | 3300028794 | Ga0307515_10739082 | Ga0307515_107390821 | 71 |
| 165 | 3300031456 | Ga0307513_10404867 | Ga0307513_104048672 | 71 |
| 166 | 3300031649 | Ga0307514_10058419 | Ga0307514_100584194 | 71 |
| 167 | 3300031824 | Ga0307413_11598422 | Ga0307413_115984222 | 71 |
| 168 | 3300031901 | Ga0307406_10504645 | Ga0307406_105046452 | 71 |
| 169 | 3300031911 | Ga0307412_10340526 | Ga0307412_103405264 | 71 |
| 170 | 3300032004 | Ga0307414_10739222 | Ga0307414_107392222 | 71 |
| 171 | 3300032126 | Ga0307415_102122116 | Ga0307415_1021221161 | 71 |
| 172 | 3300033180 | Ga0307510_10049951 | Ga0307510_100499515 | 71 |
| 173 | 3300035086 | Ga0373934_0475000 | Ga0373934_0475000_86_304 | 71 |
| 174 | 3300035111 | Ga0373923_0089766 | Ga0373923_0089766_1101_1319 | 71 |
| 175 | 3300035113 | Ga0373936_0216263 | Ga0373936_0216263_263_478 | 71 |
| 176 | 3300035117 | Ga0373953_0032702 | Ga0373953_0032702_379_597 | 71 |
| 177 | 3300035724 | Ga0373933_0181516 | Ga0373933_0181516_254_472 | 71 |
| 178 | 3300036401 | Ga0373937_0277933 | Ga0373937_0277933_1216_1434 | 71 |
| 179 | 3300037068 | Ga0373925_0224946 | Ga0373925_0224946_1070_1288 | 71 |
| 180 | 3300039437 | Ga0436365_0354361 | Ga0436365_0354361_359_574 | 71 |
| 181 | 3300039450 | Ga0436363_0345479 | Ga0436363_0345479_221_436 | 71 |
| 182 | 3300039450 | Ga0436363_1291634 | Ga0436363_1291634_47_262 | 71 |
| 183 | 3300041451 | Ga0451791_0649049 | Ga0451791_0649049_236_451 | 71 |
| 184 | 3300041460 | Ga0451802_0698271 | Ga0451802_0698271_38_256 | 71 |
| 185 | 3300041463 | Ga0451804_0106901 | Ga0451804_0106901_82_297 | 71 |
| 186 | 3300041486 | Ga0451807_2603260 | Ga0451807_2603260_366_587 | 71 |
| 187 | 3300041486 | Ga0451807_2628185 | Ga0451807_2628185_246_467 | 71 |
| 188 | 3300042876 | Ga0451577_0533489 | Ga0451577_0533489_246_470 | 71 |
| 189 | 3300044673 | Ga0453683_0000060 | Ga0453683_0000060_161644_161868 | 71 |
| 190 | 3300044712 | Ga0453684_0010987 | Ga0453684_0010987_4136_4360 | 71 |
| 191 | 3300045051 | Ga0451576_0000001 | Ga0451576_0000001_1185888_1186112 | 71 |
| 192 | 3300046499 | Ga0495594_0030734 | Ga0495594_0030734_483_707 | 71 |
| 193 | 3300046517 | Ga0495630_0480809 | Ga0495630_0480809_469_687 | 71 |
| 194 | 3300046525 | Ga0495663_0016453 | Ga0495663_0016453_1442_1663 | 71 |
| 195 | 3300046530 | Ga0495654_0024158 | Ga0495654_0024158_1323_1538 | 71 |
| 196 | 3300046616 | Ga0495668_0519439 | Ga0495668_0519439_178_393 | 71 |
| 197 | 3300046660 | Ga0495625_0000520 | Ga0495625_0000520_4712_4933 | 71 |
| 198 | 3300046660 | Ga0495625_0260011 | Ga0495625_0260011_819_1034 | 71 |
| 199 | 3300047317 | Ga0495604_0432622 | Ga0495604_0432622_366_584 | 71 |
| 200 | 3300047319 | Ga0495674_0307055 | Ga0495674_0307055_662_880 | 71 |
| 201 | 3300047470 | Ga0495681_0273816 | Ga0495681_0273816_91_306 | 71 |
| 202 | 3300047673 | Ga0495593_0201859 | Ga0495593_0201859_159_377 | 71 |
| 203 | 3300048915 | Ga0496112_0732404 | Ga0496112_0732404_341_559 | 71 |
| 204 | 3300048917 | Ga0496114_0471249 | Ga0496114_0471249_721_936 | 71 |
| 205 | 3300048929 | Ga0496126_0466677 | Ga0496126_0466677_132_347 | 71 |
| 206 | 3300048929 | Ga0496126_0506616 | Ga0496126_0506616_254_469 | 71 |
| 207 | 3300049568 | Ga0501031_0131485 | Ga0501031_0131485_503_718 | 71 |
| 208 | 3300049569 | Ga0501032_0009497 | Ga0501032_0009497_4397_4612 | 71 |
| 209 | 3300049569 | Ga0501032_0249123 | Ga0501032_0249123_323_538 | 71 |
| 210 | 3300049570 | Ga0501033_0017619 | Ga0501033_0017619_4150_4365 | 71 |
| 211 | 3300049570 | Ga0501033_0444829 | Ga0501033_0444829_524_739 | 71 |
| 212 | 3300049571 | Ga0501034_0022705 | Ga0501034_0022705_1606_1821 | 71 |
| 213 | 3300049571 | Ga0501034_0281500 | Ga0501034_0281500_241_456 | 71 |
| 214 | 3300049571 | Ga0501034_0623385 | Ga0501034_0623385_609_824 | 71 |
| 215 | 3300049572 | Ga0501036_0007278 | Ga0501036_0007278_302_517 | 71 |
| 216 | 3300049573 | Ga0501037_0010584 | Ga0501037_0010584_178_393 | 71 |
| 217 | 3300049574 | Ga0501038_0009560 | Ga0501038_0009560_5321_5536 | 71 |
| 218 | 3300049575 | Ga0501039_0027494 | Ga0501039_0027494_2455_2670 | 71 |
| 219 | 3300049579 | Ga0501043_0189196 | Ga0501043_0189196_509_724 | 71 |
| 220 | 3300049580 | Ga0501046_0066477 | Ga0501046_0066477_2494_2709 | 71 |
| 221 | 3300049581 | Ga0501047_0048517 | Ga0501047_0048517_696_911 | 71 |
| 222 | 3300049581 | Ga0501047_0925820 | Ga0501047_0925820_375_590 | 71 |
| 223 | 3300049582 | Ga0501048_0588794 | Ga0501048_0588794_196_411 | 71 |
| 224 | 3300049585 | Ga0501069_0041447 | Ga0501069_0041447_321_536 | 71 |
| 225 | 3300049586 | Ga0501070_0102945 | Ga0501070_0102945_693_908 | 71 |
| 226 | 3300049586 | Ga0501070_0571612 | Ga0501070_0571612_101_316 | 71 |
| 227 | 3300049590 | Ga0501074_1240593 | Ga0501074_1240593_115_336 | 71 |
| 228 | 3300049759 | Ga0501262_088080 | Ga0501262_088080_279_494 | 71 |
| 229 | 3300049822 | Ga0501035_0014674 | Ga0501035_0014674_2791_3006 | 71 |
| 230 | 3300049822 | Ga0501035_0286355 | Ga0501035_0286355_1139_1354 | 71 |
| 231 | 3300049822 | Ga0501035_0750659 | Ga0501035_0750659_132_347 | 71 |
| 232 | 3300049823 | Ga0501044_0024125 | Ga0501044_0024125_1573_1788 | 71 |
| 233 | 3300049823 | Ga0501044_0058722 | Ga0501044_0058722_2187_2402 | 71 |
| 234 | 3300049823 | Ga0501044_0137599 | Ga0501044_0137599_982_1197 | 71 |
| 235 | 3300050490 | nmdc:mga03n38_249499_c1 | nmdc:mga03n38_249499_c1_321_539 | 71 |
| 236 | 3300050490 | nmdc:mga03n38_347719_c1 | nmdc:mga03n38_347719_c1_444_662 | 71 |
| 237 | 3300050492 | nmdc:mga0yw44_280811_c1 | nmdc:mga0yw44_280811_c1_256_474 | 71 |
| 238 | 3300050494 | nmdc:mga06z11_144428_c1 | nmdc:mga06z11_144428_c1_184_405 | 71 |
| 239 | 3300053087 | Ga0500643_050329 | Ga0500643_050329_638_859 | 71 |
| 240 | 3300053090 | Ga0500646_0077659 | Ga0500646_0077659_635_850 | 71 |
| 241 | 3300053096 | Ga0500641_0434905 | Ga0500641_0434905_56_271 | 71 |
| 242 | 3300053116 | Ga0500592_010718 | Ga0500592_010718_613_828 | 71 |
| 243 | 3300053116 | Ga0500592_043466 | Ga0500592_043466_22_243 | 71 |
| 244 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_701413_701634 | 71 |
| 245 | 3300053134 | Ga0500658_0014554 | Ga0500658_0014554_1378_1599 | 71 |
| 246 | 3300053134 | Ga0500658_0237611 | Ga0500658_0237611_499_717 | 71 |
| 247 | 3300053139 | Ga0500568_0000579 | Ga0500568_0000579_13685_13900 | 71 |
| 248 | 3300053139 | Ga0500568_0001306 | Ga0500568_0001306_3674_3895 | 71 |
| 249 | 3300053153 | Ga0500616_0000483 | Ga0500616_0000483_33197_33412 | 71 |
| 250 | 3300053158 | Ga0500627_0000033 | Ga0500627_0000033_30403_30618 | 71 |
| 251 | 3300053739 | Ga0500587_002647 | Ga0500587_002647_1097_1312 | 71 |
| 252 | 3300060353 | Ga0501082_1811764 | Ga0501082_1811764_16_282 | 71 |
| 253 | iso_pu_bacteria | 8055066027 | 8055071622 | 71 |
| 254 | 3300002737 | JGI25162J39368_1001151 | JGI25162J39368_100115116 | 72 |
| 255 | 3300002772 | JGI25164J39214_1000193 | JGI25164J39214_10001933 | 72 |
| 256 | 3300003203 | JGI25406J46586_10008343 | JGI25406J46586_100083432 | 72 |
| 257 | 3300003214 | JGI25165J46597_1002787 | JGI25165J46597_10027872 | 72 |
| 258 | 3300003781 | Ga0055536_1000881 | Ga0055536_100088113 | 72 |
| 259 | 3300003784 | Ga0055534_1012732 | Ga0055534_10127323 | 72 |
| 260 | 3300003791 | Ga0055530_10000083 | Ga0055530_1000008338 | 72 |
| 261 | 3300003794 | Ga0055531_10000316 | Ga0055531_1000031623 | 72 |
| 262 | 3300003794 | Ga0055531_10000471 | Ga0055531_1000047113 | 72 |
| 263 | 3300005328 | Ga0070676_10647695 | Ga0070676_106476951 | 72 |
| 264 | 3300005329 | Ga0070683_100510778 | Ga0070683_1005107782 | 72 |
| 265 | 3300005337 | Ga0070682_101217754 | Ga0070682_1012177542 | 72 |
| 266 | 3300005354 | Ga0070675_102085755 | Ga0070675_1020857551 | 72 |
| 267 | 3300005356 | Ga0070674_100215252 | Ga0070674_1002152522 | 72 |
| 268 | 3300005366 | Ga0070659_100272920 | Ga0070659_1002729202 | 72 |
| 269 | 3300005455 | Ga0070663_101953464 | Ga0070663_1019534642 | 72 |
| 270 | 3300005456 | Ga0070678_100613431 | Ga0070678_1006134312 | 72 |
| 271 | 3300005459 | Ga0068867_101404169 | Ga0068867_1014041692 | 72 |
| 272 | 3300005466 | Ga0070685_11208280 | Ga0070685_112082801 | 72 |
| 273 | 3300005539 | Ga0068853_100332802 | Ga0068853_1003328022 | 72 |
| 274 | 3300005543 | Ga0070672_100739513 | Ga0070672_1007395132 | 72 |
| 275 | 3300005563 | Ga0068855_100526038 | Ga0068855_1005260382 | 72 |
| 276 | 3300005577 | Ga0068857_100222158 | Ga0068857_1002221582 | 72 |
| 277 | 3300005578 | Ga0068854_100149362 | Ga0068854_1001493622 | 72 |
| 278 | 3300005614 | Ga0068856_100329500 | Ga0068856_1003295002 | 72 |
| 279 | 3300005616 | Ga0068852_100167782 | Ga0068852_1001677822 | 72 |
| 280 | 3300005618 | Ga0068864_101523652 | Ga0068864_1015236522 | 72 |
| 281 | 3300005834 | Ga0068851_10156768 | Ga0068851_101567682 | 72 |
| 282 | 3300005981 | Ga0081538_10010782 | Ga0081538_100107826 | 72 |
| 283 | 3300005981 | Ga0081538_10014870 | Ga0081538_100148703 | 72 |
| 284 | 3300005983 | Ga0081540_1333233 | Ga0081540_13332331 | 72 |
| 285 | 3300005985 | Ga0081539_10000031 | Ga0081539_1000003161 | 72 |
| 286 | 3300005985 | Ga0081539_10005625 | Ga0081539_1000562510 | 72 |
| 287 | 3300006028 | Ga0070717_10373130 | Ga0070717_103731303 | 72 |
| 288 | 3300006237 | Ga0097621_101819940 | Ga0097621_1018199402 | 72 |
| 289 | 3300006358 | Ga0068871_101418701 | Ga0068871_1014187012 | 72 |
| 290 | 3300006844 | Ga0075428_100060805 | Ga0075428_1000608056 | 72 |
| 291 | 3300006844 | Ga0075428_100296028 | Ga0075428_1002960282 | 72 |
| 292 | 3300006844 | Ga0075428_101146007 | Ga0075428_1011460071 | 72 |
| 293 | 3300006846 | Ga0075430_100281133 | Ga0075430_1002811333 | 72 |
| 294 | 3300006846 | Ga0075430_100281285 | Ga0075430_1002812852 | 72 |
| 295 | 3300009093 | Ga0105240_12744205 | Ga0105240_127442052 | 72 |
| 296 | 3300009098 | Ga0105245_10825292 | Ga0105245_108252922 | 72 |
| 297 | 3300009147 | Ga0114129_11287969 | Ga0114129_112879692 | 72 |
| 298 | 3300009148 | Ga0105243_12374845 | Ga0105243_123748452 | 72 |
| 299 | 3300009174 | Ga0105241_10306021 | Ga0105241_103060212 | 72 |
| 300 | 3300009177 | Ga0105248_13109645 | Ga0105248_131096452 | 72 |
| 301 | 3300009545 | Ga0105237_12230094 | Ga0105237_122300941 | 72 |
| 302 | 3300009551 | Ga0105238_11746619 | Ga0105238_117466192 | 72 |
| 303 | 3300009553 | Ga0105249_11315807 | Ga0105249_113158072 | 72 |
| 304 | 3300010375 | Ga0105239_11030265 | Ga0105239_110302652 | 72 |
| 305 | 3300011119 | Ga0105246_10335082 | Ga0105246_103350822 | 72 |
| 306 | 3300013102 | Ga0157371_10228588 | Ga0157371_102285882 | 72 |
| 307 | 3300013296 | Ga0157374_11836986 | Ga0157374_118369862 | 72 |
| 308 | 3300013297 | Ga0157378_10451454 | Ga0157378_104514542 | 72 |
| 309 | 3300013306 | Ga0163162_13391211 | Ga0163162_133912112 | 72 |
| 310 | 3300013307 | Ga0157372_10477147 | Ga0157372_104771472 | 72 |
| 311 | 3300014325 | Ga0163163_10537637 | Ga0163163_105376372 | 72 |
| 312 | 3300014325 | Ga0163163_10822956 | Ga0163163_108229562 | 72 |
| 313 | 3300025231 | Ga0207427_100117 | Ga0207427_10011748 | 72 |
| 314 | 3300025233 | Ga0209437_100240 | Ga0209437_10024064 | 72 |
| 315 | 3300025245 | Ga0207425_1057180 | Ga0207425_10571802 | 72 |
| 316 | 3300025261 | Ga0209233_1000083 | Ga0209233_1000083271 | 72 |
| 317 | 3300025291 | Ga0209675_1000190 | Ga0209675_100019055 | 72 |
| 318 | 3300025292 | Ga0209676_1000133 | Ga0209676_100013376 | 72 |
| 319 | 3300025294 | Ga0209025_1010719 | Ga0209025_10107192 | 72 |
| 320 | 3300025297 | Ga0209758_1049652 | Ga0209758_10496522 | 72 |
| 321 | 3300025298 | Ga0209050_1000067 | Ga0209050_100006770 | 72 |
| 322 | 3300025304 | Ga0209257_1000132 | Ga0209257_1000132111 | 72 |
| 323 | 3300025904 | Ga0207647_10411857 | Ga0207647_104118572 | 72 |
| 324 | 3300025907 | Ga0207645_10116341 | Ga0207645_101163413 | 72 |
| 325 | 3300025909 | Ga0207705_10367377 | Ga0207705_103673772 | 72 |
| 326 | 3300025919 | Ga0207657_10035367 | Ga0207657_100353672 | 72 |
| 327 | 3300025920 | Ga0207649_10881004 | Ga0207649_108810041 | 72 |
| 328 | 3300025924 | Ga0207694_11238840 | Ga0207694_112388402 | 72 |
| 329 | 3300025925 | Ga0207650_10781690 | Ga0207650_107816902 | 72 |
| 330 | 3300025932 | Ga0207690_10741930 | Ga0207690_107419302 | 72 |
| 331 | 3300025937 | Ga0207669_10074994 | Ga0207669_100749943 | 72 |
| 332 | 3300025937 | Ga0207669_10264549 | Ga0207669_102645492 | 72 |
| 333 | 3300025938 | Ga0207704_10362856 | Ga0207704_103628563 | 72 |
| 334 | 3300025940 | Ga0207691_10079523 | Ga0207691_100795233 | 72 |
| 335 | 3300025941 | Ga0207711_11572865 | Ga0207711_115728652 | 72 |
| 336 | 3300025981 | Ga0207640_10199242 | Ga0207640_101992422 | 72 |
| 337 | 3300026023 | Ga0207677_10526855 | Ga0207677_105268553 | 72 |
| 338 | 3300026041 | Ga0207639_10319783 | Ga0207639_103197832 | 72 |
| 339 | 3300026067 | Ga0207678_10351367 | Ga0207678_103513672 | 72 |
| 340 | 3300026078 | Ga0207702_10461881 | Ga0207702_104618812 | 72 |
| 341 | 3300026089 | Ga0207648_10152652 | Ga0207648_101526522 | 72 |
| 342 | 3300026116 | Ga0207674_10237339 | Ga0207674_102373392 | 72 |
| 343 | 3300026121 | Ga0207683_10078463 | Ga0207683_100784633 | 72 |
| 344 | 3300026121 | Ga0207683_11591408 | Ga0207683_115914082 | 72 |
| 345 | 3300026142 | Ga0207698_10234988 | Ga0207698_102349882 | 72 |
| 346 | 3300028379 | Ga0268266_10582547 | Ga0268266_105825472 | 72 |
| 347 | 3300028794 | Ga0307515_10266044 | Ga0307515_102660443 | 72 |
| 348 | 3300031456 | Ga0307513_10039349 | Ga0307513_100393492 | 72 |
| 349 | 3300031456 | Ga0307513_10057618 | Ga0307513_100576182 | 72 |
| 350 | 3300031649 | Ga0307514_10455589 | Ga0307514_104555892 | 72 |
| 351 | 3300031731 | Ga0307405_10004380 | Ga0307405_100043803 | 72 |
| 352 | 3300031824 | Ga0307413_10632019 | Ga0307413_106320192 | 72 |
| 353 | 3300031852 | Ga0307410_10276253 | Ga0307410_102762532 | 72 |
| 354 | 3300031901 | Ga0307406_10064232 | Ga0307406_100642323 | 72 |
| 355 | 3300031903 | Ga0307407_10030591 | Ga0307407_100305913 | 72 |
| 356 | 3300031995 | Ga0307409_100001766 | Ga0307409_1000017664 | 72 |
| 357 | 3300031995 | Ga0307409_100760076 | Ga0307409_1007600763 | 72 |
| 358 | 3300032002 | Ga0307416_100001803 | Ga0307416_1000018039 | 72 |
| 359 | 3300032002 | Ga0307416_103893144 | Ga0307416_1038931441 | 72 |
| 360 | 3300032005 | Ga0307411_10095633 | Ga0307411_100956333 | 72 |
| 361 | 3300032126 | Ga0307415_100000474 | Ga0307415_10000047414 | 72 |
| 362 | 3300032126 | Ga0307415_100021712 | Ga0307415_1000217124 | 72 |
| 363 | 3300033179 | Ga0307507_10180177 | Ga0307507_101801772 | 72 |
| 364 | 3300034816 | Ga0373930_0108231 | Ga0373930_0108231_388_612 | 72 |
| 365 | 3300034818 | Ga0373950_0114526 | Ga0373950_0114526_328_552 | 72 |
| 366 | 3300035090 | Ga0373949_0098244 | Ga0373949_0098244_38_262 | 72 |
| 367 | 3300035091 | Ga0373951_0043290 | Ga0373951_0043290_688_912 | 72 |
| 368 | 3300035207 | Ga0373942_0056356 | Ga0373942_0056356_14_238 | 72 |
| 369 | 3300035691 | Ga0373931_0174036 | Ga0373931_0174036_560_784 | 72 |
| 370 | 3300041494 | Ga0451837_0362053 | Ga0451837_0362053_239_463 | 72 |
| 371 | 3300042003 | Ga0439443_112236 | Ga0439443_112236_287_511 | 72 |
| 372 | 3300042005 | Ga0439448_0088988 | Ga0439448_0088988_459_680 | 72 |
| 373 | 3300042012 | Ga0439455_0128108 | Ga0439455_0128108_455_679 | 72 |
| 374 | 3300042016 | Ga0439463_003783 | Ga0439463_003783_91_315 | 72 |
| 375 | 3300042437 | Ga0439444_0007107 | Ga0439444_0007107_218_439 | 72 |
| 376 | 3300042993 | Ga0439440_0003715 | Ga0439440_0003715_2025_2249 | 72 |
| 377 | 3300044712 | Ga0453684_1795378 | Ga0453684_1795378_163_387 | 72 |
| 378 | 3300048911 | Ga0496108_0552054 | Ga0496108_0552054_546_770 | 72 |
| 379 | 3300048917 | Ga0496114_1798236 | Ga0496114_1798236_23_247 | 72 |
| 380 | 3300049586 | Ga0501070_1086066 | Ga0501070_1086066_89_313 | 72 |
| 381 | 3300050507 | nmdc:mga05p37_377472_c1 | nmdc:mga05p37_377472_c1_95_319 | 72 |
| 382 | 3300050508 | nmdc:mga09592_279328_c1 | nmdc:mga09592_279328_c1_873_1097 | 72 |
| 383 | 3300050509 | nmdc:mga0qj67_614143_c1 | nmdc:mga0qj67_614143_c1_560_784 | 72 |
| 384 | 3300053139 | Ga0500568_0007771 | Ga0500568_0007771_4304_4528 | 72 |
| 385 | 3300005337 | Ga0070682_100401525 | Ga0070682_1004015252 | 73 |
| 386 | 3300005434 | Ga0070709_10479550 | Ga0070709_104795502 | 73 |
| 387 | 3300005435 | Ga0070714_100667222 | Ga0070714_1006672222 | 73 |
| 388 | 3300005435 | Ga0070714_102058694 | Ga0070714_1020586942 | 73 |
| 389 | 3300005436 | Ga0070713_102038550 | Ga0070713_1020385502 | 73 |
| 390 | 3300005439 | Ga0070711_101433367 | Ga0070711_1014333672 | 73 |
| 391 | 3300005458 | Ga0070681_10659586 | Ga0070681_106595862 | 73 |
| 392 | 3300005539 | Ga0068853_100049917 | Ga0068853_1000499175 | 73 |
| 393 | 3300005578 | Ga0068854_100942091 | Ga0068854_1009420912 | 73 |
| 394 | 3300006028 | Ga0070717_11174617 | Ga0070717_111746172 | 73 |
| 395 | 3300006163 | Ga0070715_10342781 | Ga0070715_103427812 | 73 |
| 396 | 3300006178 | Ga0075367_10352424 | Ga0075367_103524243 | 73 |
| 397 | 3300006237 | Ga0097621_100136148 | Ga0097621_1001361483 | 73 |
| 398 | 3300009148 | Ga0105243_10087416 | Ga0105243_100874163 | 73 |
| 399 | 3300009551 | Ga0105238_10406366 | Ga0105238_104063663 | 73 |
| 400 | 3300013296 | Ga0157374_12744168 | Ga0157374_127441682 | 73 |
| 401 | 3300025231 | Ga0207427_100178 | Ga0207427_10017824 | 73 |
| 402 | 3300025233 | Ga0209437_100304 | Ga0209437_10030424 | 73 |
| 403 | 3300025261 | Ga0209233_1000287 | Ga0209233_100028754 | 73 |
| 404 | 3300025906 | Ga0207699_10111832 | Ga0207699_101118322 | 73 |
| 405 | 3300025912 | Ga0207707_10751055 | Ga0207707_107510552 | 73 |
| 406 | 3300025924 | Ga0207694_11578562 | Ga0207694_115785622 | 73 |
| 407 | 3300026041 | Ga0207639_10239950 | Ga0207639_102399503 | 73 |
| 408 | 3300026095 | Ga0207676_12320614 | Ga0207676_123206142 | 73 |
| 409 | 3300026118 | Ga0207675_100859877 | Ga0207675_1008598772 | 73 |
| 410 | 3300026142 | Ga0207698_10093412 | Ga0207698_100934121 | 73 |
| 411 | 3300028379 | Ga0268266_10191605 | Ga0268266_101916052 | 73 |
| 412 | 3300028794 | Ga0307515_10131481 | Ga0307515_101314813 | 73 |
| 413 | 3300030731 | Ga0316177_1074352 | Ga0316177_10743526 | 73 |
| 414 | 3300030733 | Ga0314311_1196854 | Ga0314311_11968542 | 73 |
| 415 | 3300030734 | Ga0316179_1070522 | Ga0316179_10705222 | 73 |
| 416 | 3300030736 | Ga0316180_1192092 | Ga0316180_11920922 | 73 |
| 417 | 3300031238 | Ga0265332_10038706 | Ga0265332_100387062 | 73 |
| 418 | 3300031616 | Ga0307508_10000982 | Ga0307508_100009824 | 73 |
| 419 | 3300031616 | Ga0307508_10156710 | Ga0307508_101567103 | 73 |
| 420 | 3300031727 | Ga0316576_10568221 | Ga0316576_105682212 | 73 |
| 421 | 3300031901 | Ga0307406_11519107 | Ga0307406_115191072 | 73 |
| 422 | 3300032126 | Ga0307415_100388983 | Ga0307415_1003889833 | 73 |
| 423 | 3300033179 | Ga0307507_10167399 | Ga0307507_101673993 | 73 |
| 424 | 3300033179 | Ga0307507_10543021 | Ga0307507_105430212 | 73 |
| 425 | 3300034817 | Ga0373948_0028553 | Ga0373948_0028553_647_874 | 73 |
| 426 | 3300035116 | Ga0373945_0392158 | Ga0373945_0392158_195_422 | 73 |
| 427 | 3300035692 | Ga0373935_0986847 | Ga0373935_0986847_73_300 | 73 |
| 428 | 3300035695 | Ga0373927_0122036 | Ga0373927_0122036_75_302 | 73 |
| 429 | 3300035725 | Ga0373947_0549319 | Ga0373947_0549319_489_716 | 73 |
| 430 | 3300041459 | Ga0451800_1361167 | Ga0451800_1361167_128_352 | 73 |
| 431 | 3300041501 | Ga0451845_0281309 | Ga0451845_0281309_229_462 | 73 |
| 432 | 3300042461 | Ga0439460_0106062 | Ga0439460_0106062_155_385 | 73 |
| 433 | 3300044658 | Ga0466972_0006222 | Ga0466972_0006222_4933_5157 | 73 |
| 434 | 3300044658 | Ga0466972_0034255 | Ga0466972_0034255_407_631 | 73 |
| 435 | 3300044683 | Ga0466965_0004824 | Ga0466965_0004824_4409_4633 | 73 |
| 436 | 3300044683 | Ga0466965_0024589 | Ga0466965_0024589_1599_1823 | 73 |
| 437 | 3300044683 | Ga0466965_0080173 | Ga0466965_0080173_335_559 | 73 |
| 438 | 3300044735 | Ga0466968_0348785 | Ga0466968_0348785_473_697 | 73 |
| 439 | 3300044901 | Ga0466960_0002929 | Ga0466960_0002929_4989_5213 | 73 |
| 440 | 3300045836 | Ga0466958_0665711 | Ga0466958_0665711_375_596 | 73 |
| 441 | 3300046529 | Ga0495652_0056439 | Ga0495652_0056439_1673_1930 | 73 |
| 442 | 3300046559 | Ga0495667_0515082 | Ga0495667_0515082_183_410 | 73 |
| 443 | 3300046616 | Ga0495668_0000076 | Ga0495668_0000076_87255_87482 | 73 |
| 444 | 3300046689 | Ga0495613_0007953 | Ga0495613_0007953_6630_6887 | 73 |
| 445 | 3300048911 | Ga0496108_0050519 | Ga0496108_0050519_2328_2555 | 73 |
| 446 | 3300049568 | Ga0501031_0006336 | Ga0501031_0006336_818_1039 | 73 |
| 447 | 3300049569 | Ga0501032_0007789 | Ga0501032_0007789_6082_6309 | 73 |
| 448 | 3300049571 | Ga0501034_0020575 | Ga0501034_0020575_5538_5759 | 73 |
| 449 | 3300049572 | Ga0501036_0016024 | Ga0501036_0016024_1958_2179 | 73 |
| 450 | 3300049573 | Ga0501037_0007234 | Ga0501037_0007234_1804_2025 | 73 |
| 451 | 3300049574 | Ga0501038_0002697 | Ga0501038_0002697_1406_1627 | 73 |
| 452 | 3300049575 | Ga0501039_0036194 | Ga0501039_0036194_3253_3474 | 73 |
| 453 | 3300049579 | Ga0501043_0408169 | Ga0501043_0408169_208_429 | 73 |
| 454 | 3300049581 | Ga0501047_0410547 | Ga0501047_0410547_93_314 | 73 |
| 455 | 3300049584 | Ga0501068_0551553 | Ga0501068_0551553_180_401 | 73 |
| 456 | 3300049586 | Ga0501070_0047409 | Ga0501070_0047409_2470_2691 | 73 |
| 457 | 3300049587 | Ga0501071_0060455 | Ga0501071_0060455_275_496 | 73 |
| 458 | 3300049589 | Ga0501073_0093284 | Ga0501073_0093284_313_534 | 73 |
| 459 | 3300049741 | Ga0501079_0226637 | Ga0501079_0226637_37_264 | 73 |
| 460 | 3300049742 | Ga0501080_0005871 | Ga0501080_0005871_9895_10116 | 73 |
| 461 | 3300049822 | Ga0501035_0005602 | Ga0501035_0005602_9854_10075 | 73 |
| 462 | 3300049823 | Ga0501044_0021291 | Ga0501044_0021291_5728_5949 | 73 |
| 463 | 3300050494 | nmdc:mga06z11_233351_c1 | nmdc:mga06z11_233351_c1_243_479 | 73 |
| 464 | 3300053159 | Ga0500630_212903 | Ga0500630_212903_161_388 | 73 |
| 465 | 3300005435 | Ga0070714_100251451 | Ga0070714_1002514512 | 74 |
| 466 | 3300005436 | Ga0070713_100783548 | Ga0070713_1007835482 | 74 |
| 467 | 3300006028 | Ga0070717_10647106 | Ga0070717_106471062 | 74 |
| 468 | 3300006353 | Ga0075370_10512175 | Ga0075370_105121752 | 74 |
| 469 | 3300013105 | Ga0157369_11550829 | Ga0157369_115508292 | 74 |
| 470 | 3300013307 | Ga0157372_11079996 | Ga0157372_110799962 | 74 |
| 471 | 3300025937 | Ga0207669_10871387 | Ga0207669_108713872 | 74 |
| 472 | 3300028381 | Ga0268264_12544760 | Ga0268264_125447601 | 74 |
| 473 | 3300035089 | Ga0373944_0000077 | Ga0373944_0000077_154_384 | 74 |
| 474 | 3300037068 | Ga0373925_1245752 | Ga0373925_1245752_132_362 | 74 |
| 475 | 3300042876 | Ga0451577_0360951 | Ga0451577_0360951_1044_1274 | 74 |
| 476 | 3300044712 | Ga0453684_1498242 | Ga0453684_1498242_98_328 | 74 |
| 477 | 3300045051 | Ga0451576_1051167 | Ga0451576_1051167_12_242 | 74 |
| 478 | 3300046457 | Ga0495590_0000142 | Ga0495590_0000142_22115_22345 | 74 |
| 479 | 3300047319 | Ga0495674_1162484 | Ga0495674_1162484_291_521 | 74 |
| 480 | 3300049591 | Ga0501075_0409525 | Ga0501075_0409525_241_474 | 74 |
| 481 | 3300050496 | nmdc:mga07m45_622177_c1 | nmdc:mga07m45_622177_c1_202_432 | 74 |
| 482 | 3300005347 | Ga0070668_100001537 | Ga0070668_1000015373 | 75 |
| 483 | 3300005355 | Ga0070671_100294218 | Ga0070671_1002942182 | 75 |
| 484 | 3300005367 | Ga0070667_100746727 | Ga0070667_1007467272 | 75 |
| 485 | 3300005435 | Ga0070714_100131487 | Ga0070714_1001314873 | 75 |
| 486 | 3300005435 | Ga0070714_100262180 | Ga0070714_1002621801 | 75 |
| 487 | 3300005435 | Ga0070714_100315078 | Ga0070714_1003150782 | 75 |
| 488 | 3300005436 | Ga0070713_100052825 | Ga0070713_1000528253 | 75 |
| 489 | 3300005436 | Ga0070713_100936841 | Ga0070713_1009368412 | 75 |
| 490 | 3300005437 | Ga0070710_10219626 | Ga0070710_102196262 | 75 |
| 491 | 3300005439 | Ga0070711_100390132 | Ga0070711_1003901322 | 75 |
| 492 | 3300005444 | Ga0070694_100358186 | Ga0070694_1003581862 | 75 |
| 493 | 3300005456 | Ga0070678_100143013 | Ga0070678_1001430133 | 75 |
| 494 | 3300005458 | Ga0070681_10678629 | Ga0070681_106786291 | 75 |
| 495 | 3300005467 | Ga0070706_100048867 | Ga0070706_1000488678 | 75 |
| 496 | 3300005468 | Ga0070707_100044377 | Ga0070707_1000443777 | 75 |
| 497 | 3300005471 | Ga0070698_100010358 | Ga0070698_10001035810 | 75 |
| 498 | 3300005536 | Ga0070697_100615900 | Ga0070697_1006159002 | 75 |
| 499 | 3300005549 | Ga0070704_100821138 | Ga0070704_1008211381 | 75 |
| 500 | 3300005617 | Ga0068859_101407770 | Ga0068859_1014077702 | 75 |
| 501 | 3300005719 | Ga0068861_102700909 | Ga0068861_1027009091 | 75 |
| 502 | 3300005844 | Ga0068862_100079586 | Ga0068862_1000795863 | 75 |
| 503 | 3300006028 | Ga0070717_10629681 | Ga0070717_106296812 | 75 |
| 504 | 3300006051 | Ga0075364_10000319 | Ga0075364_100003192 | 75 |
| 505 | 3300006175 | Ga0070712_101482202 | Ga0070712_1014822022 | 75 |
| 506 | 3300006931 | Ga0097620_101407217 | Ga0097620_1014072172 | 75 |
| 507 | 3300007076 | Ga0075435_100203864 | Ga0075435_1002038644 | 75 |
| 508 | 3300009098 | Ga0105245_12622452 | Ga0105245_126224522 | 75 |
| 509 | 3300009101 | Ga0105247_10901630 | Ga0105247_109016302 | 75 |
| 510 | 3300009174 | Ga0105241_10609471 | Ga0105241_106094712 | 75 |
| 511 | 3300009176 | Ga0105242_11368600 | Ga0105242_113686002 | 75 |
| 512 | 3300009545 | Ga0105237_11035751 | Ga0105237_110357511 | 75 |
| 513 | 3300013308 | Ga0157375_10367893 | Ga0157375_103678933 | 75 |
| 514 | 3300014325 | Ga0163163_10787261 | Ga0163163_107872612 | 75 |
| 515 | 3300021388 | Ga0213875_10156232 | Ga0213875_101562322 | 75 |
| 516 | 3300021441 | Ga0213871_10318033 | Ga0213871_103180331 | 75 |
| 517 | 3300025898 | Ga0207692_10083028 | Ga0207692_100830282 | 75 |
| 518 | 3300025898 | Ga0207692_10193017 | Ga0207692_101930172 | 75 |
| 519 | 3300025905 | Ga0207685_10018699 | Ga0207685_100186992 | 75 |
| 520 | 3300025906 | Ga0207699_10024767 | Ga0207699_100247672 | 75 |
| 521 | 3300025911 | Ga0207654_11230431 | Ga0207654_112304312 | 75 |
| 522 | 3300025912 | Ga0207707_11302133 | Ga0207707_113021332 | 75 |
| 523 | 3300025916 | Ga0207663_10002596 | Ga0207663_100025962 | 75 |
| 524 | 3300025916 | Ga0207663_10141095 | Ga0207663_101410952 | 75 |
| 525 | 3300025922 | Ga0207646_10070154 | Ga0207646_100701546 | 75 |
| 526 | 3300025928 | Ga0207700_10118124 | Ga0207700_101181243 | 75 |
| 527 | 3300025928 | Ga0207700_10251023 | Ga0207700_102510232 | 75 |
| 528 | 3300025928 | Ga0207700_10425100 | Ga0207700_104251003 | 75 |
| 529 | 3300025929 | Ga0207664_10050661 | Ga0207664_100506615 | 75 |
| 530 | 3300025929 | Ga0207664_10057619 | Ga0207664_100576194 | 75 |
| 531 | 3300025929 | Ga0207664_11269803 | Ga0207664_112698032 | 75 |
| 532 | 3300025929 | Ga0207664_12020098 | Ga0207664_120200982 | 75 |
| 533 | 3300025931 | Ga0207644_10265936 | Ga0207644_102659362 | 75 |
| 534 | 3300025972 | Ga0207668_10002726 | Ga0207668_100027267 | 75 |
| 535 | 3300026078 | Ga0207702_10992056 | Ga0207702_109920562 | 75 |
| 536 | 3300026121 | Ga0207683_10082829 | Ga0207683_100828293 | 75 |
| 537 | 3300028380 | Ga0268265_10128320 | Ga0268265_101283203 | 75 |
| 538 | 3300028381 | Ga0268264_10529249 | Ga0268264_105292492 | 75 |
| 539 | 3300028556 | Ga0265337_1012858 | Ga0265337_10128583 | 75 |
| 540 | 3300028573 | Ga0265334_10066814 | Ga0265334_100668142 | 75 |
| 541 | 3300028786 | Ga0307517_10100813 | Ga0307517_101008133 | 75 |
| 542 | 3300028794 | Ga0307515_10267568 | Ga0307515_102675682 | 75 |
| 543 | 3300028800 | Ga0265338_10014544 | Ga0265338_100145442 | 75 |
| 544 | 3300030522 | Ga0307512_10065896 | Ga0307512_100658965 | 75 |
| 545 | 3300031240 | Ga0265320_10066844 | Ga0265320_100668442 | 75 |
| 546 | 3300031247 | Ga0265340_10046521 | Ga0265340_100465212 | 75 |
| 547 | 3300031456 | Ga0307513_10052583 | Ga0307513_100525834 | 75 |
| 548 | 3300031456 | Ga0307513_10137835 | Ga0307513_101378354 | 75 |
| 549 | 3300031616 | Ga0307508_10006260 | Ga0307508_1000626012 | 75 |
| 550 | 3300031711 | Ga0265314_10633917 | Ga0265314_106339172 | 75 |
| 551 | 3300031712 | Ga0265342_10396499 | Ga0265342_103964992 | 75 |
| 552 | 3300031731 | Ga0307405_10730310 | Ga0307405_107303102 | 75 |
| 553 | 3300031731 | Ga0307405_11427876 | Ga0307405_114278761 | 75 |
| 554 | 3300031824 | Ga0307413_10321075 | Ga0307413_103210752 | 75 |
| 555 | 3300032002 | Ga0307416_100326028 | Ga0307416_1003260283 | 75 |
| 556 | 3300032005 | Ga0307411_10399589 | Ga0307411_103995892 | 75 |
| 557 | 3300032126 | Ga0307415_100051999 | Ga0307415_1000519993 | 75 |
| 558 | 3300034957 | Ga0373938_0018605 | Ga0373938_0018605_544_777 | 75 |
| 559 | 3300035088 | Ga0373940_0025238 | Ga0373940_0025238_1126_1359 | 75 |
| 560 | 3300035092 | Ga0373952_0031345 | Ga0373952_0031345_376_609 | 75 |
| 561 | 3300035112 | Ga0373932_0021233 | Ga0373932_0021233_50_283 | 75 |
| 562 | 3300035114 | Ga0373939_0093425 | Ga0373939_0093425_334_567 | 75 |
| 563 | 3300035115 | Ga0373941_0031995 | Ga0373941_0031995_223_456 | 75 |
| 564 | 3300035207 | Ga0373942_0079692 | Ga0373942_0079692_589_822 | 75 |
| 565 | 3300035242 | Ga0373962_0050915 | Ga0373962_0050915_489_722 | 75 |
| 566 | 3300037853 | Ga0436364_0426719 | Ga0436364_0426719_425_658 | 75 |
| 567 | 3300039438 | Ga0436360_0757575 | Ga0436360_0757575_320_553 | 75 |
| 568 | 3300044706 | Ga0466964_0267678 | Ga0466964_0267678_155_388 | 75 |
| 569 | 3300045836 | Ga0466958_0461230 | Ga0466958_0461230_576_809 | 75 |
| 570 | 3300045976 | Ga0466967_0626685 | Ga0466967_0626685_783_1016 | 75 |
| 571 | 3300046457 | Ga0495590_0354702 | Ga0495590_0354702_301_534 | 75 |
| 572 | 3300046460 | Ga0495638_0161366 | Ga0495638_0161366_609_842 | 75 |
| 573 | 3300046519 | Ga0495632_0073382 | Ga0495632_0073382_448_681 | 75 |
| 574 | 3300048903 | Ga0496100_0334565 | Ga0496100_0334565_823_1056 | 75 |
| 575 | 3300048904 | Ga0496101_0181641 | Ga0496101_0181641_1238_1471 | 75 |
| 576 | 3300048906 | Ga0496103_0433247 | Ga0496103_0433247_236_469 | 75 |
| 577 | 3300048907 | Ga0496104_0824352 | Ga0496104_0824352_571_804 | 75 |
| 578 | 3300048908 | Ga0496105_0373456 | Ga0496105_0373456_643_876 | 75 |
| 579 | 3300048909 | Ga0496106_0620301 | Ga0496106_0620301_566_799 | 75 |
| 580 | 3300048911 | Ga0496108_0053263 | Ga0496108_0053263_1625_1858 | 75 |
| 581 | 3300048912 | Ga0496109_0293673 | Ga0496109_0293673_791_1024 | 75 |
| 582 | 3300048914 | Ga0496111_0275268 | Ga0496111_0275268_285_518 | 75 |
| 583 | 3300048915 | Ga0496112_0201159 | Ga0496112_0201159_836_1069 | 75 |
| 584 | 3300048916 | Ga0496113_0423361 | Ga0496113_0423361_462_695 | 75 |
| 585 | 3300048917 | Ga0496114_0955217 | Ga0496114_0955217_232_465 | 75 |
| 586 | 3300048918 | Ga0496115_0262684 | Ga0496115_0262684_452_685 | 75 |
| 587 | 3300050513 | nmdc:mga0rr50_1063637_c1 | nmdc:mga0rr50_1063637_c1_74_307 | 75 |
| 588 | 3300053088 | Ga0500644_0416076 | Ga0500644_0416076_243_476 | 75 |
| 589 | 3300053090 | Ga0500646_0000088 | Ga0500646_0000088_11204_11437 | 75 |
| 590 | 3300053092 | Ga0500583_0006793 | Ga0500583_0006793_1182_1415 | 75 |
| 591 | 3300053098 | Ga0500650_0347906 | Ga0500650_0347906_141_374 | 75 |
| 592 | 3300053130 | Ga0500642_0436365 | Ga0500642_0436365_28_261 | 75 |
| 593 | 3300053131 | Ga0500652_092173 | Ga0500652_092173_498_731 | 75 |
| 594 | 3300053146 | Ga0500588_0008410 | Ga0500588_0008410_1866_2099 | 75 |
| 595 | 3300005343 | Ga0070687_100462486 | Ga0070687_1004624862 | 76 |
| 596 | 3300005347 | Ga0070668_100308425 | Ga0070668_1003084252 | 76 |
| 597 | 3300005456 | Ga0070678_101354907 | Ga0070678_1013549072 | 76 |
| 598 | 3300025918 | Ga0207662_11254655 | Ga0207662_112546552 | 76 |
| 599 | 3300025939 | Ga0207665_11587826 | Ga0207665_115878262 | 76 |
| 600 | 3300025972 | Ga0207668_10553277 | Ga0207668_105532772 | 76 |
| 601 | 3300026121 | Ga0207683_11210987 | Ga0207683_112109872 | 76 |
| 602 | 3300039450 | Ga0436363_1235171 | Ga0436363_1235171_237_476 | 76 |
| 603 | 3300048913 | Ga0496110_0657889 | Ga0496110_0657889_79_312 | 76 |
| 604 | 3300049823 | Ga0501044_0084557 | Ga0501044_0084557_2436_2681 | 76 |
| 605 | 3300005439 | Ga0070711_100241133 | Ga0070711_1002411332 | 77 |
| 606 | 3300006028 | Ga0070717_10058801 | Ga0070717_100588016 | 77 |
| 607 | 3300006173 | Ga0070716_100005185 | Ga0070716_1000051855 | 77 |
| 608 | 3300006175 | Ga0070712_100014705 | Ga0070712_1000147054 | 77 |
| 609 | 3300025898 | Ga0207692_10441061 | Ga0207692_104410612 | 77 |
| 610 | 3300025915 | Ga0207693_10074932 | Ga0207693_100749326 | 77 |
| 611 | 3300025916 | Ga0207663_10178568 | Ga0207663_101785682 | 77 |
| 612 | 3300025929 | Ga0207664_10072930 | Ga0207664_100729306 | 77 |
| 613 | 3300025939 | Ga0207665_10005367 | Ga0207665_100053679 | 77 |
| 614 | 3300028794 | Ga0307515_10471046 | Ga0307515_104710462 | 77 |
| 615 | 3300028794 | Ga0307515_10703115 | Ga0307515_107031152 | 77 |
| 616 | 3300037588 | Ga0316581_0244265 | Ga0316581_0244265_122_385 | 77 |
| 617 | 3300049573 | Ga0501037_0473920 | Ga0501037_0473920_334_573 | 77 |
| 618 | 3300049574 | Ga0501038_0798481 | Ga0501038_0798481_132_371 | 77 |
| 619 | 3300049583 | Ga0501067_0236819 | Ga0501067_0236819_221_460 | 77 |
| 620 | 3300049588 | Ga0501072_0408326 | Ga0501072_0408326_652_891 | 77 |
| 621 | 3300049589 | Ga0501073_0011736 | Ga0501073_0011736_5922_6161 | 77 |
| 622 | 3300049592 | Ga0501076_1038267 | Ga0501076_1038267_212_451 | 77 |
| 623 | 3300002737 | JGI25162J39368_1000487 | JGI25162J39368_100048712 | 78 |
| 624 | 3300002772 | JGI25164J39214_1000242 | JGI25164J39214_100024212 | 78 |
| 625 | 3300003214 | JGI25165J46597_1000335 | JGI25165J46597_100033512 | 78 |
| 626 | 3300003763 | Ga0055529_1005418 | Ga0055529_10054182 | 78 |
| 627 | 3300005327 | Ga0070658_10325314 | Ga0070658_103253141 | 78 |
| 628 | 3300005336 | Ga0070680_100300281 | Ga0070680_1003002813 | 78 |
| 629 | 3300005337 | Ga0070682_100014692 | Ga0070682_1000146924 | 78 |
| 630 | 3300005339 | Ga0070660_100313967 | Ga0070660_1003139672 | 78 |
| 631 | 3300005530 | Ga0070679_100115113 | Ga0070679_1001151131 | 78 |
| 632 | 3300005546 | Ga0070696_100151789 | Ga0070696_1001517892 | 78 |
| 633 | 3300005547 | Ga0070693_100044703 | Ga0070693_1000447032 | 78 |
| 634 | 3300005563 | Ga0068855_100032327 | Ga0068855_1000323272 | 78 |
| 635 | 3300005578 | Ga0068854_100543281 | Ga0068854_1005432812 | 78 |
| 636 | 3300005578 | Ga0068854_101309118 | Ga0068854_1013091182 | 78 |
| 637 | 3300009093 | Ga0105240_10009760 | Ga0105240_100097609 | 78 |
| 638 | 3300009174 | Ga0105241_10331389 | Ga0105241_103313893 | 78 |
| 639 | 3300009545 | Ga0105237_10000105 | Ga0105237_1000010593 | 78 |
| 640 | 3300009551 | Ga0105238_10228496 | Ga0105238_102284963 | 78 |
| 641 | 3300013105 | Ga0157369_12193137 | Ga0157369_121931372 | 78 |
| 642 | 3300013307 | Ga0157372_10136012 | Ga0157372_101360126 | 78 |
| 643 | 3300013307 | Ga0157372_10587320 | Ga0157372_105873203 | 78 |
| 644 | 3300015262 | Ga0182007_10003704 | Ga0182007_100037044 | 78 |
| 645 | 3300020070 | Ga0206356_11054920 | Ga0206356_110549207 | 78 |
| 646 | 3300020081 | Ga0206354_11349434 | Ga0206354_113494342 | 78 |
| 647 | 3300020082 | Ga0206353_11672713 | Ga0206353_116727132 | 78 |
| 648 | 3300025246 | Ga0209646_1002600 | Ga0209646_10026002 | 78 |
| 649 | 3300025250 | Ga0209026_1000111 | Ga0209026_100011124 | 78 |
| 650 | 3300025272 | Ga0209455_1000211 | Ga0209455_100021110 | 78 |
| 651 | 3300025912 | Ga0207707_10459635 | Ga0207707_104596352 | 78 |
| 652 | 3300025913 | Ga0207695_10001623 | Ga0207695_100016238 | 78 |
| 653 | 3300025914 | Ga0207671_10004557 | Ga0207671_1000455715 | 78 |
| 654 | 3300025917 | Ga0207660_10283964 | Ga0207660_102839641 | 78 |
| 655 | 3300025919 | Ga0207657_10164681 | Ga0207657_101646812 | 78 |
| 656 | 3300025921 | Ga0207652_10030206 | Ga0207652_100302063 | 78 |
| 657 | 3300025924 | Ga0207694_10692513 | Ga0207694_106925132 | 78 |
| 658 | 3300025949 | Ga0207667_10297189 | Ga0207667_102971892 | 78 |
| 659 | 3300025949 | Ga0207667_11731711 | Ga0207667_117317112 | 78 |
| 660 | 3300025981 | Ga0207640_10257802 | Ga0207640_102578022 | 78 |
| 661 | 3300026067 | Ga0207678_10115363 | Ga0207678_101153635 | 78 |
| 662 | 3300026067 | Ga0207678_11930447 | Ga0207678_119304471 | 78 |
| 663 | 3300026116 | Ga0207674_11290391 | Ga0207674_112903911 | 78 |
| 664 | 3300028800 | Ga0265338_10428339 | Ga0265338_104283392 | 78 |
| 665 | 3300031250 | Ga0265331_10085819 | Ga0265331_100858193 | 78 |
| 666 | 3300039450 | Ga0436363_0434749 | Ga0436363_0434749_200_445 | 78 |
| 667 | 3300049568 | Ga0501031_0130426 | Ga0501031_0130426_793_1044 | 78 |
| 668 | 3300049569 | Ga0501032_0100594 | Ga0501032_0100594_69_320 | 78 |
| 669 | 3300049570 | Ga0501033_0004440 | Ga0501033_0004440_4052_4303 | 78 |
| 670 | 3300049570 | Ga0501033_0032102 | Ga0501033_0032102_3521_3772 | 78 |
| 671 | 3300049571 | Ga0501034_0662481 | Ga0501034_0662481_167_418 | 78 |
| 672 | 3300049572 | Ga0501036_0388556 | Ga0501036_0388556_41_292 | 78 |
| 673 | 3300049573 | Ga0501037_0238034 | Ga0501037_0238034_131_382 | 78 |
| 674 | 3300049574 | Ga0501038_0317914 | Ga0501038_0317914_952_1203 | 78 |
| 675 | 3300049575 | Ga0501039_0191013 | Ga0501039_0191013_447_698 | 78 |
| 676 | 3300049576 | Ga0501040_0270794 | Ga0501040_0270794_670_921 | 78 |
| 677 | 3300049579 | Ga0501043_0080171 | Ga0501043_0080171_1475_1726 | 78 |
| 678 | 3300049580 | Ga0501046_0092688 | Ga0501046_0092688_611_862 | 78 |
| 679 | 3300049581 | Ga0501047_0088657 | Ga0501047_0088657_1615_1866 | 78 |
| 680 | 3300049582 | Ga0501048_0075041 | Ga0501048_0075041_1753_2004 | 78 |
| 681 | 3300049586 | Ga0501070_0258622 | Ga0501070_0258622_198_449 | 78 |
| 682 | 3300049589 | Ga0501073_0082415 | Ga0501073_0082415_1544_1795 | 78 |
| 683 | 3300049822 | Ga0501035_0095557 | Ga0501035_0095557_747_998 | 78 |
| 684 | 3300049823 | Ga0501044_0196719 | Ga0501044_0196719_1252_1503 | 78 |
| 685 | 3300049824 | Ga0501045_0301488 | Ga0501045_0301488_102_353 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jxc-assembly1.cif.gz_L | crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ | 0.9643 | 10 | 63 |
| 2xj3-assembly1.cif.gz_A | high resolution structure of the t55c mutant of cylr2. | 0.9509 | 6 | 70 |
| 2xi8-assembly1.cif.gz_A | high resolution structure of native cylr2 | 0.9502 | 6 | 70 |
| 2lyk-assembly1.cif.gz_B | noe-based 3d structure of the cylr2 homodimer at 270k (-3 celsius degrees) | 0.941 | 6 | 70 |
| 2xj3-assembly1.cif.gz_B | high resolution structure of the t55c mutant of cylr2. | 0.9393 | 8 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57720_1_65_1.10.260.40 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9745 | 7 | 70 | 1.10.260.40 |
| 2lykB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.941 | 6 | 70 | 1.10.260.40 |
| 2r1jL00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9366 | 10 | 63 | 1.10.260.40 |
| 3u3wB01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.932 | 9 | 62 | 1.10.260.40 |
| af_Q57720_1_65_1.10.260.40 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9314 | 7 | 70 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A525HFM6-F1-model_v4 | Transcriptional regulator | 1.004 | 5 | 70 |
GO:0003677
|
| AF-A0A6S6FY68-F1-model_v4 | XRE family transcriptional regulator | 1.001 | 6 | 70 |
GO:0003677
|
| AF-A0A7G5HXA0-F1-model_v4 | deleted | 1.001 | 5 | 69 |
|
| AF-A0A1I0DGC6-F1-model_v4 | Putative transcriptional regulator | 1 | 5 | 69 |
GO:0003677
|
| AF-A0A1I2L6P6-F1-model_v4 | Putative transcriptional regulator | 0.9992 | 6 | 68 |
GO:0003677
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar