F475093

General Info

Members Datasets Scaffolds Average Seq Length
684 362 1368 323

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_260966_c1|nmdc:mga05p37_260966_c1_504_1610
Length 368
Sequence MISCGIGDLRQAHACGITPWRRRFVHRGGHVSSAPQEQALQGVAMPSRSVLSVVLLASAALLAASVDAGAQTYPDHLIKIVVPVGPAGSYDIVGRLLADQLSKRLGQSVIVENRPGAGTVVGTQAVINSPPDGYTLLVGGLSNIVFNAGLYQKLSYDPLNDLVPVALVFNISYTLVAYKDLPYSTPKEVIAAAKASPGALKLANAGTGTGQHILGAAFMRFTGTKFLEVPYRGSAAAFPDLLAGRVDLFVDSTPAALPYVKSGQAKGIAILSAKRSAQMPDVPTMTESGVPNLEIDSWIGLFAPAKTPPAAIARLQREIAQALPELKPRFEQNGGDVIELAPDRLKPFVASEYDKWIKIIQDAGIRLD

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
162 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
163 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
327 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
328 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
332 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
333 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
338 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
341 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
342 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
343 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
346 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
347 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
348 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
351 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
352 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
353 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
354 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
355 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
356 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
357 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
358 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
359 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
360 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
361 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
362 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.29
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.87
Nodule 1.46
Rhizoplane 8.19
Rhizosphere 78.07
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_260966_c1 3300050507 Bacteria 2073
2 JGI25406J46586_10000101 3300003203 Bacteria 38086
3 JGI25404J52841_10002278 3300003659 Bacteria 3612
4 Ga0070683_100095229 3300005329 Bacteria 2799
5 Ga0070690_100003281 3300005330 Bacteria 8841
6 Ga0070670_100006671 3300005331 Bacteria 9784
7 Ga0068869_100015522 3300005334 Bacteria 5112
8 Ga0070680_100007726 3300005336 Bacteria 8196
9 Ga0070682_100005569 3300005337 Bacteria 7015
10 Ga0070682_100308134 3300005337 Bacteria 1165
11 Ga0068868_100002449 3300005338 Bacteria 12874
12 Ga0068868_100117843 3300005338 Bacteria 2163
13 Ga0070689_100001036 3300005340 Bacteria 17435
14 Ga0070691_10001194 3300005341 Bacteria 10888
15 Ga0070687_100063187 3300005343 Bacteria 1962
16 Ga0070661_100192970 3300005344 Bacteria 1554
17 Ga0070668_100051042 3300005347 Bacteria 3186
18 Ga0070668_100077158 3300005347 Bacteria 2604
19 Ga0070669_100064121 3300005353 Bacteria 2705
20 Ga0070669_100180998 3300005353 Bacteria 1649
21 Ga0070669_100320083 3300005353 Bacteria 1252
22 Ga0070671_100115010 3300005355 Bacteria 2261
23 Ga0070674_100101727 3300005356 Bacteria 2095
24 Ga0070659_100493133 3300005366 Bacteria 1043
25 Ga0070667_100190312 3300005367 Bacteria 1818
26 Ga0070667_100446651 3300005367 Bacteria 1181
27 Ga0070714_100034531 3300005435 Bacteria 4235
28 Ga0070714_100074228 3300005435 Bacteria 2948
29 Ga0070713_100001721 3300005436 Bacteria 14092
30 Ga0070713_100017230 3300005436 Bacteria 5457
31 Ga0070713_100218456 3300005436 Bacteria 1728
32 Ga0070713_100235898 3300005436 Bacteria 1664
33 Ga0070713_100287680 3300005436 Bacteria 1509
34 Ga0070710_10058832 3300005437 Bacteria 2181
35 Ga0070701_10023691 3300005438 Bacteria 2960
36 Ga0070711_100285373 3300005439 Unclassified 1308
37 Ga0070705_100000265 3300005440 Bacteria 31468
38 Ga0070700_100001093 3300005441 Bacteria 13412
39 Ga0070700_100092067 3300005441 Bacteria 1980
40 Ga0070694_100000487 3300005444 Bacteria 21731
41 Ga0070678_100061786 3300005456 Bacteria 2763
42 Ga0070681_10020568 3300005458 Bacteria 6613
43 Ga0070681_10123693 3300005458 Bacteria 2519
44 Ga0070681_10134292 3300005458 Bacteria 2405
45 Ga0070681_10210627 3300005458 Bacteria 1860
46 Ga0068867_100000776 3300005459 Bacteria 21576
47 Ga0068867_100097727 3300005459 Bacteria 2238
48 Ga0070685_10063845 3300005466 Bacteria 2164
49 Ga0070706_100142045 3300005467 Bacteria 2241
50 Ga0070706_100503173 3300005467 Bacteria 1127
51 Ga0070698_100287697 3300005471 Bacteria 1574
52 Ga0070699_100016258 3300005518 Bacteria 6388
53 Ga0070679_100015566 3300005530 Bacteria 7308
54 Ga0070679_100063340 3300005530 Bacteria 3686
55 Ga0070679_100072422 3300005530 Bacteria 3438
56 Ga0070679_100141753 3300005530 Bacteria 2382
57 Ga0070679_100178306 3300005530 Bacteria 2098
58 Ga0070684_100004877 3300005535 Bacteria 10243
59 Ga0070684_100113530 3300005535 Bacteria 2431
60 Ga0068853_100135019 3300005539 Bacteria 2211
61 Ga0070686_100029834 3300005544 Bacteria 3322
62 Ga0070686_100090530 3300005544 Bacteria 2045
63 Ga0070686_100248195 3300005544 Bacteria 1299
64 Ga0070695_100016157 3300005545 Bacteria 4514
65 Ga0070696_100004350 3300005546 Bacteria 9440
66 Ga0070693_100000572 3300005547 Bacteria 16351
67 Ga0070693_100053211 3300005547 Bacteria 2323
68 Ga0070665_100013416 3300005548 Bacteria 8245
69 Ga0070665_100024034 3300005548 Bacteria 6137
70 Ga0070665_100053844 3300005548 Bacteria 4036
71 Ga0070665_100105133 3300005548 Bacteria 2825
72 Ga0070704_100000099 3300005549 Bacteria 30058
73 Ga0070704_100017161 3300005549 Bacteria 4595
74 Ga0068855_100002434 3300005563 Bacteria 22992
75 Ga0068855_100063804 3300005563 Bacteria 4298
76 Ga0070664_100057369 3300005564 Bacteria 3310
77 Ga0070664_100062586 3300005564 Bacteria 3172
78 Ga0070664_100116623 3300005564 Bacteria 2335
79 Ga0068854_100064244 3300005578 Bacteria 2666
80 Ga0068856_100397699 3300005614 Bacteria 1398
81 Ga0070702_100001957 3300005615 Bacteria 8671
82 Ga0068852_100015189 3300005616 Bacteria 5960
83 Ga0068852_100189623 3300005616 Bacteria 1939
84 Ga0068852_100194330 3300005616 Bacteria 1917
85 Ga0068859_100018798 3300005617 Bacteria 6944
86 Ga0068859_100082863 3300005617 Bacteria 3249
87 Ga0068859_100487607 3300005617 Bacteria 1328
88 Ga0068861_100121017 3300005719 Bacteria 2112
89 Ga0068870_10004411 3300005840 Bacteria 6062
90 Ga0068870_10105271 3300005840 Bacteria 1602
91 Ga0068863_100108568 3300005841 Bacteria 2641
92 Ga0068858_100031268 3300005842 Bacteria 4942
93 Ga0068858_100069524 3300005842 Bacteria 3264
94 Ga0068858_100130259 3300005842 Bacteria 2358
95 Ga0068860_100000240 3300005843 Bacteria 83866
96 Ga0068860_100013709 3300005843 Bacteria 7948
97 Ga0068860_100099156 3300005843 Bacteria 2779
98 Ga0068860_100116136 3300005843 Bacteria 2560
99 Ga0068862_100075232 3300005844 Bacteria 2920
100 Ga0081455_10001031 3300005937 Bacteria 35153
101 Ga0081455_10015547 3300005937 Bacteria 7389
102 Ga0081455_10018454 3300005937 Bacteria 6646
103 Ga0081455_10033927 3300005937 Bacteria 4579
104 Ga0081455_10059180 3300005937 Bacteria 3237
105 Ga0081538_10000477 3300005981 Bacteria 45047
106 Ga0081538_10055367 3300005981 Bacteria 2336
107 Ga0081540_1000978 3300005983 Bacteria 25763
108 Ga0081540_1001064 3300005983 Bacteria 24427
109 Ga0081540_1001242 3300005983 Bacteria 22254
110 Ga0081540_1002512 3300005983 Bacteria 14912
111 Ga0081540_1004706 3300005983 Bacteria 10326
112 Ga0081540_1009903 3300005983 Bacteria 6503
113 Ga0081540_1093773 3300005983 Bacteria 1313
114 Ga0081539_10000008 3300005985 Bacteria 525071
115 Ga0081539_10000172 3300005985 Bacteria 151505
116 Ga0081539_10000332 3300005985 Bacteria 104677
117 Ga0081539_10021304 3300005985 Bacteria 4337
118 Ga0081539_10092338 3300005985 Bacteria 1561
119 Ga0070717_10043833 3300006028 Bacteria 3652
120 Ga0070717_10056287 3300006028 Bacteria 3248
121 Ga0070717_10134228 3300006028 Bacteria 2130
122 Ga0075365_10016302 3300006038 Bacteria 4517
123 Ga0075365_10039028 3300006038 Bacteria 3090
124 Ga0075365_10067357 3300006038 Bacteria 2403
125 Ga0075364_10010781 3300006051 Bacteria 5530
126 Ga0075364_10048599 3300006051 Bacteria 2764
127 Ga0075364_10211927 3300006051 Bacteria 1314
128 Ga0075364_10258707 3300006051 Bacteria 1183
129 Ga0070715_10081376 3300006163 Bacteria 1470
130 Ga0070716_100016198 3300006173 Bacteria 3843
131 Ga0070716_100193932 3300006173 Bacteria 1344
132 Ga0070712_100034883 3300006175 Bacteria 3412
133 Ga0070712_100134668 3300006175 Bacteria 1877
134 Ga0075362_10101972 3300006177 Bacteria 1343
135 Ga0075367_10040340 3300006178 Bacteria 2725
136 Ga0097621_100001204 3300006237 Bacteria 17926
137 Ga0097621_100049523 3300006237 Bacteria 3413
138 Ga0097621_100211072 3300006237 Bacteria 1689
139 Ga0075370_10047323 3300006353 Bacteria 2435
140 Ga0068871_100010165 3300006358 Bacteria 6852
141 Ga0068871_100349299 3300006358 Bacteria 1308
142 Ga0075428_100032862 3300006844 Bacteria 5729
143 Ga0075428_100117702 3300006844 Bacteria 2894
144 Ga0075428_100121682 3300006844 Bacteria 2842
145 Ga0075428_100427184 3300006844 Bacteria 1420
146 Ga0075428_100557057 3300006844 Bacteria 1225
147 Ga0075431_100167638 3300006847 Bacteria 2257
148 Ga0075431_100309051 3300006847 Bacteria 1596
149 Ga0075434_100008146 3300006871 Bacteria 9717
150 Ga0075434_100296120 3300006871 Bacteria 1638
151 Ga0075429_100017721 3300006880 Bacteria 6158
152 Ga0075429_100092259 3300006880 Bacteria 2641
153 Ga0068865_100097621 3300006881 Bacteria 2145
154 Ga0068865_100325579 3300006881 Bacteria 1238
155 Ga0075436_100000606 3300006914 Bacteria 23452
156 Ga0075436_100017772 3300006914 Bacteria 4870
157 Ga0075436_100073145 3300006914 Bacteria 2372
158 Ga0075436_100342929 3300006914 Bacteria 1076
159 Ga0097620_100018798 3300006931 Bacteria 6944
160 Ga0097620_100082866 3300006931 Bacteria 3249
161 Ga0097620_100487647 3300006931 Bacteria 1328
162 Ga0075435_100001684 3300007076 Bacteria 14358
163 Ga0075435_100076318 3300007076 Bacteria 2746
164 Ga0099795_10075744 3300007788 Bacteria 1278
165 Ga0105250_10041879 3300009092 Bacteria 1835
166 Ga0105240_10015753 3300009093 Bacteria 10260
167 Ga0105240_10124206 3300009093 Bacteria 3104
168 Ga0105240_10163360 3300009093 Bacteria 2643
169 Ga0105240_10232737 3300009093 Bacteria 2140
170 Ga0111539_10002250 3300009094 Bacteria 25720
171 Ga0111539_10024422 3300009094 Bacteria 7417
172 Ga0111539_10524385 3300009094 Bacteria 1380
173 Ga0105245_10009606 3300009098 Bacteria 8437
174 Ga0105245_10104034 3300009098 Bacteria 2632
175 Ga0105247_10059042 3300009101 Bacteria 2374
176 Ga0105247_10108406 3300009101 Bacteria 1784
177 Ga0114129_10009821 3300009147 Bacteria 13648
178 Ga0114129_10019005 3300009147 Bacteria 9789
179 Ga0114129_10038203 3300009147 Bacteria 6774
180 Ga0114129_10219232 3300009147 Bacteria 2567
181 Ga0114129_10456993 3300009147 Bacteria 1674
182 Ga0105243_10001402 3300009148 Bacteria 21324
183 Ga0105243_10204634 3300009148 Bacteria 1733
184 Ga0105241_10038608 3300009174 Bacteria 3600
185 Ga0105242_10214882 3300009176 Bacteria 1715
186 Ga0105248_10066367 3300009177 Bacteria 4051
187 Ga0105237_10068140 3300009545 Bacteria 3553
188 Ga0105237_10296651 3300009545 Bacteria 1619
189 Ga0105249_10195401 3300009553 Bacteria 1977
190 Ga0105239_10070728 3300010375 Bacteria 3833
191 Ga0105239_10122891 3300010375 Bacteria 2885
192 Ga0105239_10143292 3300010375 Bacteria 2664
193 Ga0105239_10302348 3300010375 Bacteria 1802
194 Ga0105246_10082106 3300011119 Bacteria 2299
195 Ga0105246_10284291 3300011119 Bacteria 1328
196 Ga0157370_10132749 3300013104 Bacteria 2322
197 Ga0157370_10326814 3300013104 Bacteria 1414
198 Ga0157370_10404992 3300013104 Bacteria 1255
199 Ga0157369_10009530 3300013105 Bacteria 11104
200 Ga0157369_10225571 3300013105 Bacteria 1960
201 Ga0157374_10221658 3300013296 Bacteria 1856
202 Ga0157378_10003018 3300013297 Bacteria 14955
203 Ga0157378_10004165 3300013297 Bacteria 12768
204 Ga0157378_10352608 3300013297 Bacteria 1438
205 Ga0157378_10414242 3300013297 Bacteria 1330
206 Ga0157375_10167210 3300013308 Bacteria 2345
207 Ga0157375_10214496 3300013308 Bacteria 2083
208 Ga0157375_10334516 3300013308 Bacteria 1679
209 Ga0163163_10124462 3300014325 Bacteria 2615
210 Ga0157377_10150871 3300014745 Bacteria 1437
211 Ga0157377_10218499 3300014745 Bacteria 1219
212 Ga0157376_10241815 3300014969 Bacteria 1682
213 Ga0206353_10143910 3300020082 Bacteria 1077
214 Ga0224712_10097252 3300022467 Bacteria 1243
215 Ga0209564_1001859 3300025295 Bacteria 19125
216 Ga0207692_10131242 3300025898 Unclassified 1415
217 Ga0207710_10035747 3300025900 Bacteria 2187
218 Ga0207688_10011095 3300025901 Bacteria 4903
219 Ga0207647_10065117 3300025904 Bacteria 2213
220 Ga0207647_10087585 3300025904 Bacteria 1860
221 Ga0207685_10043310 3300025905 Bacteria 1695
222 Ga0207699_10032844 3300025906 Bacteria 2927
223 Ga0207643_10036955 3300025908 Bacteria 2739
224 Ga0207643_10063568 3300025908 Bacteria 2111
225 Ga0207684_10374469 3300025910 Bacteria 1225
226 Ga0207707_10004401 3300025912 Bacteria 12437
227 Ga0207707_10020944 3300025912 Bacteria 5712
228 Ga0207707_10032022 3300025912 Bacteria 4603
229 Ga0207695_10366289 3300025913 Bacteria 1327
230 Ga0207671_10044620 3300025914 Bacteria 3279
231 Ga0207671_10082833 3300025914 Bacteria 2408
232 Ga0207693_10006677 3300025915 Bacteria 9531
233 Ga0207693_10124662 3300025915 Bacteria 2024
234 Ga0207663_10019550 3300025916 Bacteria 3819
235 Ga0207663_10126592 3300025916 Bacteria 1758
236 Ga0207660_10183203 3300025917 Bacteria 1627
237 Ga0207662_10000693 3300025918 Bacteria 15368
238 Ga0207657_10111196 3300025919 Bacteria 2262
239 Ga0207649_10049406 3300025920 Bacteria 2598
240 Ga0207649_10118921 3300025920 Bacteria 1778
241 Ga0207652_10050456 3300025921 Bacteria 3565
242 Ga0207652_10141602 3300025921 Bacteria 2150
243 Ga0207652_10160450 3300025921 Bacteria 2015
244 Ga0207681_10221228 3300025923 Bacteria 1465
245 Ga0207650_10018949 3300025925 Bacteria 4835
246 Ga0207687_10018684 3300025927 Bacteria 4580
247 Ga0207687_10019968 3300025927 Bacteria 4443
248 Ga0207687_10342146 3300025927 Bacteria 1216
249 Ga0207700_10015740 3300025928 Bacteria 5001
250 Ga0207700_10030819 3300025928 Bacteria 3803
251 Ga0207700_10048324 3300025928 Bacteria 3159
252 Ga0207700_10302959 3300025928 Bacteria 1381
253 Ga0207664_10018260 3300025929 Bacteria 5159
254 Ga0207664_10024546 3300025929 Bacteria 4532
255 Ga0207664_10027852 3300025929 Bacteria 4289
256 Ga0207664_10067162 3300025929 Bacteria 2876
257 Ga0207664_10509874 3300025929 Bacteria 1077
258 Ga0207644_10115478 3300025931 Bacteria 2036
259 Ga0207706_10006437 3300025933 Bacteria 10907
260 Ga0207706_10026102 3300025933 Bacteria 5229
261 Ga0207709_10044626 3300025935 Bacteria 2680
262 Ga0207670_10036855 3300025936 Bacteria 3184
263 Ga0207670_10049428 3300025936 Bacteria 2813
264 Ga0207704_10000733 3300025938 Bacteria 14428
265 Ga0207665_10026101 3300025939 Bacteria 3855
266 Ga0207691_10085512 3300025940 Bacteria 2830
267 Ga0207711_10133175 3300025941 Bacteria 2230
268 Ga0207689_10000736 3300025942 Bacteria 31515
269 Ga0207689_10076578 3300025942 Bacteria 2750
270 Ga0207661_10000190 3300025944 Bacteria 39991
271 Ga0207661_10039765 3300025944 Bacteria 3693
272 Ga0207661_10367160 3300025944 Bacteria 1301
273 Ga0207679_10059582 3300025945 Bacteria 2833
274 Ga0207679_10067506 3300025945 Bacteria 2683
275 Ga0207667_10109989 3300025949 Bacteria 2842
276 Ga0207667_10169880 3300025949 Bacteria 2241
277 Ga0207667_10268168 3300025949 Bacteria 1745
278 Ga0207651_10035336 3300025960 Bacteria 3248
279 Ga0207651_10116762 3300025960 Bacteria 2015
280 Ga0207712_10180676 3300025961 Bacteria 1657
281 Ga0207640_10154455 3300025981 Bacteria 1690
282 Ga0207640_10241216 3300025981 Bacteria 1397
283 Ga0207677_10020159 3300026023 Bacteria 4043
284 Ga0207677_10055539 3300026023 Bacteria 2708
285 Ga0207677_10111867 3300026023 Bacteria 2035
286 Ga0207677_10147038 3300026023 Bacteria 1812
287 Ga0207703_10030472 3300026035 Bacteria 4264
288 Ga0207703_10147747 3300026035 Bacteria 2046
289 Ga0207639_10255925 3300026041 Bacteria 1529
290 Ga0207708_10000310 3300026075 Bacteria 38519
291 Ga0207708_10002044 3300026075 Bacteria 14870
292 Ga0207702_10180426 3300026078 Bacteria 1944
293 Ga0207648_10001026 3300026089 Bacteria 31434
294 Ga0207648_10078464 3300026089 Bacteria 2880
295 Ga0207676_10025464 3300026095 Bacteria 4390
296 Ga0207676_10034075 3300026095 Bacteria 3852
297 Ga0207674_10073472 3300026116 Bacteria 3433
298 Ga0207675_100002828 3300026118 Bacteria 17075
299 Ga0207675_100030077 3300026118 Bacteria 5057
300 Ga0207675_100152619 3300026118 Bacteria 2199
301 Ga0207675_100167446 3300026118 Bacteria 2099
302 Ga0207675_100242840 3300026118 Bacteria 1741
303 Ga0207683_10022046 3300026121 Bacteria 5464
304 Ga0207683_10046454 3300026121 Bacteria 3800
305 Ga0209588_1001601 3300027671 Bacteria 5961
306 Ga0207428_10004091 3300027907 Bacteria 13975
307 Ga0207428_10123677 3300027907 Bacteria 1982
308 Ga0268266_10003834 3300028379 Bacteria 14695
309 Ga0268266_10102598 3300028379 Bacteria 2523
310 Ga0268266_10140030 3300028379 Bacteria 2170
311 Ga0268266_10292468 3300028379 Bacteria 1517
312 Ga0268265_10008996 3300028380 Bacteria 6755
313 Ga0268265_10104211 3300028380 Bacteria 2298
314 Ga0268265_10184624 3300028380 Bacteria 1795
315 Ga0268264_10000035 3300028381 Bacteria 398196
316 Ga0268264_10096355 3300028381 Bacteria 2562
317 Ga0268264_10177554 3300028381 Bacteria 1931
318 Ga0265337_1017390 3300028556 Bacteria 2306
319 Ga0265319_1011573 3300028563 Bacteria 3603
320 Ga0265334_10012455 3300028573 Bacteria 3573
321 Ga0265323_10002960 3300028653 Bacteria 7588
322 Ga0265336_10000211 3300028666 Bacteria 40984
323 Ga0307517_10140452 3300028786 Unclassified 1698
324 Ga0307515_10042713 3300028794 Bacteria 7080
325 Ga0307515_10051340 3300028794 Bacteria 6151
326 Ga0265338_10004459 3300028800 Bacteria 18887
327 Ga0265320_10020941 3300031240 Bacteria 3530
328 Ga0265325_10000337 3300031241 Bacteria 33222
329 Ga0265340_10016257 3300031247 Bacteria 3856
330 Ga0307513_10158871 3300031456 Bacteria 2156
331 Ga0307509_10007153 3300031507 Bacteria 14704
332 Ga0307508_10000013 3300031616 Bacteria 242867
333 Ga0307508_10022680 3300031616 Bacteria 5707
334 Ga0307508_10171900 3300031616 Bacteria 1770
335 Ga0307508_10178452 3300031616 Bacteria 1726
336 Ga0307516_10041144 3300031730 Bacteria 4596
337 Ga0307516_10306577 3300031730 Bacteria 1262
338 Ga0307415_100118622 3300032126 Bacteria 1979
339 Ga0307507_10011807 3300033179 Bacteria 10938
340 Ga0307510_10026914 3300033180 Bacteria 6600
341 Ga0373948_0017732 3300034817 Unclassified 1330
342 Ga0373958_0016850 3300034819 Bacteria 1306
343 Ga0373926_0060495 3300035083 Bacteria 1380
344 Ga0373934_0062534 3300035086 Bacteria 1484
345 Ga0373940_0000194 3300035088 Bacteria 8354
346 Ga0373944_0004544 3300035089 Bacteria 3620
347 Ga0373944_0016239 3300035089 Bacteria 2096
348 Ga0373923_0004428 3300035111 Bacteria 4658
349 Ga0373923_0062922 3300035111 Bacteria 1579
350 Ga0373923_0075084 3300035111 Bacteria 1458
351 Ga0373932_0005875 3300035112 Bacteria 2889
352 Ga0373936_0008116 3300035113 Bacteria 3949
353 Ga0373936_0033616 3300035113 Bacteria 2033
354 Ga0373939_0009370 3300035114 Bacteria 2426
355 Ga0373945_0108068 3300035116 Bacteria 1095
356 Ga0373954_0091991 3300035118 Bacteria 1457
357 Ga0373956_0024673 3300035119 Bacteria 2593
358 Ga0373957_0067124 3300035120 Bacteria 1398
359 Ga0373943_0006377 3300035170 Bacteria 5303
360 Ga0373943_0007448 3300035170 Bacteria 4918
361 Ga0373943_0008226 3300035170 Bacteria 4681
362 Ga0373943_0026861 3300035170 Bacteria 2700
363 Ga0373943_0121348 3300035170 Bacteria 1389
364 Ga0373946_0005648 3300035171 Bacteria 4518
365 Ga0373946_0015643 3300035171 Bacteria 2880
366 Ga0373946_0032040 3300035171 Bacteria 2109
367 Ga0373946_0043133 3300035171 Bacteria 1857
368 Ga0373961_0007543 3300035241 Bacteria 2634
369 Ga0373924_0029825 3300035410 Bacteria 2183
370 Ga0373931_0003605 3300035691 Bacteria 6991
371 Ga0373931_0006462 3300035691 Bacteria 5479
372 Ga0373935_0000344 3300035692 Bacteria 23571
373 Ga0373935_0005277 3300035692 Bacteria 7605
374 Ga0373935_0032424 3300035692 Bacteria 3247
375 Ga0373935_0035377 3300035692 Bacteria 3117
376 Ga0373935_0054632 3300035692 Bacteria 2543
377 Ga0373927_0001621 3300035695 Bacteria 16865
378 Ga0373927_0018653 3300035695 Bacteria 4554
379 Ga0373927_0020398 3300035695 Bacteria 4345
380 Ga0373927_0021976 3300035695 Bacteria 4181
381 Ga0373927_0038878 3300035695 Bacteria 3088
382 Ga0373927_0047104 3300035695 Bacteria 2788
383 Ga0373927_0094417 3300035695 Bacteria 1943
384 Ga0373927_0106392 3300035695 Bacteria 1826
385 Ga0373927_0231028 3300035695 Bacteria 1215
386 Ga0373933_0039950 3300035724 Bacteria 2762
387 Ga0373933_0103332 3300035724 Bacteria 1770
388 Ga0373947_0001795 3300035725 Bacteria 13125
389 Ga0373947_0002633 3300035725 Bacteria 10777
390 Ga0373947_0015267 3300035725 Bacteria 4409
391 Ga0373947_0028278 3300035725 Bacteria 3286
392 Ga0373947_0040430 3300035725 Bacteria 2777
393 Ga0373947_0069253 3300035725 Bacteria 2159
394 Ga0373947_0078396 3300035725 Bacteria 2039
395 Ga0373925_0028480 3300037068 Bacteria 4093
396 Ga0373925_0076280 3300037068 Bacteria 2541
397 Ga0373925_0076476 3300037068 Bacteria 2538
398 Ga0373925_0130170 3300037068 Bacteria 1961
399 Ga0373925_0270003 3300037068 Bacteria 1368
400 Ga0373925_0326227 3300037068 Bacteria 1243
401 Ga0395900_0011785 3300037418 Bacteria 8941
402 Ga0395898_0040965 3300037466 Bacteria 4577
403 Ga0395898_0180929 3300037466 Bacteria 2015
404 Ga0436364_1221974 3300037853 Bacteria 1514
405 Ga0395901_0166863 3300038443 Bacteria 2311
406 Ga0395901_0522087 3300038443 Bacteria 1206
407 Ga0436365_1009371 3300039437 Bacteria 1504
408 Ga0436365_1832963 3300039437 Bacteria 3685
409 Ga0451793_1019064 3300041452 Bacteria 1153
410 Ga0451853_1230584 3300041512 Bacteria 1474
411 Ga0466966_0010678 3300044684 Bacteria 6105
412 Ga0466963_0235017 3300044694 Bacteria 1285
413 Ga0466971_0037912 3300044719 Bacteria 2162
414 Ga0466957_0047154 3300044842 Bacteria 2617
415 Ga0451576_0001638 3300045051 Bacteria 37426
416 Ga0451576_0004815 3300045051 Bacteria 17290
417 Ga0451576_0036794 3300045051 Bacteria 5186
418 Ga0466958_0056892 3300045836 Bacteria 2377
419 Ga0495592_0127933 3300046454 Bacteria 1779
420 Ga0495592_0135411 3300046454 Bacteria 1719
421 Ga0495603_0000094 3300046455 Bacteria 40636
422 Ga0495603_0002935 3300046455 Bacteria 10082
423 Ga0495603_0011897 3300046455 Bacteria 5266
424 Ga0495603_0050402 3300046455 Bacteria 2476
425 Ga0495603_0101469 3300046455 Bacteria 1679
426 Ga0495629_0001119 3300046459 Bacteria 21231
427 Ga0495629_0088219 3300046459 Bacteria 2164
428 Ga0495629_0137191 3300046459 Bacteria 1703
429 Ga0495638_0056451 3300046460 Bacteria 2436
430 Ga0495641_0001895 3300046461 Bacteria 17085
431 Ga0495641_0138568 3300046461 Bacteria 1087
432 Ga0495651_0001666 3300046462 Bacteria 17179
433 Ga0495651_0075421 3300046462 Bacteria 2557
434 Ga0495580_0002744 3300046472 Bacteria 15166
435 Ga0495580_0009353 3300046472 Bacteria 7709
436 Ga0495580_0033006 3300046472 Bacteria 3730
437 Ga0495582_0001055 3300046473 Bacteria 15486
438 Ga0495582_0025038 3300046473 Bacteria 3269
439 Ga0495639_0000114 3300046475 Bacteria 40307
440 Ga0495639_0018967 3300046475 Bacteria 2999
441 Ga0495639_0050292 3300046475 Bacteria 1893
442 Ga0495662_0000093 3300046476 Bacteria 32243
443 Ga0495662_0050341 3300046476 Bacteria 2011
444 Ga0495664_0010750 3300046477 Bacteria 5145
445 Ga0495664_0152499 3300046477 Bacteria 1401
446 Ga0495585_0129245 3300046492 Bacteria 1331
447 Ga0495594_0000393 3300046499 Bacteria 22014
448 Ga0495594_0150990 3300046499 Bacteria 1319
449 Ga0495596_0054611 3300046500 Bacteria 1562
450 Ga0495583_0121976 3300046506 Bacteria 1096
451 Ga0495606_0006792 3300046507 Bacteria 10457
452 Ga0495628_0157414 3300046516 Bacteria 1727
453 Ga0495630_0000459 3300046517 Bacteria 30805
454 Ga0495630_0094421 3300046517 Bacteria 2261
455 Ga0495630_0129289 3300046517 Bacteria 1918
456 Ga0495630_0143074 3300046517 Bacteria 1818
457 Ga0495631_0131386 3300046518 Bacteria 1076
458 Ga0495666_0031372 3300046526 Bacteria 2604
459 Ga0495666_0053769 3300046526 Bacteria 1932
460 Ga0495665_0077076 3300046531 Bacteria 1754
461 Ga0495665_0093989 3300046531 Bacteria 1575
462 Ga0495640_0016977 3300046533 Bacteria 5434
463 Ga0495640_0067892 3300046533 Bacteria 2401
464 Ga0495640_0110350 3300046533 Bacteria 1798
465 Ga0495586_0084677 3300046535 Bacteria 1745
466 Ga0495598_0008113 3300046537 Bacteria 2435
467 Ga0495645_0072195 3300046543 Bacteria 2487
468 Ga0495622_0001333 3300046557 Bacteria 12627
469 Ga0495622_0012523 3300046557 Bacteria 3928
470 Ga0495622_0055621 3300046557 Bacteria 1835
471 Ga0495667_0047676 3300046559 Bacteria 2830
472 Ga0495656_0026179 3300046615 Bacteria 2320
473 Ga0495668_0078662 3300046616 Bacteria 1810
474 Ga0495634_0001601 3300046642 Bacteria 19807
475 Ga0495634_0049215 3300046642 Bacteria 2835
476 Ga0495625_0146866 3300046660 Bacteria 1587
477 Ga0495635_0001000 3300046663 Bacteria 18675
478 Ga0495635_0152284 3300046663 Bacteria 1574
479 Ga0495588_0050904 3300046674 Bacteria 2132
480 Ga0495588_0222466 3300046674 Bacteria 996
481 Ga0495599_0139093 3300046678 Bacteria 1506
482 Ga0495646_0023798 3300046680 Bacteria 3856
483 Ga0495646_0079583 3300046680 Bacteria 1913
484 Ga0495647_0000070 3300046681 Bacteria 24847
485 Ga0495647_0000340 3300046681 Bacteria 13129
486 Ga0495647_0007639 3300046681 Bacteria 3630
487 Ga0495647_0014154 3300046681 Bacteria 2776
488 Ga0495658_0001004 3300046683 Bacteria 14900
489 Ga0495658_0075310 3300046683 Bacteria 1969
490 Ga0495658_0129167 3300046683 Bacteria 1536
491 Ga0495669_0071230 3300046684 Bacteria 1585
492 Ga0495613_0003317 3300046689 Bacteria 12056
493 Ga0495624_0003008 3300046690 Bacteria 12614
494 Ga0495624_0026238 3300046690 Bacteria 3819
495 Ga0495624_0060782 3300046690 Bacteria 2368
496 Ga0495670_0106871 3300046691 Bacteria 1446
497 Ga0495589_0128842 3300046794 Bacteria 1216
498 Ga0495600_0027380 3300046809 Bacteria 3683
499 Ga0495581_0000082 3300047315 Bacteria 38294
500 Ga0495581_0074316 3300047315 Bacteria 1967
501 Ga0495604_0114362 3300047317 Bacteria 1962
502 Ga0495604_0153302 3300047317 Bacteria 1635
503 Ga0495674_0011588 3300047319 Bacteria 8317
504 Ga0495674_0077669 3300047319 Bacteria 2854
505 Ga0495672_0010945 3300047320 Bacteria 6434
506 Ga0495676_0116144 3300047321 Bacteria 1955
507 Ga0495676_0212019 3300047321 Bacteria 1339
508 Ga0495684_0229088 3300047471 Bacteria 1359
509 Ga0495686_0100687 3300047472 Bacteria 1743
510 Ga0495593_0000206 3300047673 Bacteria 31187
511 Ga0495593_0049068 3300047673 Bacteria 2241
512 Ga0496100_0067828 3300048903 Bacteria 2370
513 Ga0496100_0070688 3300048903 Bacteria 2328
514 Ga0496100_0180873 3300048903 Bacteria 1525
515 Ga0496100_0286319 3300048903 Bacteria 1230
516 Ga0496101_0005595 3300048904 Bacteria 8022
517 Ga0496101_0020832 3300048904 Bacteria 4497
518 Ga0496101_0053586 3300048904 Bacteria 2911
519 Ga0496102_0251935 3300048905 Bacteria 1665
520 Ga0496102_0522374 3300048905 Bacteria 1110
521 Ga0496103_0010623 3300048906 Bacteria 5448
522 Ga0496104_0001281 3300048907 Bacteria 21671
523 Ga0496104_0003017 3300048907 Bacteria 14499
524 Ga0496104_0005779 3300048907 Bacteria 10829
525 Ga0496104_0007509 3300048907 Bacteria 9638
526 Ga0496104_0099427 3300048907 Bacteria 2785
527 Ga0496104_0492792 3300048907 Bacteria 1137
528 Ga0496105_0013103 3300048908 Bacteria 6575
529 Ga0496105_0016864 3300048908 Bacteria 5842
530 Ga0496105_0050461 3300048908 Bacteria 3437
531 Ga0496105_0059338 3300048908 Bacteria 3157
532 Ga0496105_0087248 3300048908 Bacteria 2578
533 Ga0496105_0095085 3300048908 Bacteria 2461
534 Ga0496106_0001874 3300048909 Bacteria 15739
535 Ga0496106_0075467 3300048909 Bacteria 2582
536 Ga0496106_0292221 3300048909 Bacteria 1307
537 Ga0496107_0058298 3300048910 Bacteria 2792
538 Ga0496107_0092298 3300048910 Bacteria 2213
539 Ga0496108_0000805 3300048911 Bacteria 24339
540 Ga0496109_0003733 3300048912 Bacteria 12725
541 Ga0496109_0085270 3300048912 Bacteria 2915
542 Ga0496109_0158077 3300048912 Bacteria 2123
543 Ga0496109_0305276 3300048912 Bacteria 1501
544 Ga0496110_0010178 3300048913 Bacteria 7640
545 Ga0496110_0178071 3300048913 Bacteria 1930
546 Ga0496111_0141186 3300048914 Bacteria 1785
547 Ga0496112_0011960 3300048915 Bacteria 7954
548 Ga0496112_0047900 3300048915 Bacteria 4192
549 Ga0496112_0131307 3300048915 Bacteria 2476
550 Ga0496112_0141517 3300048915 Bacteria 2375
551 Ga0496113_0013855 3300048916 Bacteria 5479
552 Ga0496113_0110807 3300048916 Bacteria 2136
553 Ga0496113_0115725 3300048916 Bacteria 2092
554 Ga0496113_0159078 3300048916 Bacteria 1785
555 Ga0496113_0310275 3300048916 Bacteria 1264
556 Ga0496114_0008851 3300048917 Bacteria 7979
557 Ga0496114_0043176 3300048917 Bacteria 3739
558 Ga0496114_0096825 3300048917 Bacteria 2513
559 Ga0496114_0147577 3300048917 Bacteria 2039
560 Ga0496114_0152314 3300048917 Bacteria 2006
561 Ga0496114_0397274 3300048917 Bacteria 1221
562 Ga0496115_0001214 3300048918 Bacteria 18485
563 Ga0496115_0024106 3300048918 Bacteria 4727
564 Ga0496115_0118618 3300048918 Bacteria 2176
565 Ga0496115_0151971 3300048918 Bacteria 1912
566 Ga0496115_0205552 3300048918 Bacteria 1626
567 Ga0496117_0010525 3300048920 Bacteria 8412
568 Ga0496118_0002852 3300048921 Bacteria 22557
569 Ga0496118_0134388 3300048921 Bacteria 1581
570 Ga0496119_0030456 3300048922 Bacteria 3637
571 Ga0496121_0000041 3300048924 Bacteria 346686
572 Ga0496121_0018134 3300048924 Bacteria 7119
573 Ga0496121_0123698 3300048924 Bacteria 1949
574 Ga0496121_0148702 3300048924 Bacteria 1727
575 Ga0496124_0003141 3300048927 Bacteria 20452
576 Ga0496125_0009109 3300048928 Bacteria 10266
577 Ga0496125_0057438 3300048928 Bacteria 3151
578 Ga0496125_0070785 3300048928 Bacteria 2728
579 Ga0496126_0011838 3300048929 Bacteria 8976
580 Ga0496126_0015326 3300048929 Bacteria 7713
581 Ga0496126_0126747 3300048929 Bacteria 2209
582 Ga0496126_0139912 3300048929 Bacteria 2084
583 Ga0496126_0225493 3300048929 Bacteria 1572
584 Ga0496126_0234598 3300048929 Bacteria 1535
585 Ga0501032_0041687 3300049569 Bacteria 3116
586 Ga0501036_0067202 3300049572 Bacteria 3032
587 Ga0501037_0029925 3300049573 Bacteria 4022
588 Ga0501038_0041151 3300049574 Bacteria 4030
589 Ga0501039_0376732 3300049575 Bacteria 1115
590 Ga0501042_0041503 3300049578 Bacteria 3272
591 Ga0501043_0059688 3300049579 Bacteria 2993
592 Ga0501046_0025449 3300049580 Bacteria 4843
593 Ga0501046_0078032 3300049580 Bacteria 2563
594 Ga0501048_0007169 3300049582 Bacteria 8469
595 Ga0501068_0002350 3300049584 Bacteria 10070
596 Ga0501069_0001953 3300049585 Bacteria 10297
597 Ga0501071_0070369 3300049587 Bacteria 2548
598 Ga0501072_0371468 3300049588 Bacteria 1135
599 Ga0501073_0020814 3300049589 Bacteria 4730
600 Ga0501074_0017115 3300049590 Bacteria 5258
601 Ga0501075_0282779 3300049591 Bacteria 1264
602 Ga0501079_0012098 3300049741 Bacteria 6587
603 Ga0501080_0007369 3300049742 Bacteria 9928
604 Ga0501080_0269902 3300049742 Bacteria 1549
605 Ga0501083_0039165 3300049744 Bacteria 3220
606 Ga0501035_0103345 3300049822 Bacteria 2499
607 Ga0501044_0163810 3300049823 Bacteria 2198
608 Ga0501045_0030089 3300049824 Bacteria 3928
609 nmdc:mga03n38_43677_c1 3300050490 Bacteria 1965
610 nmdc:mga00v17_83303_c1 3300050491 Bacteria 2000
611 nmdc:mga00v17_94070_c1 3300050491 Bacteria 1885
612 nmdc:mga0yw44_205499_c1 3300050492 Bacteria 1302
613 nmdc:mga0yw44_30892_c1 3300050492 Bacteria 3110
614 nmdc:mga06z11_51802_c1 3300050494 Bacteria 2103
615 nmdc:mga06z11_85413_c1 3300050494 Bacteria 1702
616 nmdc:mga05p37_102240_c1 3300050507 Bacteria 3529
617 nmdc:mga05p37_136487_c1 3300050507 Bacteria 3007
618 nmdc:mga05p37_22506_c1 3300050507 Bacteria 7643
619 nmdc:mga09592_21978_c1 3300050508 Bacteria 5263
620 nmdc:mga09592_260177_c1 3300050508 Bacteria 1505
621 nmdc:mga0qj67_379639_c1 3300050509 Bacteria 1141
622 nmdc:mga0qj67_44349_c1 3300050509 Bacteria 3504
623 nmdc:mga06r32_196313_c1 3300050510 Bacteria 2005
624 nmdc:mga06r32_74220_c1 3300050510 Bacteria 3297
625 nmdc:mga06r32_81649_c1 3300050510 Bacteria 3148
626 nmdc:mga08y16_12672_c1 3300050511 Bacteria 8870
627 nmdc:mga08y16_25522_c1 3300050511 Bacteria 6233
628 nmdc:mga0n895_11926_c1 3300050512 Bacteria 7776
629 nmdc:mga0n895_180658_c1 3300050512 Bacteria 2141
630 nmdc:mga0n895_21214_c1 3300050512 Bacteria 6070
631 nmdc:mga0n895_66099_c1 3300050512 Bacteria 3580
632 nmdc:mga08x19_1272_c1 3300050514 Bacteria 15657
633 nmdc:mga08x19_4700_c1 3300050514 Bacteria 8097
634 nmdc:mga08x19_52471_c1 3300050514 Bacteria 2623
635 nmdc:mga0a205_407610_c1 3300050515 Bacteria 1223
636 Ga0495601_0072209 3300053077 Bacteria 2205
637 Ga0495601_0236476 3300053077 Bacteria 1193
638 Ga0495612_0014530 3300053078 Bacteria 3165
639 Ga0495612_0130233 3300053078 Bacteria 1086
640 Ga0495655_0047314 3300053083 Bacteria 1125
641 Ga0495619_0230459 3300053085 Bacteria 1283
642 Ga0500643_032227 3300053087 Bacteria 1593
643 Ga0500647_0060205 3300053091 Bacteria 1827
644 Ga0500583_0075200 3300053092 Bacteria 1622
645 Ga0500651_0001673 3300053093 Bacteria 11316
646 Ga0500566_0000035 3300053094 Bacteria 69457
647 Ga0500566_0123238 3300053094 Bacteria 1395
648 Ga0500554_004423 3300053102 Bacteria 2977
649 Ga0500572_000122 3300053111 Bacteria 26114
650 Ga0500580_091786 3300053113 Bacteria 1211
651 Ga0500595_000286 3300053119 Bacteria 33353
652 Ga0500595_005670 3300053119 Bacteria 5419
653 Ga0500595_064770 3300053119 Bacteria 1095
654 Ga0500608_048859 3300053122 Bacteria 2033
655 Ga0500559_0045287 3300053136 Bacteria 1925
656 Ga0500590_041581 3300053148 Bacteria 2363
657 Ga0500603_001224 3300053150 Bacteria 5960
658 Ga0500603_001363 3300053150 Bacteria 5587
659 Ga0500616_0041115 3300053153 Bacteria 2483
660 Ga0500630_000187 3300053159 Bacteria 23623
661 Ga0500634_0109744 3300053161 Bacteria 1364
662 Ga0500638_007790 3300053162 Bacteria 4516
663 Ga0500638_053598 3300053162 Bacteria 1946
664 Ga0500639_000038 3300053163 Bacteria 65317
665 Ga0500637_0003874 3300053178 Bacteria 6976
666 Ga0500637_0026513 3300053178 Bacteria 3193
667 Ga0500576_054065 3300053725 Bacteria 1773
668 Ga0500596_000775 3300053735 Bacteria 6296
669 Ga0500601_005940 3300053737 Bacteria 1344
670 Ga0500661_000031 3300055283 Bacteria 21207
671 Ga0501082_0044534 3300060353 Bacteria 3827
672 2513696912 2513237101 Bacteria 7952346
673 2723846362 2721755755 Bacteria 8322773
674 2838126812 2838122688 Bacteria 8803140
675 2841954906 2841949485 Bacteria 8680857
676 2841988538 2841983080 Bacteria 8395090
677 2874610673 2874604998 Bacteria 7834745
678 2876811854 2876808645 Bacteria 8824342
679 2879118743 2879110137 Bacteria 8907982
680 2922388073 2922386360 Bacteria 7017218
681 2939635065 2939631187 Bacteria 6118131
682 8006928232 8006926726 Bacteria 6749210
683 8016624501 8016622563 Bacteria 7999408
684 8056680253 8056673599 Bacteria 7871253
685 nmdc:mga05p37_260966_c1
686 JGI25406J46586_10000101
687 JGI25404J52841_10002278
688 Ga0070683_100095229
689 Ga0070690_100003281
690 Ga0070670_100006671
691 Ga0068869_100015522
692 Ga0070680_100007726
693 Ga0070682_100005569
694 Ga0070682_100308134
695 Ga0068868_100002449
696 Ga0068868_100117843
697 Ga0070689_100001036
698 Ga0070691_10001194
699 Ga0070687_100063187
700 Ga0070661_100192970
701 Ga0070668_100051042
702 Ga0070668_100077158
703 Ga0070669_100064121
704 Ga0070669_100180998
705 Ga0070669_100320083
706 Ga0070671_100115010
707 Ga0070674_100101727
708 Ga0070659_100493133
709 Ga0070667_100190312
710 Ga0070667_100446651
711 Ga0070714_100034531
712 Ga0070714_100074228
713 Ga0070713_100001721
714 Ga0070713_100017230
715 Ga0070713_100218456
716 Ga0070713_100235898
717 Ga0070713_100287680
718 Ga0070710_10058832
719 Ga0070701_10023691
720 Ga0070711_100285373
721 Ga0070705_100000265
722 Ga0070700_100001093
723 Ga0070700_100092067
724 Ga0070694_100000487
725 Ga0070678_100061786
726 Ga0070681_10020568
727 Ga0070681_10123693
728 Ga0070681_10134292
729 Ga0070681_10210627
730 Ga0068867_100000776
731 Ga0068867_100097727
732 Ga0070685_10063845
733 Ga0070706_100142045
734 Ga0070706_100503173
735 Ga0070698_100287697
736 Ga0070699_100016258
737 Ga0070679_100015566
738 Ga0070679_100063340
739 Ga0070679_100072422
740 Ga0070679_100141753
741 Ga0070679_100178306
742 Ga0070684_100004877
743 Ga0070684_100113530
744 Ga0068853_100135019
745 Ga0070686_100029834
746 Ga0070686_100090530
747 Ga0070686_100248195
748 Ga0070695_100016157
749 Ga0070696_100004350
750 Ga0070693_100000572
751 Ga0070693_100053211
752 Ga0070665_100013416
753 Ga0070665_100024034
754 Ga0070665_100053844
755 Ga0070665_100105133
756 Ga0070704_100000099
757 Ga0070704_100017161
758 Ga0068855_100002434
759 Ga0068855_100063804
760 Ga0070664_100057369
761 Ga0070664_100062586
762 Ga0070664_100116623
763 Ga0068854_100064244
764 Ga0068856_100397699
765 Ga0070702_100001957
766 Ga0068852_100015189
767 Ga0068852_100189623
768 Ga0068852_100194330
769 Ga0068859_100018798
770 Ga0068859_100082863
771 Ga0068859_100487607
772 Ga0068861_100121017
773 Ga0068870_10004411
774 Ga0068870_10105271
775 Ga0068863_100108568
776 Ga0068858_100031268
777 Ga0068858_100069524
778 Ga0068858_100130259
779 Ga0068860_100000240
780 Ga0068860_100013709
781 Ga0068860_100099156
782 Ga0068860_100116136
783 Ga0068862_100075232
784 Ga0081455_10001031
785 Ga0081455_10015547
786 Ga0081455_10018454
787 Ga0081455_10033927
788 Ga0081455_10059180
789 Ga0081538_10000477
790 Ga0081538_10055367
791 Ga0081540_1000978
792 Ga0081540_1001064
793 Ga0081540_1001242
794 Ga0081540_1002512
795 Ga0081540_1004706
796 Ga0081540_1009903
797 Ga0081540_1093773
798 Ga0081539_10000008
799 Ga0081539_10000172
800 Ga0081539_10000332
801 Ga0081539_10021304
802 Ga0081539_10092338
803 Ga0070717_10043833
804 Ga0070717_10056287
805 Ga0070717_10134228
806 Ga0075365_10016302
807 Ga0075365_10039028
808 Ga0075365_10067357
809 Ga0075364_10010781
810 Ga0075364_10048599
811 Ga0075364_10211927
812 Ga0075364_10258707
813 Ga0070715_10081376
814 Ga0070716_100016198
815 Ga0070716_100193932
816 Ga0070712_100034883
817 Ga0070712_100134668
818 Ga0075362_10101972
819 Ga0075367_10040340
820 Ga0097621_100001204
821 Ga0097621_100049523
822 Ga0097621_100211072
823 Ga0075370_10047323
824 Ga0068871_100010165
825 Ga0068871_100349299
826 Ga0075428_100032862
827 Ga0075428_100117702
828 Ga0075428_100121682
829 Ga0075428_100427184
830 Ga0075428_100557057
831 Ga0075431_100167638
832 Ga0075431_100309051
833 Ga0075434_100008146
834 Ga0075434_100296120
835 Ga0075429_100017721
836 Ga0075429_100092259
837 Ga0068865_100097621
838 Ga0068865_100325579
839 Ga0075436_100000606
840 Ga0075436_100017772
841 Ga0075436_100073145
842 Ga0075436_100342929
843 Ga0097620_100018798
844 Ga0097620_100082866
845 Ga0097620_100487647
846 Ga0075435_100001684
847 Ga0075435_100076318
848 Ga0099795_10075744
849 Ga0105250_10041879
850 Ga0105240_10015753
851 Ga0105240_10124206
852 Ga0105240_10163360
853 Ga0105240_10232737
854 Ga0111539_10002250
855 Ga0111539_10024422
856 Ga0111539_10524385
857 Ga0105245_10009606
858 Ga0105245_10104034
859 Ga0105247_10059042
860 Ga0105247_10108406
861 Ga0114129_10009821
862 Ga0114129_10019005
863 Ga0114129_10038203
864 Ga0114129_10219232
865 Ga0114129_10456993
866 Ga0105243_10001402
867 Ga0105243_10204634
868 Ga0105241_10038608
869 Ga0105242_10214882
870 Ga0105248_10066367
871 Ga0105237_10068140
872 Ga0105237_10296651
873 Ga0105249_10195401
874 Ga0105239_10070728
875 Ga0105239_10122891
876 Ga0105239_10143292
877 Ga0105239_10302348
878 Ga0105246_10082106
879 Ga0105246_10284291
880 Ga0157370_10132749
881 Ga0157370_10326814
882 Ga0157370_10404992
883 Ga0157369_10009530
884 Ga0157369_10225571
885 Ga0157374_10221658
886 Ga0157378_10003018
887 Ga0157378_10004165
888 Ga0157378_10352608
889 Ga0157378_10414242
890 Ga0157375_10167210
891 Ga0157375_10214496
892 Ga0157375_10334516
893 Ga0163163_10124462
894 Ga0157377_10150871
895 Ga0157377_10218499
896 Ga0157376_10241815
897 Ga0206353_10143910
898 Ga0224712_10097252
899 Ga0209564_1001859
900 Ga0207692_10131242
901 Ga0207710_10035747
902 Ga0207688_10011095
903 Ga0207647_10065117
904 Ga0207647_10087585
905 Ga0207685_10043310
906 Ga0207699_10032844
907 Ga0207643_10036955
908 Ga0207643_10063568
909 Ga0207684_10374469
910 Ga0207707_10004401
911 Ga0207707_10020944
912 Ga0207707_10032022
913 Ga0207695_10366289
914 Ga0207671_10044620
915 Ga0207671_10082833
916 Ga0207693_10006677
917 Ga0207693_10124662
918 Ga0207663_10019550
919 Ga0207663_10126592
920 Ga0207660_10183203
921 Ga0207662_10000693
922 Ga0207657_10111196
923 Ga0207649_10049406
924 Ga0207649_10118921
925 Ga0207652_10050456
926 Ga0207652_10141602
927 Ga0207652_10160450
928 Ga0207681_10221228
929 Ga0207650_10018949
930 Ga0207687_10018684
931 Ga0207687_10019968
932 Ga0207687_10342146
933 Ga0207700_10015740
934 Ga0207700_10030819
935 Ga0207700_10048324
936 Ga0207700_10302959
937 Ga0207664_10018260
938 Ga0207664_10024546
939 Ga0207664_10027852
940 Ga0207664_10067162
941 Ga0207664_10509874
942 Ga0207644_10115478
943 Ga0207706_10006437
944 Ga0207706_10026102
945 Ga0207709_10044626
946 Ga0207670_10036855
947 Ga0207670_10049428
948 Ga0207704_10000733
949 Ga0207665_10026101
950 Ga0207691_10085512
951 Ga0207711_10133175
952 Ga0207689_10000736
953 Ga0207689_10076578
954 Ga0207661_10000190
955 Ga0207661_10039765
956 Ga0207661_10367160
957 Ga0207679_10059582
958 Ga0207679_10067506
959 Ga0207667_10109989
960 Ga0207667_10169880
961 Ga0207667_10268168
962 Ga0207651_10035336
963 Ga0207651_10116762
964 Ga0207712_10180676
965 Ga0207640_10154455
966 Ga0207640_10241216
967 Ga0207677_10020159
968 Ga0207677_10055539
969 Ga0207677_10111867
970 Ga0207677_10147038
971 Ga0207703_10030472
972 Ga0207703_10147747
973 Ga0207639_10255925
974 Ga0207708_10000310
975 Ga0207708_10002044
976 Ga0207702_10180426
977 Ga0207648_10001026
978 Ga0207648_10078464
979 Ga0207676_10025464
980 Ga0207676_10034075
981 Ga0207674_10073472
982 Ga0207675_100002828
983 Ga0207675_100030077
984 Ga0207675_100152619
985 Ga0207675_100167446
986 Ga0207675_100242840
987 Ga0207683_10022046
988 Ga0207683_10046454
989 Ga0209588_1001601
990 Ga0207428_10004091
991 Ga0207428_10123677
992 Ga0268266_10003834
993 Ga0268266_10102598
994 Ga0268266_10140030
995 Ga0268266_10292468
996 Ga0268265_10008996
997 Ga0268265_10104211
998 Ga0268265_10184624
999 Ga0268264_10000035
1000 Ga0268264_10096355
1001 Ga0268264_10177554
1002 Ga0265337_1017390
1003 Ga0265319_1011573
1004 Ga0265334_10012455
1005 Ga0265323_10002960
1006 Ga0265336_10000211
1007 Ga0307517_10140452
1008 Ga0307515_10042713
1009 Ga0307515_10051340
1010 Ga0265338_10004459
1011 Ga0265320_10020941
1012 Ga0265325_10000337
1013 Ga0265340_10016257
1014 Ga0307513_10158871
1015 Ga0307509_10007153
1016 Ga0307508_10000013
1017 Ga0307508_10022680
1018 Ga0307508_10171900
1019 Ga0307508_10178452
1020 Ga0307516_10041144
1021 Ga0307516_10306577
1022 Ga0307415_100118622
1023 Ga0307507_10011807
1024 Ga0307510_10026914
1025 Ga0373948_0017732
1026 Ga0373958_0016850
1027 Ga0373926_0060495
1028 Ga0373934_0062534
1029 Ga0373940_0000194
1030 Ga0373944_0004544
1031 Ga0373944_0016239
1032 Ga0373923_0004428
1033 Ga0373923_0062922
1034 Ga0373923_0075084
1035 Ga0373932_0005875
1036 Ga0373936_0008116
1037 Ga0373936_0033616
1038 Ga0373939_0009370
1039 Ga0373945_0108068
1040 Ga0373954_0091991
1041 Ga0373956_0024673
1042 Ga0373957_0067124
1043 Ga0373943_0006377
1044 Ga0373943_0007448
1045 Ga0373943_0008226
1046 Ga0373943_0026861
1047 Ga0373943_0121348
1048 Ga0373946_0005648
1049 Ga0373946_0015643
1050 Ga0373946_0032040
1051 Ga0373946_0043133
1052 Ga0373961_0007543
1053 Ga0373924_0029825
1054 Ga0373931_0003605
1055 Ga0373931_0006462
1056 Ga0373935_0000344
1057 Ga0373935_0005277
1058 Ga0373935_0032424
1059 Ga0373935_0035377
1060 Ga0373935_0054632
1061 Ga0373927_0001621
1062 Ga0373927_0018653
1063 Ga0373927_0020398
1064 Ga0373927_0021976
1065 Ga0373927_0038878
1066 Ga0373927_0047104
1067 Ga0373927_0094417
1068 Ga0373927_0106392
1069 Ga0373927_0231028
1070 Ga0373933_0039950
1071 Ga0373933_0103332
1072 Ga0373947_0001795
1073 Ga0373947_0002633
1074 Ga0373947_0015267
1075 Ga0373947_0028278
1076 Ga0373947_0040430
1077 Ga0373947_0069253
1078 Ga0373947_0078396
1079 Ga0373925_0028480
1080 Ga0373925_0076280
1081 Ga0373925_0076476
1082 Ga0373925_0130170
1083 Ga0373925_0270003
1084 Ga0373925_0326227
1085 Ga0395900_0011785
1086 Ga0395898_0040965
1087 Ga0395898_0180929
1088 Ga0436364_1221974
1089 Ga0395901_0166863
1090 Ga0395901_0522087
1091 Ga0436365_1009371
1092 Ga0436365_1832963
1093 Ga0451793_1019064
1094 Ga0451853_1230584
1095 Ga0466966_0010678
1096 Ga0466963_0235017
1097 Ga0466971_0037912
1098 Ga0466957_0047154
1099 Ga0451576_0001638
1100 Ga0451576_0004815
1101 Ga0451576_0036794
1102 Ga0466958_0056892
1103 Ga0495592_0127933
1104 Ga0495592_0135411
1105 Ga0495603_0000094
1106 Ga0495603_0002935
1107 Ga0495603_0011897
1108 Ga0495603_0050402
1109 Ga0495603_0101469
1110 Ga0495629_0001119
1111 Ga0495629_0088219
1112 Ga0495629_0137191
1113 Ga0495638_0056451
1114 Ga0495641_0001895
1115 Ga0495641_0138568
1116 Ga0495651_0001666
1117 Ga0495651_0075421
1118 Ga0495580_0002744
1119 Ga0495580_0009353
1120 Ga0495580_0033006
1121 Ga0495582_0001055
1122 Ga0495582_0025038
1123 Ga0495639_0000114
1124 Ga0495639_0018967
1125 Ga0495639_0050292
1126 Ga0495662_0000093
1127 Ga0495662_0050341
1128 Ga0495664_0010750
1129 Ga0495664_0152499
1130 Ga0495585_0129245
1131 Ga0495594_0000393
1132 Ga0495594_0150990
1133 Ga0495596_0054611
1134 Ga0495583_0121976
1135 Ga0495606_0006792
1136 Ga0495628_0157414
1137 Ga0495630_0000459
1138 Ga0495630_0094421
1139 Ga0495630_0129289
1140 Ga0495630_0143074
1141 Ga0495631_0131386
1142 Ga0495666_0031372
1143 Ga0495666_0053769
1144 Ga0495665_0077076
1145 Ga0495665_0093989
1146 Ga0495640_0016977
1147 Ga0495640_0067892
1148 Ga0495640_0110350
1149 Ga0495586_0084677
1150 Ga0495598_0008113
1151 Ga0495645_0072195
1152 Ga0495622_0001333
1153 Ga0495622_0012523
1154 Ga0495622_0055621
1155 Ga0495667_0047676
1156 Ga0495656_0026179
1157 Ga0495668_0078662
1158 Ga0495634_0001601
1159 Ga0495634_0049215
1160 Ga0495625_0146866
1161 Ga0495635_0001000
1162 Ga0495635_0152284
1163 Ga0495588_0050904
1164 Ga0495588_0222466
1165 Ga0495599_0139093
1166 Ga0495646_0023798
1167 Ga0495646_0079583
1168 Ga0495647_0000070
1169 Ga0495647_0000340
1170 Ga0495647_0007639
1171 Ga0495647_0014154
1172 Ga0495658_0001004
1173 Ga0495658_0075310
1174 Ga0495658_0129167
1175 Ga0495669_0071230
1176 Ga0495613_0003317
1177 Ga0495624_0003008
1178 Ga0495624_0026238
1179 Ga0495624_0060782
1180 Ga0495670_0106871
1181 Ga0495589_0128842
1182 Ga0495600_0027380
1183 Ga0495581_0000082
1184 Ga0495581_0074316
1185 Ga0495604_0114362
1186 Ga0495604_0153302
1187 Ga0495674_0011588
1188 Ga0495674_0077669
1189 Ga0495672_0010945
1190 Ga0495676_0116144
1191 Ga0495676_0212019
1192 Ga0495684_0229088
1193 Ga0495686_0100687
1194 Ga0495593_0000206
1195 Ga0495593_0049068
1196 Ga0496100_0067828
1197 Ga0496100_0070688
1198 Ga0496100_0180873
1199 Ga0496100_0286319
1200 Ga0496101_0005595
1201 Ga0496101_0020832
1202 Ga0496101_0053586
1203 Ga0496102_0251935
1204 Ga0496102_0522374
1205 Ga0496103_0010623
1206 Ga0496104_0001281
1207 Ga0496104_0003017
1208 Ga0496104_0005779
1209 Ga0496104_0007509
1210 Ga0496104_0099427
1211 Ga0496104_0492792
1212 Ga0496105_0013103
1213 Ga0496105_0016864
1214 Ga0496105_0050461
1215 Ga0496105_0059338
1216 Ga0496105_0087248
1217 Ga0496105_0095085
1218 Ga0496106_0001874
1219 Ga0496106_0075467
1220 Ga0496106_0292221
1221 Ga0496107_0058298
1222 Ga0496107_0092298
1223 Ga0496108_0000805
1224 Ga0496109_0003733
1225 Ga0496109_0085270
1226 Ga0496109_0158077
1227 Ga0496109_0305276
1228 Ga0496110_0010178
1229 Ga0496110_0178071
1230 Ga0496111_0141186
1231 Ga0496112_0011960
1232 Ga0496112_0047900
1233 Ga0496112_0131307
1234 Ga0496112_0141517
1235 Ga0496113_0013855
1236 Ga0496113_0110807
1237 Ga0496113_0115725
1238 Ga0496113_0159078
1239 Ga0496113_0310275
1240 Ga0496114_0008851
1241 Ga0496114_0043176
1242 Ga0496114_0096825
1243 Ga0496114_0147577
1244 Ga0496114_0152314
1245 Ga0496114_0397274
1246 Ga0496115_0001214
1247 Ga0496115_0024106
1248 Ga0496115_0118618
1249 Ga0496115_0151971
1250 Ga0496115_0205552
1251 Ga0496117_0010525
1252 Ga0496118_0002852
1253 Ga0496118_0134388
1254 Ga0496119_0030456
1255 Ga0496121_0000041
1256 Ga0496121_0018134
1257 Ga0496121_0123698
1258 Ga0496121_0148702
1259 Ga0496124_0003141
1260 Ga0496125_0009109
1261 Ga0496125_0057438
1262 Ga0496125_0070785
1263 Ga0496126_0011838
1264 Ga0496126_0015326
1265 Ga0496126_0126747
1266 Ga0496126_0139912
1267 Ga0496126_0225493
1268 Ga0496126_0234598
1269 Ga0501032_0041687
1270 Ga0501036_0067202
1271 Ga0501037_0029925
1272 Ga0501038_0041151
1273 Ga0501039_0376732
1274 Ga0501042_0041503
1275 Ga0501043_0059688
1276 Ga0501046_0025449
1277 Ga0501046_0078032
1278 Ga0501048_0007169
1279 Ga0501068_0002350
1280 Ga0501069_0001953
1281 Ga0501071_0070369
1282 Ga0501072_0371468
1283 Ga0501073_0020814
1284 Ga0501074_0017115
1285 Ga0501075_0282779
1286 Ga0501079_0012098
1287 Ga0501080_0007369
1288 Ga0501080_0269902
1289 Ga0501083_0039165
1290 Ga0501035_0103345
1291 Ga0501044_0163810
1292 Ga0501045_0030089
1293 nmdc:mga03n38_43677_c1
1294 nmdc:mga00v17_83303_c1
1295 nmdc:mga00v17_94070_c1
1296 nmdc:mga0yw44_205499_c1
1297 nmdc:mga0yw44_30892_c1
1298 nmdc:mga06z11_51802_c1
1299 nmdc:mga06z11_85413_c1
1300 nmdc:mga05p37_102240_c1
1301 nmdc:mga05p37_136487_c1
1302 nmdc:mga05p37_22506_c1
1303 nmdc:mga09592_21978_c1
1304 nmdc:mga09592_260177_c1
1305 nmdc:mga0qj67_379639_c1
1306 nmdc:mga0qj67_44349_c1
1307 nmdc:mga06r32_196313_c1
1308 nmdc:mga06r32_74220_c1
1309 nmdc:mga06r32_81649_c1
1310 nmdc:mga08y16_12672_c1
1311 nmdc:mga08y16_25522_c1
1312 nmdc:mga0n895_11926_c1
1313 nmdc:mga0n895_180658_c1
1314 nmdc:mga0n895_21214_c1
1315 nmdc:mga0n895_66099_c1
1316 nmdc:mga08x19_1272_c1
1317 nmdc:mga08x19_4700_c1
1318 nmdc:mga08x19_52471_c1
1319 nmdc:mga0a205_407610_c1
1320 Ga0495601_0072209
1321 Ga0495601_0236476
1322 Ga0495612_0014530
1323 Ga0495612_0130233
1324 Ga0495655_0047314
1325 Ga0495619_0230459
1326 Ga0500643_032227
1327 Ga0500647_0060205
1328 Ga0500583_0075200
1329 Ga0500651_0001673
1330 Ga0500566_0000035
1331 Ga0500566_0123238
1332 Ga0500554_004423
1333 Ga0500572_000122
1334 Ga0500580_091786
1335 Ga0500595_000286
1336 Ga0500595_005670
1337 Ga0500595_064770
1338 Ga0500608_048859
1339 Ga0500559_0045287
1340 Ga0500590_041581
1341 Ga0500603_001224
1342 Ga0500603_001363
1343 Ga0500616_0041115
1344 Ga0500630_000187
1345 Ga0500634_0109744
1346 Ga0500638_007790
1347 Ga0500638_053598
1348 Ga0500639_000038
1349 Ga0500637_0003874
1350 Ga0500637_0026513
1351 Ga0500576_054065
1352 Ga0500596_000775
1353 Ga0500601_005940
1354 Ga0500661_000031
1355 Ga0501082_0044534
1356 2513696912
1357 2723846362
1358 2838126812
1359 2841954906
1360 2841988538
1361 2874610673
1362 2876811854
1363 2879118743
1364 2922388073
1365 2939635065
1366 8006928232
1367 8016624501
1368 8056680253

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

93

365

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.959 30 326
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9539 31 323
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9467 30 326
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9464 31 324
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9455 34 326
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9479 131 253 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9432 131 248 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9409 131 253 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9334 131 253 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9287 131 253 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A536ZN56-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9727 27 326
AF-Q472W5-F1-model_v4 Uncharacterized protein UPF0065 0.9712 29 326
AF-A0A1Q4BG09-F1-model_v4 ABC transporter substrate-binding protein 0.9686 31 326
AF-A0A4Q1HI09-F1-model_v4 LacI family transcriptional regulator 0.9674 29 326
AF-A0A4Q3GWI3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9673 27 249

Map