F475088

General Info

Members Datasets Scaffolds Average Seq Length
684 273 1368 353

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0011200|Ga0501037_0011200_4608_5840
Length 410
Sequence MGKTTHSITHFHSDTLSAPLKKICHVSLHPIRARNILDKGIDLTTKEFTVKREINTDTARSRPAELATVIAIISAVVLMLLIFVGSRGMRDFDSALIGYAVATLFAVVALTYRYALWISRPPTWRYFRAGWANFFSWRNFRNYTLLIPKAWWTDIFGQTFILKRGLRRWITHMCIFWGVLLSLAITLPLTFGWLHFTLLPNSLYQLWFFGIPLFIFPISSVIGFVIYHGLDFTALLLMVGLLLALWRRITDAGLLAIQRFGFDLMPLVMLLAICVTGLALTASSSWXXGRFYWFLSLTHQAVVVVWLISLPFGKFFHIIQRPASIGVSLYQTVNQDVEHYDIRPQTGHCRRCGQELPSEQFVQDLQAVLGDLGQHYNLGGDRGVLQEYCPTCKRVLRGEAYYQLMGKRFL

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
182 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
183 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
202 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
203 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
231 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
232 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
237 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
238 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
239 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
240 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
241 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
242 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
243 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
246 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
252 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
253 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
254 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
259 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.58
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 13.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0011200 3300049573 Bacteria 6601
2 SwRhRL2b_contig_2001657 2162886007 Unclassified 1663
3 JGI24737J22298_10047258 3300001990 Bacteria 1312
4 JGI24751J29686_10000026 3300002459 Bacteria 95463
5 rootH1_10143967 3300003323 Bacteria 5988
6 Ga0065714_10064430 3300005288 Bacteria 140636
7 Ga0065704_10013593 3300005289 Unclassified 1505
8 Ga0065704_10073219 3300005289 Bacteria 7432
9 Ga0065712_10002775 3300005290 Bacteria 4187
10 Ga0065712_10018115 3300005290 Bacteria 1962
11 Ga0065712_10067738 3300005290 Bacteria 92500
12 Ga0065712_10072144 3300005290 Bacteria 4883
13 Ga0065715_10006128 3300005293 Bacteria 3168
14 Ga0065715_10089039 3300005293 Bacteria 15988
15 Ga0065715_10091882 3300005293 Bacteria 5485
16 Ga0065715_10101202 3300005293 Unclassified 3228
17 Ga0065715_10120383 3300005293 Bacteria 2259
18 Ga0065707_10002153 3300005295 Bacteria 8328
19 Ga0065707_10011279 3300005295 Unclassified 2044
20 Ga0065707_10110047 3300005295 Bacteria 2446
21 Ga0065707_10112447 3300005295 Unclassified 2360
22 Ga0065707_10131108 3300005295 Unclassified 1919
23 Ga0070658_10015584 3300005327 Bacteria 6079
24 Ga0070683_100118232 3300005329 Unclassified 2503
25 Ga0070690_100006865 3300005330 Bacteria 6476
26 Ga0070690_100020763 3300005330 Unclassified 4005
27 Ga0070690_100077950 3300005330 Bacteria 2164
28 Ga0070670_100000076 3300005331 Bacteria 95513
29 Ga0070670_100002745 3300005331 Bacteria 14545
30 Ga0070670_100144721 3300005331 Bacteria 2056
31 Ga0070670_100268132 3300005331 Bacteria 1489
32 Ga0070670_100306271 3300005331 Bacteria 1390
33 Ga0068869_100012018 3300005334 Bacteria 5701
34 Ga0070680_100080757 3300005336 Unclassified 2682
35 Ga0070680_100344937 3300005336 Unclassified 1266
36 Ga0070682_100004777 3300005337 Bacteria 7531
37 Ga0070682_100058747 3300005337 Bacteria 2426
38 Ga0070682_100063091 3300005337 Bacteria 2348
39 Ga0068868_100222948 3300005338 Bacteria 1579
40 Ga0070689_100000568 3300005340 Bacteria 22206
41 Ga0070689_100086506 3300005340 Bacteria 2465
42 Ga0070661_100028001 3300005344 Bacteria 4062
43 Ga0070661_100242568 3300005344 Unclassified 1388
44 Ga0070692_10001088 3300005345 Bacteria 9446
45 Ga0070692_10004133 3300005345 Bacteria 6004
46 Ga0070668_100000175 3300005347 Bacteria 41128
47 Ga0070669_100009766 3300005353 Bacteria 6834
48 Ga0070669_100024430 3300005353 Bacteria 4333
49 Ga0070669_100185026 3300005353 Bacteria 1632
50 Ga0070669_100195119 3300005353 Unclassified 1590
51 Ga0070671_100025255 3300005355 Bacteria 4874
52 Ga0070671_100045780 3300005355 Bacteria 3637
53 Ga0070673_100003964 3300005364 Bacteria 9304
54 Ga0070673_100019727 3300005364 Unclassified 4846
55 Ga0070673_100283187 3300005364 Bacteria 1454
56 Ga0070688_100064066 3300005365 Unclassified 2332
57 Ga0070688_100091175 3300005365 Bacteria 1991
58 Ga0070667_100053575 3300005367 Bacteria 3404
59 Ga0070703_10011365 3300005406 Bacteria 2514
60 Ga0070705_100017313 3300005440 Bacteria 3760
61 Ga0070705_100143462 3300005440 Bacteria 1575
62 Ga0070700_100021501 3300005441 Bacteria 3751
63 Ga0070700_100022530 3300005441 Bacteria 3675
64 Ga0070700_100033969 3300005441 Unclassified 3076
65 Ga0070700_100065601 3300005441 Bacteria 2302
66 Ga0070700_100113525 3300005441 Unclassified 1805
67 Ga0070694_100004070 3300005444 Bacteria 8766
68 Ga0070694_100021120 3300005444 Bacteria 4157
69 Ga0070694_100022411 3300005444 Bacteria 4046
70 Ga0070694_100137813 3300005444 Unclassified 1770
71 Ga0070694_100227589 3300005444 Bacteria 1401
72 Ga0070708_100020620 3300005445 Bacteria 5563
73 Ga0070663_100007406 3300005455 Bacteria 6678
74 Ga0070662_100070118 3300005457 Bacteria 2582
75 Ga0070662_100070911 3300005457 Bacteria 2568
76 Ga0070681_10005775 3300005458 Bacteria 11967
77 Ga0070681_10005921 3300005458 Bacteria 11832
78 Ga0070681_10068816 3300005458 Bacteria 3507
79 Ga0070681_10435978 3300005458 Bacteria 1222
80 Ga0068867_100088900 3300005459 Bacteria 2342
81 Ga0068867_100210504 3300005459 Unclassified 1561
82 Ga0070706_100000376 3300005467 Bacteria 53604
83 Ga0070706_100259352 3300005467 Bacteria 1623
84 Ga0070698_100029404 3300005471 Bacteria 5705
85 Ga0070698_100088803 3300005471 Unclassified 3075
86 Ga0070699_100017701 3300005518 Bacteria 6119
87 Ga0070679_100031760 3300005530 Bacteria 5221
88 Ga0070679_100051784 3300005530 Bacteria 4089
89 Ga0070679_100088690 3300005530 Bacteria 3080
90 Ga0070684_100023111 3300005535 Bacteria 5193
91 Ga0070684_100127801 3300005535 Bacteria 2291
92 Ga0070697_100000055 3300005536 Bacteria 86691
93 Ga0070697_100000201 3300005536 Bacteria 48972
94 Ga0070697_100047592 3300005536 Bacteria 3477
95 Ga0070697_100047951 3300005536 Bacteria 3463
96 Ga0068853_100007830 3300005539 Bacteria 8569
97 Ga0068853_100025941 3300005539 Bacteria 4918
98 Ga0068853_100052706 3300005539 Bacteria 3504
99 Ga0070672_100010743 3300005543 Bacteria 6361
100 Ga0070672_100016661 3300005543 Bacteria 5268
101 Ga0070686_100021014 3300005544 Bacteria 3873
102 Ga0070686_100033368 3300005544 Bacteria 3163
103 Ga0070686_100195848 3300005544 Bacteria 1445
104 Ga0070695_100030337 3300005545 Bacteria 3367
105 Ga0070695_100034151 3300005545 Unclassified 3187
106 Ga0070665_100065367 3300005548 Bacteria 3649
107 Ga0070704_100017562 3300005549 Bacteria 4553
108 Ga0070704_100073962 3300005549 Unclassified 2484
109 Ga0070704_100102081 3300005549 Bacteria 2163
110 Ga0070704_100146870 3300005549 Bacteria 1849
111 Ga0070704_100207544 3300005549 Unclassified 1585
112 Ga0070704_100356291 3300005549 Bacteria 1237
113 Ga0068855_100004975 3300005563 Bacteria 16212
114 Ga0068855_100013481 3300005563 Bacteria 9854
115 Ga0068855_100118779 3300005563 Bacteria 3028
116 Ga0068855_100285798 3300005563 Unclassified 1830
117 Ga0068855_100474567 3300005563 Unclassified 1362
118 Ga0070664_100027851 3300005564 Unclassified 4698
119 Ga0068857_100008943 3300005577 Bacteria 8676
120 Ga0068857_100013707 3300005577 Bacteria 7064
121 Ga0068854_100201365 3300005578 Bacteria 1565
122 Ga0068856_100000672 3300005614 Bacteria 37107
123 Ga0068856_100141284 3300005614 Bacteria 2415
124 Ga0070702_100001697 3300005615 Bacteria 9144
125 Ga0070702_100005753 3300005615 Bacteria 5809
126 Ga0070702_100009063 3300005615 Bacteria 4853
127 Ga0070702_100020219 3300005615 Bacteria 3483
128 Ga0070702_100034698 3300005615 Bacteria 2782
129 Ga0068852_100038876 3300005616 Bacteria 4003
130 Ga0068852_100400404 3300005616 Bacteria 1350
131 Ga0068859_100002374 3300005617 Bacteria 19171
132 Ga0068859_100033682 3300005617 Bacteria 5144
133 Ga0068859_100048696 3300005617 Bacteria 4257
134 Ga0068859_100076684 3300005617 Bacteria 3383
135 Ga0068859_100100504 3300005617 Bacteria 2948
136 Ga0068859_100130170 3300005617 Bacteria 2587
137 Ga0068864_100014062 3300005618 Bacteria 6638
138 Ga0068864_100075395 3300005618 Bacteria 2945
139 Ga0068864_100081288 3300005618 Bacteria 2840
140 Ga0068864_100121175 3300005618 Bacteria 2339
141 Ga0068866_10015282 3300005718 Bacteria 3408
142 Ga0068866_10076683 3300005718 Unclassified 1783
143 Ga0068861_100034300 3300005719 Bacteria 3752
144 Ga0068861_100081393 3300005719 Bacteria 2535
145 Ga0068861_100172918 3300005719 Bacteria 1792
146 Ga0068851_10004066 3300005834 Bacteria 6567
147 Ga0068870_10012649 3300005840 Bacteria 3948
148 Ga0068870_10090532 3300005840 Bacteria 1709
149 Ga0068863_100105985 3300005841 Bacteria 2674
150 Ga0068863_100160442 3300005841 Bacteria 2154
151 Ga0068863_100173827 3300005841 Bacteria 2067
152 Ga0068858_100102163 3300005842 Unclassified 2674
153 Ga0068858_100371535 3300005842 Unclassified 1371
154 Ga0068860_100008250 3300005843 Bacteria 10367
155 Ga0068860_100048263 3300005843 Unclassified 4057
156 Ga0068860_100070565 3300005843 Bacteria 3321
157 Ga0068860_100188408 3300005843 Unclassified 1996
158 Ga0068862_100019636 3300005844 Bacteria 5642
159 Ga0068862_100075108 3300005844 Bacteria 2923
160 Ga0068862_100104576 3300005844 Bacteria 2480
161 Ga0068862_100212181 3300005844 Bacteria 1750
162 Ga0081538_10001404 3300005981 Bacteria 24734
163 Ga0081538_10006787 3300005981 Bacteria 10001
164 Ga0081538_10007568 3300005981 Bacteria 9371
165 Ga0081538_10018548 3300005981 Bacteria 5218
166 Ga0081538_10049776 3300005981 Bacteria 2539
167 Ga0097621_100011834 3300006237 Bacteria 6447
168 Ga0097621_100045045 3300006237 Bacteria 3562
169 Ga0097621_100099250 3300006237 Bacteria 2447
170 Ga0068871_100002087 3300006358 Bacteria 13520
171 Ga0068871_100032180 3300006358 Unclassified 4141
172 Ga0068871_100214517 3300006358 Bacteria 1666
173 Ga0075428_100002686 3300006844 Bacteria 19337
174 Ga0075428_100013116 3300006844 Bacteria 9217
175 Ga0075428_100100453 3300006844 Bacteria 3154
176 Ga0075428_100195699 3300006844 Bacteria 2186
177 Ga0075430_100004075 3300006846 Bacteria 12332
178 Ga0075430_100011391 3300006846 Bacteria 7549
179 Ga0075430_100030324 3300006846 Bacteria 4592
180 Ga0075431_100004897 3300006847 Bacteria 13182
181 Ga0075431_100041934 3300006847 Bacteria 4719
182 Ga0075431_100063018 3300006847 Bacteria 3826
183 Ga0075431_100194535 3300006847 Bacteria 2077
184 Ga0075433_10096665 3300006852 Bacteria 2614
185 Ga0075433_10119768 3300006852 Bacteria 2336
186 Ga0075434_100088068 3300006871 Bacteria 3106
187 Ga0075429_100006439 3300006880 Bacteria 10169
188 Ga0075429_100057482 3300006880 Bacteria 3387
189 Ga0075429_100094498 3300006880 Bacteria 2607
190 Ga0075429_100206459 3300006880 Bacteria 1721
191 Ga0068865_100098514 3300006881 Bacteria 2136
192 Ga0068865_100268654 3300006881 Unclassified 1353
193 Ga0075436_100000026 3300006914 Bacteria 102984
194 Ga0097620_100002374 3300006931 Bacteria 19171
195 Ga0097620_100033682 3300006931 Bacteria 5144
196 Ga0097620_100048696 3300006931 Bacteria 4257
197 Ga0097620_100076685 3300006931 Bacteria 3383
198 Ga0097620_100100500 3300006931 Bacteria 2948
199 Ga0097620_100130177 3300006931 Bacteria 2587
200 Ga0075435_100006194 3300007076 Bacteria 8441
201 Ga0105240_10020770 3300009093 Bacteria 8748
202 Ga0105240_10241462 3300009093 Bacteria 2094
203 Ga0111539_10005528 3300009094 Bacteria 16344
204 Ga0111539_10016688 3300009094 Bacteria 9101
205 Ga0111539_10041268 3300009094 Bacteria 5549
206 Ga0111539_10081330 3300009094 Bacteria 3811
207 Ga0111539_10085870 3300009094 Bacteria 3699
208 Ga0111539_10455009 3300009094 Unclassified 1491
209 Ga0105245_10147049 3300009098 Bacteria 2224
210 Ga0105245_10188906 3300009098 Bacteria 1972
211 Ga0105245_10387371 3300009098 Bacteria 1393
212 Ga0105247_10197617 3300009101 Bacteria 1349
213 Ga0105247_10224595 3300009101 Unclassified 1273
214 Ga0114129_10021414 3300009147 Bacteria 9178
215 Ga0114129_10041020 3300009147 Bacteria 6523
216 Ga0114129_10147860 3300009147 Bacteria 3217
217 Ga0114129_10188333 3300009147 Bacteria 2803
218 Ga0114129_10188874 3300009147 Bacteria 2799
219 Ga0114129_10223244 3300009147 Unclassified 2541
220 Ga0114129_10240579 3300009147 Bacteria 2433
221 Ga0105243_10023713 3300009148 Bacteria 4676
222 Ga0105243_10056256 3300009148 Bacteria 3127
223 Ga0105243_10063147 3300009148 Bacteria 2967
224 Ga0105241_10079553 3300009174 Bacteria 2563
225 Ga0105241_10091838 3300009174 Bacteria 2396
226 Ga0105241_10225527 3300009174 Bacteria 1577
227 Ga0105242_10296328 3300009176 Bacteria 1474
228 Ga0105248_10000654 3300009177 Bacteria 39374
229 Ga0105248_10011838 3300009177 Bacteria 9623
230 Ga0105248_10024711 3300009177 Bacteria 6681
231 Ga0105248_10195946 3300009177 Bacteria 2276
232 Ga0105248_10326765 3300009177 Bacteria 1728
233 Ga0105248_10796962 3300009177 Bacteria 1066
234 Ga0105237_10005971 3300009545 Bacteria 13643
235 Ga0105237_10036829 3300009545 Bacteria 4949
236 Ga0105237_10098971 3300009545 Bacteria 2908
237 Ga0105237_10138994 3300009545 Bacteria 2423
238 Ga0105237_10245657 3300009545 Bacteria 1791
239 Ga0105238_10005220 3300009551 Bacteria 12835
240 Ga0105238_10019916 3300009551 Bacteria 6829
241 Ga0105249_10000156 3300009553 Bacteria 83676
242 Ga0105249_10119688 3300009553 Bacteria 2501
243 Ga0105249_10149374 3300009553 Bacteria 2248
244 Ga0105239_10019972 3300010375 Bacteria 7394
245 Ga0105239_10264975 3300010375 Bacteria 1932
246 Ga0105246_10017436 3300011119 Bacteria 4563
247 Ga0105246_10044706 3300011119 Bacteria 3011
248 Ga0105246_10052659 3300011119 Bacteria 2798
249 Ga0157373_10010885 3300013100 Bacteria 6695
250 Ga0157373_10028903 3300013100 Bacteria 3997
251 Ga0157373_10043843 3300013100 Bacteria 3194
252 Ga0157370_10006382 3300013104 Bacteria 13014
253 Ga0157374_10010327 3300013296 Bacteria 8030
254 Ga0157378_10005727 3300013297 Bacteria 10877
255 Ga0157378_10031284 3300013297 Unclassified 4701
256 Ga0157378_10108095 3300013297 Bacteria 2546
257 Ga0157378_10277847 3300013297 Bacteria 1613
258 Ga0163162_10000724 3300013306 Bacteria 30596
259 Ga0163162_10030896 3300013306 Bacteria 5309
260 Ga0163162_10031011 3300013306 Bacteria 5300
261 Ga0163162_10204893 3300013306 Unclassified 2102
262 Ga0163162_10399024 3300013306 Unclassified 1508
263 Ga0163162_10466426 3300013306 Unclassified 1394
264 Ga0163162_10501539 3300013306 Bacteria 1344
265 Ga0157372_10003273 3300013307 Bacteria 17504
266 Ga0157372_10014821 3300013307 Bacteria 8348
267 Ga0157372_10025926 3300013307 Bacteria 6376
268 Ga0157372_10081602 3300013307 Bacteria 3661
269 Ga0157375_10013347 3300013308 Bacteria 7306
270 Ga0157375_10068994 3300013308 Bacteria 3540
271 Ga0157375_10349333 3300013308 Bacteria 1645
272 Ga0157375_10477000 3300013308 Unclassified 1412
273 Ga0157375_10578003 3300013308 Bacteria 1284
274 Ga0163163_10000227 3300014325 Bacteria 58267
275 Ga0163163_10001411 3300014325 Bacteria 20302
276 Ga0163163_10007595 3300014325 Bacteria 9577
277 Ga0163163_10010665 3300014325 Bacteria 8282
278 Ga0157380_10002483 3300014326 Bacteria 12432
279 Ga0157380_10005600 3300014326 Bacteria 8774
280 Ga0157380_10025862 3300014326 Bacteria 4454
281 Ga0157380_10030855 3300014326 Bacteria 4109
282 Ga0157380_10087514 3300014326 Bacteria 2562
283 Ga0157377_10007225 3300014745 Bacteria 5350
284 Ga0157377_10089415 3300014745 Bacteria 1816
285 Ga0157379_10038489 3300014968 Bacteria 4267
286 Ga0157379_10290879 3300014968 Bacteria 1488
287 Ga0157376_10003474 3300014969 Bacteria 10861
288 Ga0206350_11197239 3300020080 Bacteria 2497
289 Ga0224712_10002238 3300022467 Bacteria 4730
290 Ga0224712_10007000 3300022467 Bacteria 3255
291 Ga0207697_10015922 3300025315 Bacteria 3102
292 Ga0207710_10000415 3300025900 Bacteria 28286
293 Ga0207647_10024106 3300025904 Unclassified 4013
294 Ga0207647_10044988 3300025904 Unclassified 2755
295 Ga0207645_10033781 3300025907 Bacteria 3287
296 Ga0207643_10003234 3300025908 Bacteria 8787
297 Ga0207643_10005269 3300025908 Bacteria 6916
298 Ga0207643_10008510 3300025908 Bacteria 5503
299 Ga0207705_10000288 3300025909 Bacteria 47206
300 Ga0207705_10004826 3300025909 Bacteria 10151
301 Ga0207684_10000355 3300025910 Bacteria 62655
302 Ga0207707_10018436 3300025912 Bacteria 6085
303 Ga0207707_10102008 3300025912 Bacteria 2508
304 Ga0207707_10151725 3300025912 Bacteria 2025
305 Ga0207695_10006136 3300025913 Bacteria 15674
306 Ga0207695_10120525 3300025913 Bacteria 2592
307 Ga0207671_10004336 3300025914 Bacteria 13624
308 Ga0207671_10048363 3300025914 Bacteria 3148
309 Ga0207671_10060997 3300025914 Bacteria 2798
310 Ga0207671_10103595 3300025914 Bacteria 2158
311 Ga0207671_10134138 3300025914 Bacteria 1903
312 Ga0207660_10064964 3300025917 Bacteria 2635
313 Ga0207660_10078320 3300025917 Bacteria 2422
314 Ga0207660_10307278 3300025917 Unclassified 1264
315 Ga0207662_10016871 3300025918 Bacteria 4126
316 Ga0207662_10129779 3300025918 Unclassified 1588
317 Ga0207657_10075717 3300025919 Bacteria 2840
318 Ga0207652_10023126 3300025921 Bacteria 5147
319 Ga0207652_10062699 3300025921 Bacteria 3213
320 Ga0207652_10071838 3300025921 Bacteria 3008
321 Ga0207681_10090354 3300025923 Unclassified 2186
322 Ga0207681_10098923 3300025923 Bacteria 2099
323 Ga0207681_10106629 3300025923 Bacteria 2031
324 Ga0207694_10005795 3300025924 Bacteria 9465
325 Ga0207650_10000126 3300025925 Bacteria 95820
326 Ga0207650_10007159 3300025925 Bacteria 7603
327 Ga0207650_10074339 3300025925 Bacteria 2562
328 Ga0207650_10211217 3300025925 Unclassified 1558
329 Ga0207659_10180703 3300025926 Unclassified 1671
330 Ga0207687_10056249 3300025927 Bacteria 2759
331 Ga0207687_10112599 3300025927 Bacteria 2023
332 Ga0207644_10047811 3300025931 Bacteria 3055
333 Ga0207644_10063169 3300025931 Bacteria 2688
334 Ga0207644_10125497 3300025931 Bacteria 1959
335 Ga0207706_10016221 3300025933 Bacteria 6732
336 Ga0207709_10139723 3300025935 Bacteria 1663
337 Ga0207670_10000672 3300025936 Bacteria 18112
338 Ga0207670_10058921 3300025936 Bacteria 2610
339 Ga0207691_10021521 3300025940 Bacteria 6088
340 Ga0207691_10024825 3300025940 Bacteria 5634
341 Ga0207711_10003330 3300025941 Bacteria 13938
342 Ga0207711_10034858 3300025941 Bacteria 4263
343 Ga0207711_10070960 3300025941 Bacteria 3021
344 Ga0207689_10020724 3300025942 Bacteria 5528
345 Ga0207689_10080268 3300025942 Bacteria 2681
346 Ga0207689_10118927 3300025942 Unclassified 2173
347 Ga0207661_10039205 3300025944 Unclassified 3717
348 Ga0207679_10014554 3300025945 Bacteria 5176
349 Ga0207679_10143029 3300025945 Bacteria 1936
350 Ga0207667_10010029 3300025949 Bacteria 11107
351 Ga0207667_10025107 3300025949 Bacteria 6531
352 Ga0207667_10043319 3300025949 Bacteria 4777
353 Ga0207651_10002216 3300025960 Bacteria 9198
354 Ga0207651_10063377 3300025960 Bacteria 2581
355 Ga0207712_10000123 3300025961 Bacteria 83597
356 Ga0207712_10158264 3300025961 Bacteria 1757
357 Ga0207668_10000593 3300025972 Bacteria 22515
358 Ga0207640_10012308 3300025981 Bacteria 4869
359 Ga0207703_10089054 3300026035 Bacteria 2591
360 Ga0207703_10095930 3300026035 Unclassified 2503
361 Ga0207639_10037554 3300026041 Bacteria 3598
362 Ga0207639_10039804 3300026041 Bacteria 3505
363 Ga0207639_10095761 3300026041 Bacteria 2386
364 Ga0207678_10002795 3300026067 Bacteria 15838
365 Ga0207678_10004070 3300026067 Bacteria 13159
366 Ga0207708_10011578 3300026075 Bacteria 6574
367 Ga0207708_10011629 3300026075 Bacteria 6560
368 Ga0207708_10020116 3300026075 Bacteria 5034
369 Ga0207708_10080823 3300026075 Bacteria 2498
370 Ga0207708_10272245 3300026075 Bacteria 1370
371 Ga0207702_10029632 3300026078 Bacteria 4556
372 Ga0207641_10038625 3300026088 Bacteria 3991
373 Ga0207641_10064206 3300026088 Bacteria 3138
374 Ga0207641_10104471 3300026088 Bacteria 2501
375 Ga0207641_10276492 3300026088 Bacteria 1577
376 Ga0207648_10015446 3300026089 Bacteria 7022
377 Ga0207648_10246270 3300026089 Bacteria 1593
378 Ga0207648_10369637 3300026089 Bacteria 1295
379 Ga0207676_10029332 3300026095 Bacteria 4117
380 Ga0207676_10079640 3300026095 Bacteria 2657
381 Ga0207674_10002071 3300026116 Bacteria 25430
382 Ga0207674_10004267 3300026116 Bacteria 17241
383 Ga0207674_10040540 3300026116 Bacteria 4822
384 Ga0207674_10085568 3300026116 Bacteria 3148
385 Ga0207674_10088158 3300026116 Unclassified 3096
386 Ga0207674_10110943 3300026116 Unclassified 2718
387 Ga0207674_10129388 3300026116 Bacteria 2489
388 Ga0207674_10221098 3300026116 Bacteria 1842
389 Ga0207674_10229383 3300026116 Bacteria 1805
390 Ga0207674_10240519 3300026116 Unclassified 1757
391 Ga0207675_100024853 3300026118 Bacteria 5575
392 Ga0207675_100052571 3300026118 Bacteria 3801
393 Ga0207675_100097466 3300026118 Unclassified 2769
394 Ga0207675_100163724 3300026118 Bacteria 2123
395 Ga0207683_10041261 3300026121 Bacteria 4029
396 Ga0207428_10015300 3300027907 Bacteria 6639
397 Ga0207428_10019871 3300027907 Bacteria 5720
398 Ga0207428_10043277 3300027907 Unclassified 3638
399 Ga0207428_10083407 3300027907 Bacteria 2493
400 Ga0268265_10164517 3300028380 Bacteria 1889
401 Ga0268264_10017843 3300028381 Bacteria 5809
402 Ga0268264_10049082 3300028381 Unclassified 3510
403 Ga0268264_10080618 3300028381 Bacteria 2779
404 Ga0268264_10101188 3300028381 Bacteria 2504
405 Ga0268264_10269182 3300028381 Unclassified 1591
406 Ga0268264_10363642 3300028381 Bacteria 1381
407 Ga0265325_10001316 3300031241 Bacteria 17579
408 Ga0265340_10000709 3300031247 Bacteria 18827
409 Ga0265331_10007406 3300031250 Bacteria 6354
410 Ga0265327_10068212 3300031251 Unclassified 1790
411 Ga0307513_10012601 3300031456 Bacteria 10424
412 Ga0307408_100008359 3300031548 Bacteria 6834
413 Ga0307408_100022439 3300031548 Bacteria 4289
414 Ga0307408_100262485 3300031548 Bacteria 1430
415 Ga0307408_100332240 3300031548 Unclassified 1284
416 Ga0265313_10002468 3300031595 Bacteria 15937
417 Ga0265314_10041343 3300031711 Unclassified 3301
418 Ga0307405_10004407 3300031731 Bacteria 6654
419 Ga0307405_10020750 3300031731 Unclassified 3678
420 Ga0307405_10021065 3300031731 Bacteria 3658
421 Ga0307405_10096381 3300031731 Bacteria 1972
422 Ga0307405_10221360 3300031731 Unclassified 1389
423 Ga0307405_10229156 3300031731 Unclassified 1368
424 Ga0307413_10055334 3300031824 Bacteria 2413
425 Ga0307413_10075825 3300031824 Bacteria 2135
426 Ga0307413_10077543 3300031824 Unclassified 2116
427 Ga0307413_10286197 3300031824 Unclassified 1242
428 Ga0307410_10019585 3300031852 Unclassified 4119
429 Ga0307410_10023984 3300031852 Bacteria 3804
430 Ga0307410_10070371 3300031852 Bacteria 2423
431 Ga0307410_10189094 3300031852 Unclassified 1564
432 Ga0307410_10209404 3300031852 Bacteria 1493
433 Ga0307406_10001282 3300031901 Bacteria 14084
434 Ga0307406_10001622 3300031901 Bacteria 12372
435 Ga0307406_10009071 3300031901 Bacteria 5565
436 Ga0307406_10061752 3300031901 Bacteria 2421
437 Ga0307406_10122599 3300031901 Bacteria 1810
438 Ga0307406_10166722 3300031901 Bacteria 1590
439 Ga0307406_10239790 3300031901 Unclassified 1359
440 Ga0307407_10006166 3300031903 Bacteria 5296
441 Ga0307407_10018990 3300031903 Unclassified 3491
442 Ga0307407_10025948 3300031903 Bacteria 3097
443 Ga0307407_10064587 3300031903 Bacteria 2152
444 Ga0307407_10205164 3300031903 Bacteria 1323
445 Ga0307412_10014948 3300031911 Bacteria 4590
446 Ga0307412_10016821 3300031911 Bacteria 4367
447 Ga0307412_10236020 3300031911 Unclassified 1411
448 Ga0307409_100003923 3300031995 Bacteria 8237
449 Ga0307409_100012465 3300031995 Bacteria 5418
450 Ga0307409_100020367 3300031995 Bacteria 4518
451 Ga0307409_100063974 3300031995 Unclassified 2887
452 Ga0307409_100226123 3300031995 Bacteria 1692
453 Ga0307409_100230611 3300031995 Bacteria 1678
454 Ga0307416_100015729 3300032002 Bacteria 5235
455 Ga0307416_100065237 3300032002 Bacteria 2991
456 Ga0307416_100073515 3300032002 Unclassified 2851
457 Ga0307416_100082345 3300032002 Bacteria 2726
458 Ga0307416_100182229 3300032002 Bacteria 1969
459 Ga0307416_100474499 3300032002 Bacteria 1309
460 Ga0307414_10001934 3300032004 Bacteria 10717
461 Ga0307414_10199512 3300032004 Unclassified 1626
462 Ga0307414_10340469 3300032004 Bacteria 1284
463 Ga0307414_10431795 3300032004 Bacteria 1151
464 Ga0307411_10023008 3300032005 Bacteria 3682
465 Ga0307411_10031419 3300032005 Bacteria 3267
466 Ga0307411_10090921 3300032005 Unclassified 2130
467 Ga0307411_10384054 3300032005 Bacteria 1156
468 Ga0307415_100000285 3300032126 Bacteria 21933
469 Ga0307415_100006915 3300032126 Bacteria 6159
470 Ga0307415_100008202 3300032126 Bacteria 5779
471 Ga0307415_100035784 3300032126 Bacteria 3246
472 Ga0307415_100069845 3300032126 Bacteria 2464
473 Ga0307415_100075723 3300032126 Bacteria 2383
474 Ga0307415_100078027 3300032126 Bacteria 2354
475 Ga0307415_100099158 3300032126 Bacteria 2131
476 Ga0307415_100122999 3300032126 Unclassified 1949
477 Ga0373942_0005763 3300035207 Unclassified 2868
478 Ga0395900_0157287 3300037418 Bacteria 2321
479 Ga0395898_0122852 3300037466 Bacteria 2488
480 Ga0395905_0012079 3300037471 Bacteria 8323
481 Ga0436365_0919346 3300039437 Bacteria 2458
482 Ga0436365_1507749 3300039437 Bacteria 4250
483 Ga0436363_0567417 3300039450 Bacteria 3952
484 Ga0439448_0002497 3300042005 Bacteria 5005
485 Ga0439463_000494 3300042016 Bacteria 11025
486 Ga0450888_002104 3300042126 Bacteria 1951
487 Ga0450900_000045 3300042136 Bacteria 5659
488 Ga0439444_0000494 3300042437 Bacteria 4434
489 Ga0439459_0023222 3300042438 Bacteria 1207
490 Ga0439464_0017820 3300042439 Bacteria 1928
491 Ga0439464_0021738 3300042439 Unclassified 1762
492 Ga0439460_0000465 3300042461 Bacteria 8769
493 Ga0439460_0039242 3300042461 Bacteria 1383
494 Ga0439440_0000219 3300042993 Bacteria 8984
495 Ga0466966_0085120 3300044684 Bacteria 1966
496 Ga0466963_0089181 3300044694 Bacteria 2098
497 Ga0466970_0074987 3300044765 Bacteria 1822
498 Ga0466959_0062728 3300045049 Bacteria 2700
499 Ga0466958_0085605 3300045836 Bacteria 1944
500 Ga0495663_0000334 3300046525 Bacteria 17463
501 Ga0495621_0000025 3300046539 Bacteria 28091
502 Ga0495668_0111650 3300046616 Bacteria 1495
503 Ga0495636_0028590 3300047318 Bacteria 2275
504 Ga0496104_0295684 3300048907 Bacteria 1532
505 Ga0496106_0056965 3300048909 Bacteria 2955
506 Ga0496108_0160431 3300048911 Unclassified 1943
507 Ga0496112_0181198 3300048915 Bacteria 2071
508 Ga0501291_003289 3300049514 Unclassified 2001
509 Ga0501291_003885 3300049514 Bacteria 1883
510 Ga0501292_003193 3300049515 Bacteria 2173
511 Ga0501296_000227 3300049519 Bacteria 5812
512 Ga0501296_005022 3300049519 Bacteria 1461
513 Ga0501298_000130 3300049521 Bacteria 9024
514 Ga0501299_000263 3300049522 Bacteria 6024
515 Ga0501031_0001034 3300049568 Bacteria 16873
516 Ga0501031_0012339 3300049568 Bacteria 5572
517 Ga0501031_0034956 3300049568 Bacteria 3278
518 Ga0501031_0083925 3300049568 Bacteria 2076
519 Ga0501032_0103508 3300049569 Bacteria 1886
520 Ga0501033_0011772 3300049570 Bacteria 6687
521 Ga0501033_0028529 3300049570 Bacteria 4192
522 Ga0501034_0087936 3300049571 Bacteria 3106
523 Ga0501034_0395751 3300049571 Bacteria 1305
524 Ga0501036_0001554 3300049572 Bacteria 17736
525 Ga0501036_0035732 3300049572 Bacteria 4204
526 Ga0501036_0063108 3300049572 Bacteria 3137
527 Ga0501036_0067321 3300049572 Bacteria 3029
528 Ga0501036_0214806 3300049572 Bacteria 1616
529 Ga0501036_0275786 3300049572 Bacteria 1407
530 Ga0501037_0007723 3300049573 Bacteria 7874
531 Ga0501037_0008645 3300049573 Bacteria 7467
532 Ga0501037_0037838 3300049573 Bacteria 3557
533 Ga0501038_0001526 3300049574 Bacteria 21348
534 Ga0501038_0001703 3300049574 Bacteria 20414
535 Ga0501038_0098946 3300049574 Unclassified 2431
536 Ga0501038_0113258 3300049574 Bacteria 2245
537 Ga0501039_0000609 3300049575 Bacteria 25844
538 Ga0501039_0001558 3300049575 Bacteria 16872
539 Ga0501039_0068531 3300049575 Bacteria 2754
540 Ga0501040_0000855 3300049576 Bacteria 19109
541 Ga0501040_0005416 3300049576 Bacteria 8258
542 Ga0501040_0037493 3300049576 Unclassified 3293
543 Ga0501040_0057096 3300049576 Bacteria 2679
544 Ga0501041_0002766 3300049577 Bacteria 10024
545 Ga0501041_0005724 3300049577 Bacteria 7262
546 Ga0501041_0007445 3300049577 Bacteria 6426
547 Ga0501041_0071283 3300049577 Bacteria 2133
548 Ga0501042_0000767 3300049578 Bacteria 17490
549 Ga0501042_0008164 3300049578 Bacteria 6897
550 Ga0501043_0044204 3300049579 Bacteria 3502
551 Ga0501043_0114958 3300049579 Bacteria 2112
552 Ga0501043_0165787 3300049579 Bacteria 1725
553 Ga0501046_0005270 3300049580 Bacteria 11562
554 Ga0501046_0005589 3300049580 Bacteria 11226
555 Ga0501046_0019854 3300049580 Bacteria 5565
556 Ga0501046_0121876 3300049580 Bacteria 1983
557 Ga0501047_0096776 3300049581 Bacteria 2830
558 Ga0501048_0000132 3300049582 Bacteria 44381
559 Ga0501048_0005232 3300049582 Bacteria 9884
560 Ga0501048_0021229 3300049582 Bacteria 4754
561 Ga0501048_0033426 3300049582 Bacteria 3715
562 Ga0501068_0008798 3300049584 Bacteria 5631
563 Ga0501068_0013422 3300049584 Bacteria 4661
564 Ga0501068_0016121 3300049584 Bacteria 4304
565 Ga0501068_0062491 3300049584 Bacteria 2265
566 Ga0501069_0007016 3300049585 Bacteria 5897
567 Ga0501070_0008580 3300049586 Bacteria 8641
568 Ga0501070_0112371 3300049586 Bacteria 2251
569 Ga0501071_0000791 3300049587 Bacteria 16853
570 Ga0501071_0027836 3300049587 Bacteria 3979
571 Ga0501071_0136464 3300049587 Bacteria 1826
572 Ga0501072_0004053 3300049588 Bacteria 11093
573 Ga0501072_0012186 3300049588 Bacteria 6569
574 Ga0501072_0050849 3300049588 Bacteria 3263
575 Ga0501072_0080455 3300049588 Bacteria 2581
576 Ga0501073_0007434 3300049589 Bacteria 8144
577 Ga0501074_0001254 3300049590 Bacteria 16760
578 Ga0501075_0000069 3300049591 Bacteria 45091
579 Ga0501075_0001188 3300049591 Bacteria 16846
580 Ga0501075_0014481 3300049591 Bacteria 5651
581 Ga0501075_0050302 3300049591 Bacteria 3132
582 Ga0501075_0091393 3300049591 Bacteria 2310
583 Ga0501076_0000218 3300049592 Bacteria 34686
584 Ga0501076_0018405 3300049592 Bacteria 5325
585 Ga0501076_0042859 3300049592 Bacteria 3564
586 Ga0501077_0001711 3300049593 Bacteria 13231
587 Ga0501077_0014796 3300049593 Bacteria 4903
588 Ga0501077_0016485 3300049593 Bacteria 4656
589 Ga0501077_0053767 3300049593 Unclassified 2556
590 Ga0501077_0089099 3300049593 Bacteria 1955
591 Ga0501198_000735 3300049649 Unclassified 4094
592 Ga0501198_002044 3300049649 Bacteria 2686
593 Ga0501202_000706 3300049652 Bacteria 4982
594 Ga0501206_005711 3300049653 Bacteria 1605
595 Ga0501217_000434 3300049661 Bacteria 6814
596 Ga0501217_000858 3300049661 Bacteria 5381
597 Ga0501217_002391 3300049661 Bacteria 3692
598 Ga0501217_011295 3300049661 Bacteria 1973
599 Ga0501223_010710 3300049663 Unclassified 1842
600 Ga0501224_003366 3300049664 Unclassified 2225
601 Ga0501224_004603 3300049664 Bacteria 1962
602 Ga0501227_008067 3300049665 Bacteria 2260
603 Ga0501233_002950 3300049668 Bacteria 3037
604 Ga0501233_007207 3300049668 Unclassified 2111
605 Ga0501235_007284 3300049669 Bacteria 2412
606 Ga0501235_013046 3300049669 Unclassified 1828
607 Ga0501249_007021 3300049679 Bacteria 2321
608 Ga0501257_010754 3300049686 Unclassified 2081
609 Ga0501260_003354 3300049689 Bacteria 1434
610 Ga0501261_000814 3300049690 Bacteria 3901
611 Ga0501221_002707 3300049704 Bacteria 2914
612 Ga0501225_0001642 3300049705 Bacteria 6979
613 Ga0501225_0009650 3300049705 Bacteria 2743
614 Ga0501225_0010310 3300049705 Bacteria 2649
615 Ga0501229_009441 3300049706 Bacteria 1225
616 Ga0501234_000377 3300049707 Bacteria 6617
617 Ga0501079_0000429 3300049741 Bacteria 27323
618 Ga0501079_0001265 3300049741 Bacteria 17741
619 Ga0501079_0020992 3300049741 Bacteria 4992
620 Ga0501079_0023401 3300049741 Bacteria 4740
621 Ga0501080_0020650 3300049742 Bacteria 6101
622 Ga0501081_0002589 3300049743 Bacteria 11430
623 Ga0501081_0004612 3300049743 Bacteria 8846
624 Ga0501081_0029208 3300049743 Bacteria 3725
625 Ga0501081_0108054 3300049743 Bacteria 1973
626 Ga0501083_0065131 3300049744 Bacteria 2427
627 Ga0501083_0073715 3300049744 Bacteria 2269
628 Ga0501083_0083246 3300049744 Bacteria 2119
629 Ga0501268_003937 3300049765 Bacteria 2067
630 Ga0501273_001964 3300049770 Bacteria 2042
631 Ga0501279_006209 3300049775 Bacteria 1577
632 Ga0501283_000480 3300049779 Bacteria 5251
633 Ga0501035_0005520 3300049822 Bacteria 11951
634 Ga0501035_0035901 3300049822 Bacteria 4496
635 Ga0501035_0127598 3300049822 Bacteria 2220
636 Ga0501044_0011482 3300049823 Bacteria 9597
637 Ga0501045_0001302 3300049824 Bacteria 16560
638 Ga0501045_0001782 3300049824 Bacteria 14544
639 Ga0501045_0007136 3300049824 Bacteria 7751
640 Ga0501045_0018529 3300049824 Bacteria 4953
641 Ga0501045_0043747 3300049824 Bacteria 3261
642 Ga0501212_003257 3300049851 Bacteria 2024
643 Ga0501226_005600 3300049853 Bacteria 1429
644 nmdc:mga05p37_115263_c1 3300050507 Unclassified 3303
645 nmdc:mga05p37_183956_c1 3300050507 Unclassified 2541
646 nmdc:mga05p37_33255_c2 3300050507 Bacteria 4804
647 nmdc:mga05p37_51793_c1 3300050507 Bacteria 5048
648 nmdc:mga05p37_96167_c1 3300050507 Bacteria 3649
649 nmdc:mga09592_109473_c1 3300050508 Bacteria 2370
650 nmdc:mga09592_146634_c1 3300050508 Bacteria 2035
651 nmdc:mga09592_4051_c1 3300050508 Bacteria 11826
652 nmdc:mga09592_72204_c1 3300050508 Bacteria 2930
653 nmdc:mga0qj67_1648_c1 3300050509 Bacteria 15729
654 nmdc:mga0qj67_3059_c1 3300050509 Bacteria 12024
655 nmdc:mga0qj67_76628_c1 3300050509 Bacteria 2675
656 nmdc:mga06r32_166710_c1 3300050510 Unclassified 2186
657 nmdc:mga06r32_19281_c1 3300050510 Bacteria 6259
658 nmdc:mga06r32_28153_c1 3300050510 Bacteria 5255
659 nmdc:mga06r32_9916_c1 3300050510 Bacteria 8596
660 nmdc:mga08y16_135556_c1 3300050511 Bacteria 2559
661 nmdc:mga08y16_19954_c1 3300050511 Bacteria 7072
662 nmdc:mga08y16_291980_c1 3300050511 Bacteria 1681
663 nmdc:mga08y16_63911_c1 3300050511 Unclassified 3844
664 nmdc:mga0n895_82008_c1 3300050512 Bacteria 3214
665 nmdc:mga0rr50_255_c1 3300050513 Bacteria 18439
666 nmdc:mga08x19_26_c1 3300050514 Bacteria 228913
667 nmdc:mga0a205_145985_c1 3300050515 Bacteria 2266
668 nmdc:mga0a205_92248_c1 3300050515 Bacteria 2926
669 Ga0501084_0000597 3300054114 Bacteria 27610
670 Ga0501084_0002383 3300054114 Bacteria 15119
671 Ga0501084_0041977 3300054114 Bacteria 3825
672 Ga0501084_0052814 3300054114 Bacteria 3400
673 Ga0590074_006975 3300059423 Bacteria 1876
674 Ga0501082_0001027 3300060353 Bacteria 24703
675 Ga0501082_0003746 3300060353 Bacteria 13291
676 Ga0501082_0012767 3300060353 Bacteria 7218
677 Ga0501082_0048752 3300060353 Bacteria 3651
678 Ga0501082_0083003 3300060353 Bacteria 2764
679 Ga0466962_0100086 3300061719 Bacteria 1392
680 Ga0530510_0000273 3300061734 Bacteria 32644
681 Ga0530510_0001188 3300061734 Bacteria 17321
682 Ga0530510_0014660 3300061734 Bacteria 5533
683 Ga0530510_0036302 3300061734 Unclassified 3553
684 Ga0530510_0044137 3300061734 Bacteria 3221
685 Ga0501037_0011200
686 SwRhRL2b_contig_2001657
687 JGI24737J22298_10047258
688 JGI24751J29686_10000026
689 rootH1_10143967
690 Ga0065714_10064430
691 Ga0065704_10013593
692 Ga0065704_10073219
693 Ga0065712_10002775
694 Ga0065712_10018115
695 Ga0065712_10067738
696 Ga0065712_10072144
697 Ga0065715_10006128
698 Ga0065715_10089039
699 Ga0065715_10091882
700 Ga0065715_10101202
701 Ga0065715_10120383
702 Ga0065707_10002153
703 Ga0065707_10011279
704 Ga0065707_10110047
705 Ga0065707_10112447
706 Ga0065707_10131108
707 Ga0070658_10015584
708 Ga0070683_100118232
709 Ga0070690_100006865
710 Ga0070690_100020763
711 Ga0070690_100077950
712 Ga0070670_100000076
713 Ga0070670_100002745
714 Ga0070670_100144721
715 Ga0070670_100268132
716 Ga0070670_100306271
717 Ga0068869_100012018
718 Ga0070680_100080757
719 Ga0070680_100344937
720 Ga0070682_100004777
721 Ga0070682_100058747
722 Ga0070682_100063091
723 Ga0068868_100222948
724 Ga0070689_100000568
725 Ga0070689_100086506
726 Ga0070661_100028001
727 Ga0070661_100242568
728 Ga0070692_10001088
729 Ga0070692_10004133
730 Ga0070668_100000175
731 Ga0070669_100009766
732 Ga0070669_100024430
733 Ga0070669_100185026
734 Ga0070669_100195119
735 Ga0070671_100025255
736 Ga0070671_100045780
737 Ga0070673_100003964
738 Ga0070673_100019727
739 Ga0070673_100283187
740 Ga0070688_100064066
741 Ga0070688_100091175
742 Ga0070667_100053575
743 Ga0070703_10011365
744 Ga0070705_100017313
745 Ga0070705_100143462
746 Ga0070700_100021501
747 Ga0070700_100022530
748 Ga0070700_100033969
749 Ga0070700_100065601
750 Ga0070700_100113525
751 Ga0070694_100004070
752 Ga0070694_100021120
753 Ga0070694_100022411
754 Ga0070694_100137813
755 Ga0070694_100227589
756 Ga0070708_100020620
757 Ga0070663_100007406
758 Ga0070662_100070118
759 Ga0070662_100070911
760 Ga0070681_10005775
761 Ga0070681_10005921
762 Ga0070681_10068816
763 Ga0070681_10435978
764 Ga0068867_100088900
765 Ga0068867_100210504
766 Ga0070706_100000376
767 Ga0070706_100259352
768 Ga0070698_100029404
769 Ga0070698_100088803
770 Ga0070699_100017701
771 Ga0070679_100031760
772 Ga0070679_100051784
773 Ga0070679_100088690
774 Ga0070684_100023111
775 Ga0070684_100127801
776 Ga0070697_100000055
777 Ga0070697_100000201
778 Ga0070697_100047592
779 Ga0070697_100047951
780 Ga0068853_100007830
781 Ga0068853_100025941
782 Ga0068853_100052706
783 Ga0070672_100010743
784 Ga0070672_100016661
785 Ga0070686_100021014
786 Ga0070686_100033368
787 Ga0070686_100195848
788 Ga0070695_100030337
789 Ga0070695_100034151
790 Ga0070665_100065367
791 Ga0070704_100017562
792 Ga0070704_100073962
793 Ga0070704_100102081
794 Ga0070704_100146870
795 Ga0070704_100207544
796 Ga0070704_100356291
797 Ga0068855_100004975
798 Ga0068855_100013481
799 Ga0068855_100118779
800 Ga0068855_100285798
801 Ga0068855_100474567
802 Ga0070664_100027851
803 Ga0068857_100008943
804 Ga0068857_100013707
805 Ga0068854_100201365
806 Ga0068856_100000672
807 Ga0068856_100141284
808 Ga0070702_100001697
809 Ga0070702_100005753
810 Ga0070702_100009063
811 Ga0070702_100020219
812 Ga0070702_100034698
813 Ga0068852_100038876
814 Ga0068852_100400404
815 Ga0068859_100002374
816 Ga0068859_100033682
817 Ga0068859_100048696
818 Ga0068859_100076684
819 Ga0068859_100100504
820 Ga0068859_100130170
821 Ga0068864_100014062
822 Ga0068864_100075395
823 Ga0068864_100081288
824 Ga0068864_100121175
825 Ga0068866_10015282
826 Ga0068866_10076683
827 Ga0068861_100034300
828 Ga0068861_100081393
829 Ga0068861_100172918
830 Ga0068851_10004066
831 Ga0068870_10012649
832 Ga0068870_10090532
833 Ga0068863_100105985
834 Ga0068863_100160442
835 Ga0068863_100173827
836 Ga0068858_100102163
837 Ga0068858_100371535
838 Ga0068860_100008250
839 Ga0068860_100048263
840 Ga0068860_100070565
841 Ga0068860_100188408
842 Ga0068862_100019636
843 Ga0068862_100075108
844 Ga0068862_100104576
845 Ga0068862_100212181
846 Ga0081538_10001404
847 Ga0081538_10006787
848 Ga0081538_10007568
849 Ga0081538_10018548
850 Ga0081538_10049776
851 Ga0097621_100011834
852 Ga0097621_100045045
853 Ga0097621_100099250
854 Ga0068871_100002087
855 Ga0068871_100032180
856 Ga0068871_100214517
857 Ga0075428_100002686
858 Ga0075428_100013116
859 Ga0075428_100100453
860 Ga0075428_100195699
861 Ga0075430_100004075
862 Ga0075430_100011391
863 Ga0075430_100030324
864 Ga0075431_100004897
865 Ga0075431_100041934
866 Ga0075431_100063018
867 Ga0075431_100194535
868 Ga0075433_10096665
869 Ga0075433_10119768
870 Ga0075434_100088068
871 Ga0075429_100006439
872 Ga0075429_100057482
873 Ga0075429_100094498
874 Ga0075429_100206459
875 Ga0068865_100098514
876 Ga0068865_100268654
877 Ga0075436_100000026
878 Ga0097620_100002374
879 Ga0097620_100033682
880 Ga0097620_100048696
881 Ga0097620_100076685
882 Ga0097620_100100500
883 Ga0097620_100130177
884 Ga0075435_100006194
885 Ga0105240_10020770
886 Ga0105240_10241462
887 Ga0111539_10005528
888 Ga0111539_10016688
889 Ga0111539_10041268
890 Ga0111539_10081330
891 Ga0111539_10085870
892 Ga0111539_10455009
893 Ga0105245_10147049
894 Ga0105245_10188906
895 Ga0105245_10387371
896 Ga0105247_10197617
897 Ga0105247_10224595
898 Ga0114129_10021414
899 Ga0114129_10041020
900 Ga0114129_10147860
901 Ga0114129_10188333
902 Ga0114129_10188874
903 Ga0114129_10223244
904 Ga0114129_10240579
905 Ga0105243_10023713
906 Ga0105243_10056256
907 Ga0105243_10063147
908 Ga0105241_10079553
909 Ga0105241_10091838
910 Ga0105241_10225527
911 Ga0105242_10296328
912 Ga0105248_10000654
913 Ga0105248_10011838
914 Ga0105248_10024711
915 Ga0105248_10195946
916 Ga0105248_10326765
917 Ga0105248_10796962
918 Ga0105237_10005971
919 Ga0105237_10036829
920 Ga0105237_10098971
921 Ga0105237_10138994
922 Ga0105237_10245657
923 Ga0105238_10005220
924 Ga0105238_10019916
925 Ga0105249_10000156
926 Ga0105249_10119688
927 Ga0105249_10149374
928 Ga0105239_10019972
929 Ga0105239_10264975
930 Ga0105246_10017436
931 Ga0105246_10044706
932 Ga0105246_10052659
933 Ga0157373_10010885
934 Ga0157373_10028903
935 Ga0157373_10043843
936 Ga0157370_10006382
937 Ga0157374_10010327
938 Ga0157378_10005727
939 Ga0157378_10031284
940 Ga0157378_10108095
941 Ga0157378_10277847
942 Ga0163162_10000724
943 Ga0163162_10030896
944 Ga0163162_10031011
945 Ga0163162_10204893
946 Ga0163162_10399024
947 Ga0163162_10466426
948 Ga0163162_10501539
949 Ga0157372_10003273
950 Ga0157372_10014821
951 Ga0157372_10025926
952 Ga0157372_10081602
953 Ga0157375_10013347
954 Ga0157375_10068994
955 Ga0157375_10349333
956 Ga0157375_10477000
957 Ga0157375_10578003
958 Ga0163163_10000227
959 Ga0163163_10001411
960 Ga0163163_10007595
961 Ga0163163_10010665
962 Ga0157380_10002483
963 Ga0157380_10005600
964 Ga0157380_10025862
965 Ga0157380_10030855
966 Ga0157380_10087514
967 Ga0157377_10007225
968 Ga0157377_10089415
969 Ga0157379_10038489
970 Ga0157379_10290879
971 Ga0157376_10003474
972 Ga0206350_11197239
973 Ga0224712_10002238
974 Ga0224712_10007000
975 Ga0207697_10015922
976 Ga0207710_10000415
977 Ga0207647_10024106
978 Ga0207647_10044988
979 Ga0207645_10033781
980 Ga0207643_10003234
981 Ga0207643_10005269
982 Ga0207643_10008510
983 Ga0207705_10000288
984 Ga0207705_10004826
985 Ga0207684_10000355
986 Ga0207707_10018436
987 Ga0207707_10102008
988 Ga0207707_10151725
989 Ga0207695_10006136
990 Ga0207695_10120525
991 Ga0207671_10004336
992 Ga0207671_10048363
993 Ga0207671_10060997
994 Ga0207671_10103595
995 Ga0207671_10134138
996 Ga0207660_10064964
997 Ga0207660_10078320
998 Ga0207660_10307278
999 Ga0207662_10016871
1000 Ga0207662_10129779
1001 Ga0207657_10075717
1002 Ga0207652_10023126
1003 Ga0207652_10062699
1004 Ga0207652_10071838
1005 Ga0207681_10090354
1006 Ga0207681_10098923
1007 Ga0207681_10106629
1008 Ga0207694_10005795
1009 Ga0207650_10000126
1010 Ga0207650_10007159
1011 Ga0207650_10074339
1012 Ga0207650_10211217
1013 Ga0207659_10180703
1014 Ga0207687_10056249
1015 Ga0207687_10112599
1016 Ga0207644_10047811
1017 Ga0207644_10063169
1018 Ga0207644_10125497
1019 Ga0207706_10016221
1020 Ga0207709_10139723
1021 Ga0207670_10000672
1022 Ga0207670_10058921
1023 Ga0207691_10021521
1024 Ga0207691_10024825
1025 Ga0207711_10003330
1026 Ga0207711_10034858
1027 Ga0207711_10070960
1028 Ga0207689_10020724
1029 Ga0207689_10080268
1030 Ga0207689_10118927
1031 Ga0207661_10039205
1032 Ga0207679_10014554
1033 Ga0207679_10143029
1034 Ga0207667_10010029
1035 Ga0207667_10025107
1036 Ga0207667_10043319
1037 Ga0207651_10002216
1038 Ga0207651_10063377
1039 Ga0207712_10000123
1040 Ga0207712_10158264
1041 Ga0207668_10000593
1042 Ga0207640_10012308
1043 Ga0207703_10089054
1044 Ga0207703_10095930
1045 Ga0207639_10037554
1046 Ga0207639_10039804
1047 Ga0207639_10095761
1048 Ga0207678_10002795
1049 Ga0207678_10004070
1050 Ga0207708_10011578
1051 Ga0207708_10011629
1052 Ga0207708_10020116
1053 Ga0207708_10080823
1054 Ga0207708_10272245
1055 Ga0207702_10029632
1056 Ga0207641_10038625
1057 Ga0207641_10064206
1058 Ga0207641_10104471
1059 Ga0207641_10276492
1060 Ga0207648_10015446
1061 Ga0207648_10246270
1062 Ga0207648_10369637
1063 Ga0207676_10029332
1064 Ga0207676_10079640
1065 Ga0207674_10002071
1066 Ga0207674_10004267
1067 Ga0207674_10040540
1068 Ga0207674_10085568
1069 Ga0207674_10088158
1070 Ga0207674_10110943
1071 Ga0207674_10129388
1072 Ga0207674_10221098
1073 Ga0207674_10229383
1074 Ga0207674_10240519
1075 Ga0207675_100024853
1076 Ga0207675_100052571
1077 Ga0207675_100097466
1078 Ga0207675_100163724
1079 Ga0207683_10041261
1080 Ga0207428_10015300
1081 Ga0207428_10019871
1082 Ga0207428_10043277
1083 Ga0207428_10083407
1084 Ga0268265_10164517
1085 Ga0268264_10017843
1086 Ga0268264_10049082
1087 Ga0268264_10080618
1088 Ga0268264_10101188
1089 Ga0268264_10269182
1090 Ga0268264_10363642
1091 Ga0265325_10001316
1092 Ga0265340_10000709
1093 Ga0265331_10007406
1094 Ga0265327_10068212
1095 Ga0307513_10012601
1096 Ga0307408_100008359
1097 Ga0307408_100022439
1098 Ga0307408_100262485
1099 Ga0307408_100332240
1100 Ga0265313_10002468
1101 Ga0265314_10041343
1102 Ga0307405_10004407
1103 Ga0307405_10020750
1104 Ga0307405_10021065
1105 Ga0307405_10096381
1106 Ga0307405_10221360
1107 Ga0307405_10229156
1108 Ga0307413_10055334
1109 Ga0307413_10075825
1110 Ga0307413_10077543
1111 Ga0307413_10286197
1112 Ga0307410_10019585
1113 Ga0307410_10023984
1114 Ga0307410_10070371
1115 Ga0307410_10189094
1116 Ga0307410_10209404
1117 Ga0307406_10001282
1118 Ga0307406_10001622
1119 Ga0307406_10009071
1120 Ga0307406_10061752
1121 Ga0307406_10122599
1122 Ga0307406_10166722
1123 Ga0307406_10239790
1124 Ga0307407_10006166
1125 Ga0307407_10018990
1126 Ga0307407_10025948
1127 Ga0307407_10064587
1128 Ga0307407_10205164
1129 Ga0307412_10014948
1130 Ga0307412_10016821
1131 Ga0307412_10236020
1132 Ga0307409_100003923
1133 Ga0307409_100012465
1134 Ga0307409_100020367
1135 Ga0307409_100063974
1136 Ga0307409_100226123
1137 Ga0307409_100230611
1138 Ga0307416_100015729
1139 Ga0307416_100065237
1140 Ga0307416_100073515
1141 Ga0307416_100082345
1142 Ga0307416_100182229
1143 Ga0307416_100474499
1144 Ga0307414_10001934
1145 Ga0307414_10199512
1146 Ga0307414_10340469
1147 Ga0307414_10431795
1148 Ga0307411_10023008
1149 Ga0307411_10031419
1150 Ga0307411_10090921
1151 Ga0307411_10384054
1152 Ga0307415_100000285
1153 Ga0307415_100006915
1154 Ga0307415_100008202
1155 Ga0307415_100035784
1156 Ga0307415_100069845
1157 Ga0307415_100075723
1158 Ga0307415_100078027
1159 Ga0307415_100099158
1160 Ga0307415_100122999
1161 Ga0373942_0005763
1162 Ga0395900_0157287
1163 Ga0395898_0122852
1164 Ga0395905_0012079
1165 Ga0436365_0919346
1166 Ga0436365_1507749
1167 Ga0436363_0567417
1168 Ga0439448_0002497
1169 Ga0439463_000494
1170 Ga0450888_002104
1171 Ga0450900_000045
1172 Ga0439444_0000494
1173 Ga0439459_0023222
1174 Ga0439464_0017820
1175 Ga0439464_0021738
1176 Ga0439460_0000465
1177 Ga0439460_0039242
1178 Ga0439440_0000219
1179 Ga0466966_0085120
1180 Ga0466963_0089181
1181 Ga0466970_0074987
1182 Ga0466959_0062728
1183 Ga0466958_0085605
1184 Ga0495663_0000334
1185 Ga0495621_0000025
1186 Ga0495668_0111650
1187 Ga0495636_0028590
1188 Ga0496104_0295684
1189 Ga0496106_0056965
1190 Ga0496108_0160431
1191 Ga0496112_0181198
1192 Ga0501291_003289
1193 Ga0501291_003885
1194 Ga0501292_003193
1195 Ga0501296_000227
1196 Ga0501296_005022
1197 Ga0501298_000130
1198 Ga0501299_000263
1199 Ga0501031_0001034
1200 Ga0501031_0012339
1201 Ga0501031_0034956
1202 Ga0501031_0083925
1203 Ga0501032_0103508
1204 Ga0501033_0011772
1205 Ga0501033_0028529
1206 Ga0501034_0087936
1207 Ga0501034_0395751
1208 Ga0501036_0001554
1209 Ga0501036_0035732
1210 Ga0501036_0063108
1211 Ga0501036_0067321
1212 Ga0501036_0214806
1213 Ga0501036_0275786
1214 Ga0501037_0007723
1215 Ga0501037_0008645
1216 Ga0501037_0037838
1217 Ga0501038_0001526
1218 Ga0501038_0001703
1219 Ga0501038_0098946
1220 Ga0501038_0113258
1221 Ga0501039_0000609
1222 Ga0501039_0001558
1223 Ga0501039_0068531
1224 Ga0501040_0000855
1225 Ga0501040_0005416
1226 Ga0501040_0037493
1227 Ga0501040_0057096
1228 Ga0501041_0002766
1229 Ga0501041_0005724
1230 Ga0501041_0007445
1231 Ga0501041_0071283
1232 Ga0501042_0000767
1233 Ga0501042_0008164
1234 Ga0501043_0044204
1235 Ga0501043_0114958
1236 Ga0501043_0165787
1237 Ga0501046_0005270
1238 Ga0501046_0005589
1239 Ga0501046_0019854
1240 Ga0501046_0121876
1241 Ga0501047_0096776
1242 Ga0501048_0000132
1243 Ga0501048_0005232
1244 Ga0501048_0021229
1245 Ga0501048_0033426
1246 Ga0501068_0008798
1247 Ga0501068_0013422
1248 Ga0501068_0016121
1249 Ga0501068_0062491
1250 Ga0501069_0007016
1251 Ga0501070_0008580
1252 Ga0501070_0112371
1253 Ga0501071_0000791
1254 Ga0501071_0027836
1255 Ga0501071_0136464
1256 Ga0501072_0004053
1257 Ga0501072_0012186
1258 Ga0501072_0050849
1259 Ga0501072_0080455
1260 Ga0501073_0007434
1261 Ga0501074_0001254
1262 Ga0501075_0000069
1263 Ga0501075_0001188
1264 Ga0501075_0014481
1265 Ga0501075_0050302
1266 Ga0501075_0091393
1267 Ga0501076_0000218
1268 Ga0501076_0018405
1269 Ga0501076_0042859
1270 Ga0501077_0001711
1271 Ga0501077_0014796
1272 Ga0501077_0016485
1273 Ga0501077_0053767
1274 Ga0501077_0089099
1275 Ga0501198_000735
1276 Ga0501198_002044
1277 Ga0501202_000706
1278 Ga0501206_005711
1279 Ga0501217_000434
1280 Ga0501217_000858
1281 Ga0501217_002391
1282 Ga0501217_011295
1283 Ga0501223_010710
1284 Ga0501224_003366
1285 Ga0501224_004603
1286 Ga0501227_008067
1287 Ga0501233_002950
1288 Ga0501233_007207
1289 Ga0501235_007284
1290 Ga0501235_013046
1291 Ga0501249_007021
1292 Ga0501257_010754
1293 Ga0501260_003354
1294 Ga0501261_000814
1295 Ga0501221_002707
1296 Ga0501225_0001642
1297 Ga0501225_0009650
1298 Ga0501225_0010310
1299 Ga0501229_009441
1300 Ga0501234_000377
1301 Ga0501079_0000429
1302 Ga0501079_0001265
1303 Ga0501079_0020992
1304 Ga0501079_0023401
1305 Ga0501080_0020650
1306 Ga0501081_0002589
1307 Ga0501081_0004612
1308 Ga0501081_0029208
1309 Ga0501081_0108054
1310 Ga0501083_0065131
1311 Ga0501083_0073715
1312 Ga0501083_0083246
1313 Ga0501268_003937
1314 Ga0501273_001964
1315 Ga0501279_006209
1316 Ga0501283_000480
1317 Ga0501035_0005520
1318 Ga0501035_0035901
1319 Ga0501035_0127598
1320 Ga0501044_0011482
1321 Ga0501045_0001302
1322 Ga0501045_0001782
1323 Ga0501045_0007136
1324 Ga0501045_0018529
1325 Ga0501045_0043747
1326 Ga0501212_003257
1327 Ga0501226_005600
1328 nmdc:mga05p37_115263_c1
1329 nmdc:mga05p37_183956_c1
1330 nmdc:mga05p37_33255_c2
1331 nmdc:mga05p37_51793_c1
1332 nmdc:mga05p37_96167_c1
1333 nmdc:mga09592_109473_c1
1334 nmdc:mga09592_146634_c1
1335 nmdc:mga09592_4051_c1
1336 nmdc:mga09592_72204_c1
1337 nmdc:mga0qj67_1648_c1
1338 nmdc:mga0qj67_3059_c1
1339 nmdc:mga0qj67_76628_c1
1340 nmdc:mga06r32_166710_c1
1341 nmdc:mga06r32_19281_c1
1342 nmdc:mga06r32_28153_c1
1343 nmdc:mga06r32_9916_c1
1344 nmdc:mga08y16_135556_c1
1345 nmdc:mga08y16_19954_c1
1346 nmdc:mga08y16_291980_c1
1347 nmdc:mga08y16_63911_c1
1348 nmdc:mga0n895_82008_c1
1349 nmdc:mga0rr50_255_c1
1350 nmdc:mga08x19_26_c1
1351 nmdc:mga0a205_145985_c1
1352 nmdc:mga0a205_92248_c1
1353 Ga0501084_0000597
1354 Ga0501084_0002383
1355 Ga0501084_0041977
1356 Ga0501084_0052814
1357 Ga0590074_006975
1358 Ga0501082_0001027
1359 Ga0501082_0003746
1360 Ga0501082_0012767
1361 Ga0501082_0048752
1362 Ga0501082_0083003
1363 Ga0466962_0100086
1364 Ga0530510_0000273
1365 Ga0530510_0001188
1366 Ga0530510_0014660
1367 Ga0530510_0036302
1368 Ga0530510_0044137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ydz-assembly1.cif.gz_A structure of endo-lysosomal trpml1 channel inserting into amphipol: state 1 0.5117 146 276
6uw6-assembly1.cif.gz_A cryo-em structure of the human trpv3 k169a mutant determined in lipid nanodisc 0.5032 107 309
2v5d-assembly1.cif.gz_A structure of a family 84 glycoside hydrolase and a family 32 carbohydrate-binding module in tandem from clostridium perfringens. 0.4887 166 274
2wb5-assembly1.cif.gz_A glcnacstatins are nanomolar inhibitors of human o-glcnacase inducing cellular hyper-o-glcnacylation 0.4857 167 274
2j62-assembly1.cif.gz_A structure of a bacterial o-glcnacase in complex with glcnacstatin 0.485 166 273
ID Description Score Start End Superfamily
af_O33268_1_267_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5625 45 269 1.20.950.20
4zxlA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Hyaluronidase post-catalytic domain-like 0.4892 166 272 1.20.58.460
af_Q6RKB0_810_937_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4862 117 260 1.20.120.350
af_O33268_1_267_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.481 45 269 1.20.950.20
af_C3JXE0_33_145_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4645 169 279 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A349BBV6-F1-model_v4 MFS transporter 0.9612 17 336 GO:0016020
AF-A0A521UIT2-F1-model_v4 MFS transporter 0.9576 9 336 GO:0016020
AF-A0A2E0ZGJ1-F1-model_v4 MFS transporter 0.9574 17 279 GO:0016020
AF-A0A7C3NPV2-F1-model_v4 MFS transporter 0.9501 1 339 GO:0016020
AF-A0A2V8MAY5-F1-model_v4 MFS transporter 0.9488 3 256 GO:0016020

Map