F474919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 682 | 366 | 567 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300035398|Ga0316574_0148979|Ga0316574_0148979_183_878 |
| Length | 231 |
| Sequence | MAEPLSGGPAIFGAALFLQRFHPYVLSGNSFHYEHRSLIMAHVLPPLPFAKDALEPVISAETIDYHYGKHHQAYVTNLNNLVPGTEFENATLEEIVMRSSGGIFNNAAQVWNHTFYWNGLSPDGGGQPGGALGAAIDKAFGSLDAFKEAFVKSAVGNFGSGWTWLVKNADGSVEIVNTSNAATPLRDGKTPLLTIDVWEHAYYIDYRNARPKYLEEIWKLVNWDFVSSNYG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 8 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 9 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 10 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 11 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 12 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 13 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 14 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 15 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 16 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 17 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 18 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 19 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 20 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 21 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 22 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 23 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 24 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 25 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 26 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 27 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 28 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 29 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 30 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 31 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 32 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 33 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 34 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 35 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 36 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 37 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 38 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 39 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 40 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 41 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 42 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 43 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 44 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 45 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 46 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 47 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 48 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 49 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 50 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 51 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 52 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 53 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 54 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 55 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 56 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 57 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 58 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 59 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 60 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 61 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 62 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 63 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 64 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 65 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 66 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 67 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 68 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 69 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 70 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 71 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 72 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 73 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 74 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 75 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 76 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 77 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 78 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 79 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 80 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 81 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 82 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 83 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 84 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 85 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 86 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 87 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 88 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 89 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 90 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 91 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 92 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 93 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 94 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 95 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 96 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 97 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 98 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 99 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 100 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 101 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 102 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 103 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 104 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 105 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 106 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 107 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 108 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 109 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 110 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 111 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 112 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 117 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 129 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 131 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 132 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 134 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 135 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 136 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 137 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 138 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 139 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 140 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 141 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 142 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 143 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 144 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 145 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 146 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 147 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 148 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 149 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 150 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 151 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 158 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 159 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 160 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 161 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 168 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 178 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 187 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 190 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 234 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 236 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 237 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 238 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 241 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 242 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 243 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 244 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 247 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 248 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 249 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 250 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 255 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 256 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 257 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 272 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 273 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 274 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 275 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 276 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 277 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 278 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 279 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 280 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 281 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 285 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 286 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 287 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 288 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 289 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 312 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 313 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 329 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 338 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 340 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 341 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 344 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 346 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 347 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 353 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 355 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 356 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 357 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 358 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 359 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 360 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 361 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 362 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 363 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 364 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 365 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 366 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.61 |
| Metatranscriptomes | 9.53 |
| Isolates | 16.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.02 |
| Nodule | 1.47 |
| Rhizoplane | 3.23 |
| Rhizosphere | 51.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10051584 | 3300001979 | Bacteria | 1176 |
| 2 | JGI24739J22299_10013502 | 3300001989 | Bacteria | 2982 |
| 3 | JGI25158J39367_1011357 | 3300002739 | Bacteria | 1190 |
| 4 | JGI25152J39213_1012314 | 3300002773 | Bacteria | 1844 |
| 5 | JGI25159J45721_1001861 | 3300002987 | Bacteria | 8437 |
| 6 | JGI25159J45721_1003820 | 3300002987 | Bacteria | 5184 |
| 7 | JGI25159J45721_1004718 | 3300002987 | Bacteria | 4434 |
| 8 | JGI25159J45721_1005899 | 3300002987 | Bacteria | 3766 |
| 9 | JGI25151J46595_10013500 | 3300003187 | Bacteria | 3673 |
| 10 | JGI25151J46595_10020267 | 3300003187 | Bacteria | 2806 |
| 11 | JGI25151J46595_10029288 | 3300003187 | Bacteria | 2182 |
| 12 | JGI25160J50197_1000646 | 3300003354 | Bacteria | 19384 |
| 13 | JGI25160J50197_1000712 | 3300003354 | Bacteria | 18321 |
| 14 | JGI25161J50226_1000018 | 3300003374 | Bacteria | 172599 |
| 15 | JGI25161J50226_1002851 | 3300003374 | Bacteria | 4223 |
| 16 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 17 | Ga0055527_1005489 | 3300003760 | Bacteria | 1646 |
| 18 | Ga0055526_1010564 | 3300003771 | Bacteria | 4276 |
| 19 | Ga0055537_1001685 | 3300003773 | Bacteria | 8186 |
| 20 | Ga0055537_1010093 | 3300003773 | Bacteria | 2019 |
| 21 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 22 | Ga0055536_1005421 | 3300003781 | Bacteria | 6243 |
| 23 | Ga0055534_1003317 | 3300003784 | Bacteria | 5100 |
| 24 | Ga0055534_1004663 | 3300003784 | Bacteria | 3889 |
| 25 | Ga0055528_1000925 | 3300003790 | Bacteria | 19615 |
| 26 | Ga0055528_1006458 | 3300003790 | Bacteria | 5318 |
| 27 | Ga0055530_10002096 | 3300003791 | Bacteria | 13321 |
| 28 | Ga0055530_10002329 | 3300003791 | Bacteria | 12409 |
| 29 | Ga0055530_10047761 | 3300003791 | Bacteria | 1010 |
| 30 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 31 | Ga0055540_1027959 | 3300003792 | Bacteria | 1340 |
| 32 | Ga0055531_10000345 | 3300003794 | Bacteria | 45594 |
| 33 | Ga0055531_10004467 | 3300003794 | Bacteria | 8510 |
| 34 | Ga0055531_10039699 | 3300003794 | Bacteria | 1393 |
| 35 | Ga0055543_1001471 | 3300004625 | Bacteria | 9301 |
| 36 | Ga0055543_1002402 | 3300004625 | Bacteria | 6223 |
| 37 | Ga0065165_1029136 | 3300005262 | Bacteria | 1773 |
| 38 | Ga0065165_1100907 | 3300005262 | Bacteria | 722 |
| 39 | Ga0065704_10029721 | 3300005289 | Bacteria | 1509 |
| 40 | Ga0070658_10020320 | 3300005327 | Bacteria | 5322 |
| 41 | Ga0070658_10619094 | 3300005327 | Bacteria | 939 |
| 42 | Ga0070676_10264626 | 3300005328 | Bacteria | 1153 |
| 43 | Ga0070683_100005699 | 3300005329 | Bacteria | 10405 |
| 44 | Ga0070683_100162463 | 3300005329 | Bacteria | 2119 |
| 45 | Ga0070666_10267897 | 3300005335 | Bacteria | 1212 |
| 46 | Ga0070666_10420055 | 3300005335 | Bacteria | 963 |
| 47 | Ga0068868_100001942 | 3300005338 | Bacteria | 14183 |
| 48 | Ga0070660_100075942 | 3300005339 | Bacteria | 2631 |
| 49 | Ga0070660_100279113 | 3300005339 | Bacteria | 1367 |
| 50 | Ga0070661_100277424 | 3300005344 | Bacteria | 1299 |
| 51 | Ga0070669_100028621 | 3300005353 | Bacteria | 4013 |
| 52 | Ga0070669_100102338 | 3300005353 | Bacteria | 2163 |
| 53 | Ga0070675_100002690 | 3300005354 | Bacteria | 13361 |
| 54 | Ga0070671_100305335 | 3300005355 | Bacteria | 1355 |
| 55 | Ga0070674_100324362 | 3300005356 | Bacteria | 1236 |
| 56 | Ga0070673_101389581 | 3300005364 | Bacteria | 661 |
| 57 | Ga0070659_100078641 | 3300005366 | Bacteria | 2631 |
| 58 | Ga0070659_100352569 | 3300005366 | Bacteria | 1235 |
| 59 | Ga0070667_100240676 | 3300005367 | Bacteria | 1616 |
| 60 | Ga0070667_100291034 | 3300005367 | Bacteria | 1469 |
| 61 | Ga0070663_100459781 | 3300005455 | Bacteria | 1050 |
| 62 | Ga0070662_100026589 | 3300005457 | Bacteria | 4009 |
| 63 | Ga0070662_100094386 | 3300005457 | Bacteria | 2252 |
| 64 | Ga0068867_100011231 | 3300005459 | Bacteria | 6317 |
| 65 | Ga0070685_10828367 | 3300005466 | Bacteria | 684 |
| 66 | Ga0070684_100032261 | 3300005535 | Bacteria | 4463 |
| 67 | Ga0070684_100304994 | 3300005535 | Bacteria | 1461 |
| 68 | Ga0068853_100055551 | 3300005539 | Bacteria | 3413 |
| 69 | Ga0068853_100189388 | 3300005539 | Bacteria | 1868 |
| 70 | Ga0070693_100087266 | 3300005547 | Bacteria | 1873 |
| 71 | Ga0070693_100097492 | 3300005547 | Bacteria | 1784 |
| 72 | Ga0068855_100023604 | 3300005563 | Bacteria | 7366 |
| 73 | Ga0068857_100127738 | 3300005577 | Bacteria | 2291 |
| 74 | Ga0068857_100520899 | 3300005577 | Bacteria | 1117 |
| 75 | Ga0068854_100016635 | 3300005578 | Bacteria | 4907 |
| 76 | Ga0068856_100063174 | 3300005614 | Bacteria | 3658 |
| 77 | Ga0068856_100277837 | 3300005614 | Bacteria | 1691 |
| 78 | Ga0068852_100032373 | 3300005616 | Bacteria | 4329 |
| 79 | Ga0068852_100217522 | 3300005616 | Bacteria | 1815 |
| 80 | Ga0068859_100217651 | 3300005617 | Bacteria | 1997 |
| 81 | Ga0068864_100009238 | 3300005618 | Bacteria | 8129 |
| 82 | Ga0068861_100005119 | 3300005719 | Bacteria | 8841 |
| 83 | Ga0068851_10059805 | 3300005834 | Bacteria | 1949 |
| 84 | Ga0068851_10104123 | 3300005834 | Bacteria | 1508 |
| 85 | Ga0068858_100387511 | 3300005842 | Bacteria | 1341 |
| 86 | Ga0068860_100008648 | 3300005843 | Bacteria | 10144 |
| 87 | Ga0075365_10094215 | 3300006038 | Bacteria | 2043 |
| 88 | Ga0075368_10024245 | 3300006042 | Bacteria | 2323 |
| 89 | Ga0075363_100239812 | 3300006048 | Bacteria | 1042 |
| 90 | Ga0075364_10006278 | 3300006051 | Bacteria | 6974 |
| 91 | Ga0075364_10112903 | 3300006051 | Bacteria | 1814 |
| 92 | Ga0075366_10016348 | 3300006195 | Bacteria | 4264 |
| 93 | Ga0075366_10094424 | 3300006195 | Bacteria | 1793 |
| 94 | Ga0075370_10367685 | 3300006353 | Bacteria | 860 |
| 95 | Ga0068871_100087560 | 3300006358 | Bacteria | 2590 |
| 96 | Ga0097620_100217652 | 3300006931 | Bacteria | 1997 |
| 97 | Ga0105240_10000096 | 3300009093 | Bacteria | 179543 |
| 98 | Ga0105240_10556401 | 3300009093 | Bacteria | 1268 |
| 99 | Ga0105245_10036044 | 3300009098 | Bacteria | 4392 |
| 100 | Ga0105248_10027182 | 3300009177 | Bacteria | 6364 |
| 101 | Ga0105238_10060978 | 3300009551 | Bacteria | 3775 |
| 102 | Ga0105238_10185754 | 3300009551 | Bacteria | 2055 |
| 103 | Ga0105239_10275951 | 3300010375 | Bacteria | 1891 |
| 104 | Ga0157346_1006907 | 3300012480 | Bacteria | 745 |
| 105 | Ga0157319_1006742 | 3300012497 | Bacteria | 833 |
| 106 | Ga0157347_1001688 | 3300012502 | Bacteria | 1781 |
| 107 | Ga0157324_1001788 | 3300012506 | Bacteria | 1236 |
| 108 | Ga0157326_1006688 | 3300012513 | Bacteria | 1235 |
| 109 | Ga0157369_10018014 | 3300013105 | Bacteria | 7924 |
| 110 | Ga0157374_10445067 | 3300013296 | Bacteria | 1296 |
| 111 | Ga0163162_10030471 | 3300013306 | Bacteria | 5345 |
| 112 | Ga0157372_10046609 | 3300013307 | Bacteria | 4812 |
| 113 | Ga0157372_10056547 | 3300013307 | Bacteria | 4383 |
| 114 | Ga0157375_11138664 | 3300013308 | Bacteria | 914 |
| 115 | Ga0182008_10000664 | 3300014497 | Bacteria | 24934 |
| 116 | Ga0157377_10005357 | 3300014745 | Bacteria | 6022 |
| 117 | Ga0157376_10004653 | 3300014969 | Bacteria | 9562 |
| 118 | Ga0182006_1063082 | 3300015261 | Bacteria | 1393 |
| 119 | Ga0182007_10000468 | 3300015262 | Bacteria | 24418 |
| 120 | Ga0182005_1098250 | 3300015265 | Bacteria | 819 |
| 121 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 122 | Ga0163161_10000142 | 3300017792 | Bacteria | 66331 |
| 123 | Ga0163161_10000568 | 3300017792 | Bacteria | 29734 |
| 124 | Ga0206351_10428386 | 3300020077 | Bacteria | 957 |
| 125 | Ga0154015_1240110 | 3300020610 | Bacteria | 799 |
| 126 | Ga0213872_10000160 | 3300021361 | Bacteria | 61551 |
| 127 | Ga0213872_10000683 | 3300021361 | Bacteria | 25720 |
| 128 | Ga0213872_10011112 | 3300021361 | Bacteria | 4266 |
| 129 | Ga0209672_100354 | 3300025228 | Bacteria | 29117 |
| 130 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 131 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 132 | Ga0207425_1000514 | 3300025245 | Bacteria | 23629 |
| 133 | Ga0207425_1002389 | 3300025245 | Bacteria | 6644 |
| 134 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 135 | Ga0209129_1000049 | 3300025258 | Bacteria | 268086 |
| 136 | Ga0209129_1001139 | 3300025258 | Bacteria | 15365 |
| 137 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 138 | Ga0209565_1000108 | 3300025263 | Bacteria | 120719 |
| 139 | Ga0209565_1000187 | 3300025263 | Bacteria | 76001 |
| 140 | Ga0209565_1000892 | 3300025263 | Bacteria | 16282 |
| 141 | Ga0209673_1000074 | 3300025273 | Bacteria | 233552 |
| 142 | Ga0209673_1000389 | 3300025273 | Bacteria | 79243 |
| 143 | Ga0209673_1000477 | 3300025273 | Bacteria | 66849 |
| 144 | Ga0209673_1000817 | 3300025273 | Bacteria | 41131 |
| 145 | Ga0209130_1000050 | 3300025284 | Bacteria | 222092 |
| 146 | Ga0209130_1000069 | 3300025284 | Bacteria | 179177 |
| 147 | Ga0209130_1000267 | 3300025284 | Bacteria | 65435 |
| 148 | Ga0209130_1000828 | 3300025284 | Bacteria | 26047 |
| 149 | Ga0209130_1001005 | 3300025284 | Bacteria | 21918 |
| 150 | Ga0209130_1001070 | 3300025284 | Bacteria | 20605 |
| 151 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 152 | Ga0209675_1000232 | 3300025291 | Bacteria | 56301 |
| 153 | Ga0209675_1000398 | 3300025291 | Bacteria | 36047 |
| 154 | Ga0209675_1001699 | 3300025291 | Bacteria | 12181 |
| 155 | Ga0209675_1002669 | 3300025291 | Bacteria | 8997 |
| 156 | Ga0209675_1003839 | 3300025291 | Bacteria | 6929 |
| 157 | Ga0209675_1003844 | 3300025291 | Bacteria | 6927 |
| 158 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 159 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 160 | Ga0209676_1000137 | 3300025292 | Bacteria | 179437 |
| 161 | Ga0209676_1000139 | 3300025292 | Bacteria | 177886 |
| 162 | Ga0209676_1000416 | 3300025292 | Bacteria | 76249 |
| 163 | Ga0209676_1001530 | 3300025292 | Bacteria | 21006 |
| 164 | Ga0209676_1007648 | 3300025292 | Bacteria | 5012 |
| 165 | Ga0209676_1009127 | 3300025292 | Bacteria | 4319 |
| 166 | Ga0209025_1000313 | 3300025294 | Bacteria | 107850 |
| 167 | Ga0209025_1000316 | 3300025294 | Bacteria | 107447 |
| 168 | Ga0209025_1000481 | 3300025294 | Bacteria | 77405 |
| 169 | Ga0209025_1005773 | 3300025294 | Bacteria | 9927 |
| 170 | Ga0209025_1019202 | 3300025294 | Bacteria | 3815 |
| 171 | Ga0209025_1024149 | 3300025294 | Bacteria | 3150 |
| 172 | Ga0209025_1030246 | 3300025294 | Bacteria | 2597 |
| 173 | Ga0209025_1047973 | 3300025294 | Bacteria | 1737 |
| 174 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 175 | Ga0209564_1000232 | 3300025295 | Bacteria | 122080 |
| 176 | Ga0209564_1000303 | 3300025295 | Bacteria | 97431 |
| 177 | Ga0209564_1001809 | 3300025295 | Bacteria | 19735 |
| 178 | Ga0209564_1019681 | 3300025295 | Bacteria | 2511 |
| 179 | Ga0209564_1023389 | 3300025295 | Bacteria | 2149 |
| 180 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 181 | Ga0209758_1000135 | 3300025297 | Bacteria | 177753 |
| 182 | Ga0209758_1003942 | 3300025297 | Bacteria | 12892 |
| 183 | Ga0209758_1009084 | 3300025297 | Bacteria | 6271 |
| 184 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 185 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 186 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 187 | Ga0209050_1015570 | 3300025298 | Bacteria | 3181 |
| 188 | Ga0209050_1019571 | 3300025298 | Bacteria | 2564 |
| 189 | Ga0209050_1047094 | 3300025298 | Bacteria | 1126 |
| 190 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 191 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 192 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 193 | Ga0209256_1000129 | 3300025299 | Bacteria | 163766 |
| 194 | Ga0209256_1000224 | 3300025299 | Bacteria | 104436 |
| 195 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 196 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 197 | Ga0207426_1000071 | 3300025302 | Bacteria | 329539 |
| 198 | Ga0207426_1000171 | 3300025302 | Bacteria | 163766 |
| 199 | Ga0207426_1000185 | 3300025302 | Bacteria | 154146 |
| 200 | Ga0207426_1003300 | 3300025302 | Bacteria | 8974 |
| 201 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 202 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 203 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 204 | Ga0209051_1001299 | 3300025303 | Bacteria | 21972 |
| 205 | Ga0209051_1005858 | 3300025303 | Bacteria | 7068 |
| 206 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 207 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 208 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 209 | Ga0209257_1000643 | 3300025304 | Bacteria | 55819 |
| 210 | Ga0209257_1003639 | 3300025304 | Bacteria | 12958 |
| 211 | Ga0209257_1004427 | 3300025304 | Bacteria | 10890 |
| 212 | Ga0209257_1007677 | 3300025304 | Bacteria | 6445 |
| 213 | Ga0209257_1014348 | 3300025304 | Bacteria | 3408 |
| 214 | Ga0209257_1022304 | 3300025304 | Bacteria | 2263 |
| 215 | Ga0207656_10121016 | 3300025321 | Bacteria | 1218 |
| 216 | Ga0207643_10130029 | 3300025908 | Bacteria | 1498 |
| 217 | Ga0207705_10511277 | 3300025909 | Bacteria | 933 |
| 218 | Ga0207695_10000836 | 3300025913 | Bacteria | 56759 |
| 219 | Ga0207695_10090050 | 3300025913 | Bacteria | 3084 |
| 220 | Ga0207695_10160682 | 3300025913 | Bacteria | 2178 |
| 221 | Ga0207657_10044124 | 3300025919 | Bacteria | 3922 |
| 222 | Ga0207657_10235712 | 3300025919 | Bacteria | 1462 |
| 223 | Ga0207681_10026743 | 3300025923 | Bacteria | 3725 |
| 224 | Ga0207681_10044904 | 3300025923 | Bacteria | 2963 |
| 225 | Ga0207694_10285023 | 3300025924 | Bacteria | 1357 |
| 226 | Ga0207659_10305258 | 3300025926 | Bacteria | 1309 |
| 227 | Ga0207687_10008809 | 3300025927 | Bacteria | 6594 |
| 228 | Ga0207690_10031077 | 3300025932 | Bacteria | 3413 |
| 229 | Ga0207690_10086483 | 3300025932 | Bacteria | 2203 |
| 230 | Ga0207706_10144826 | 3300025933 | Bacteria | 2090 |
| 231 | Ga0207706_10159295 | 3300025933 | Bacteria | 1985 |
| 232 | Ga0207686_10329325 | 3300025934 | Bacteria | 1144 |
| 233 | Ga0207709_10000195 | 3300025935 | Bacteria | 80988 |
| 234 | Ga0207709_10000308 | 3300025935 | Bacteria | 53075 |
| 235 | Ga0207709_10031504 | 3300025935 | Bacteria | 3098 |
| 236 | Ga0207709_10071319 | 3300025935 | Bacteria | 2206 |
| 237 | Ga0207691_10125601 | 3300025940 | Bacteria | 2270 |
| 238 | Ga0207691_10134708 | 3300025940 | Bacteria | 2180 |
| 239 | Ga0207691_10812940 | 3300025940 | Bacteria | 785 |
| 240 | Ga0207711_10006066 | 3300025941 | Bacteria | 10211 |
| 241 | Ga0207661_10454772 | 3300025944 | Bacteria | 1166 |
| 242 | Ga0207679_10003805 | 3300025945 | Bacteria | 9356 |
| 243 | Ga0207651_10652379 | 3300025960 | Bacteria | 924 |
| 244 | Ga0207640_10089337 | 3300025981 | Bacteria | 2129 |
| 245 | Ga0207640_10351508 | 3300025981 | Bacteria | 1184 |
| 246 | Ga0207658_10225074 | 3300025986 | Bacteria | 1580 |
| 247 | Ga0207677_10004412 | 3300026023 | Bacteria | 7546 |
| 248 | Ga0207703_10113400 | 3300026035 | Bacteria | 2317 |
| 249 | Ga0207639_10025273 | 3300026041 | Bacteria | 4306 |
| 250 | Ga0207639_10424606 | 3300026041 | Bacteria | 1202 |
| 251 | Ga0207639_10466622 | 3300026041 | Bacteria | 1149 |
| 252 | Ga0207678_10069440 | 3300026067 | Bacteria | 3021 |
| 253 | Ga0207678_10176402 | 3300026067 | Bacteria | 1825 |
| 254 | Ga0207678_10404661 | 3300026067 | Bacteria | 1182 |
| 255 | Ga0207702_10037173 | 3300026078 | Bacteria | 4074 |
| 256 | Ga0207648_10010393 | 3300026089 | Bacteria | 8823 |
| 257 | Ga0207648_10191097 | 3300026089 | Bacteria | 1814 |
| 258 | Ga0207676_10009240 | 3300026095 | Bacteria | 7014 |
| 259 | Ga0207676_10969178 | 3300026095 | Bacteria | 837 |
| 260 | Ga0207674_10075700 | 3300026116 | Bacteria | 3375 |
| 261 | Ga0207675_100001125 | 3300026118 | Bacteria | 26534 |
| 262 | Ga0207675_100953003 | 3300026118 | Bacteria | 876 |
| 263 | Ga0207683_10076632 | 3300026121 | Bacteria | 2961 |
| 264 | Ga0207683_11011854 | 3300026121 | Bacteria | 771 |
| 265 | Ga0207698_10005789 | 3300026142 | Bacteria | 7671 |
| 266 | Ga0207698_10115999 | 3300026142 | Bacteria | 2256 |
| 267 | Ga0207698_10167292 | 3300026142 | Bacteria | 1931 |
| 268 | Ga0207698_10309110 | 3300026142 | Bacteria | 1475 |
| 269 | Ga0209996_1003350 | 3300027395 | Bacteria | 2013 |
| 270 | Ga0209982_1020102 | 3300027552 | Bacteria | 1025 |
| 271 | Ga0209970_1015411 | 3300027614 | Bacteria | 1272 |
| 272 | Ga0209983_1001258 | 3300027665 | Bacteria | 5634 |
| 273 | Ga0209971_1001741 | 3300027682 | Bacteria | 5339 |
| 274 | Ga0265319_1007769 | 3300028563 | Bacteria | 4778 |
| 275 | Ga0265318_10075050 | 3300028577 | Bacteria | 1251 |
| 276 | Ga0265322_10118519 | 3300028654 | Bacteria | 754 |
| 277 | Ga0265336_10010251 | 3300028666 | Bacteria | 3213 |
| 278 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 279 | Ga0307515_10000484 | 3300028794 | Bacteria | 94947 |
| 280 | Ga0307515_10000645 | 3300028794 | Bacteria | 80548 |
| 281 | Ga0307515_10224088 | 3300028794 | Bacteria | 1690 |
| 282 | Ga0307512_10216274 | 3300030522 | Bacteria | 1009 |
| 283 | Ga0265330_10064418 | 3300031235 | Bacteria | 1592 |
| 284 | Ga0265331_10042383 | 3300031250 | Bacteria | 2208 |
| 285 | Ga0265327_10001152 | 3300031251 | Bacteria | 36013 |
| 286 | Ga0265327_10006337 | 3300031251 | Bacteria | 9495 |
| 287 | Ga0265327_10012819 | 3300031251 | Bacteria | 5621 |
| 288 | Ga0307513_10000014 | 3300031456 | Bacteria | 303157 |
| 289 | Ga0307513_10005720 | 3300031456 | Bacteria | 16360 |
| 290 | Ga0307513_10016922 | 3300031456 | Bacteria | 8765 |
| 291 | Ga0307514_10000645 | 3300031649 | Bacteria | 63434 |
| 292 | Ga0316575_10075151 | 3300031665 | Bacteria | 1360 |
| 293 | Ga0316575_10126717 | 3300031665 | Bacteria | 1046 |
| 294 | Ga0316579_10002240 | 3300031691 | Bacteria | 7292 |
| 295 | Ga0316579_10003273 | 3300031691 | Bacteria | 6288 |
| 296 | Ga0316579_10010519 | 3300031691 | Bacteria | 3914 |
| 297 | Ga0316579_10201963 | 3300031691 | Bacteria | 961 |
| 298 | Ga0265314_10077616 | 3300031711 | Bacteria | 2202 |
| 299 | Ga0265314_10104775 | 3300031711 | Bacteria | 1810 |
| 300 | Ga0265342_10081430 | 3300031712 | Bacteria | 1869 |
| 301 | Ga0316576_10003570 | 3300031727 | Bacteria | 9160 |
| 302 | Ga0316576_10055018 | 3300031727 | Bacteria | 2903 |
| 303 | Ga0316576_10066156 | 3300031727 | Bacteria | 2657 |
| 304 | Ga0316576_10133575 | 3300031727 | Bacteria | 1867 |
| 305 | Ga0316576_10335475 | 3300031727 | Bacteria | 1126 |
| 306 | Ga0316578_10003048 | 3300031728 | Bacteria | 7556 |
| 307 | Ga0316578_10015033 | 3300031728 | Bacteria | 4152 |
| 308 | Ga0316578_10098879 | 3300031728 | Bacteria | 1748 |
| 309 | Ga0316578_10109545 | 3300031728 | Bacteria | 1658 |
| 310 | Ga0316578_10140245 | 3300031728 | Bacteria | 1456 |
| 311 | Ga0316578_10175690 | 3300031728 | Bacteria | 1291 |
| 312 | Ga0307516_10019943 | 3300031730 | Bacteria | 6931 |
| 313 | Ga0307516_10422900 | 3300031730 | Bacteria | 990 |
| 314 | Ga0316577_10015044 | 3300031733 | Bacteria | 4253 |
| 315 | Ga0316577_10073228 | 3300031733 | Bacteria | 1913 |
| 316 | Ga0307412_10002987 | 3300031911 | Bacteria | 9370 |
| 317 | Ga0307412_10037397 | 3300031911 | Bacteria | 3118 |
| 318 | Ga0307416_100019773 | 3300032002 | Bacteria | 4784 |
| 319 | Ga0307411_10056745 | 3300032005 | Bacteria | 2583 |
| 320 | Ga0307411_10131898 | 3300032005 | Bacteria | 1827 |
| 321 | Ga0316583_10130134 | 3300032133 | Bacteria | 877 |
| 322 | Ga0316585_10126701 | 3300032137 | Bacteria | 841 |
| 323 | Ga0316580_10002554 | 3300032139 | Bacteria | 5033 |
| 324 | Ga0316593_10002364 | 3300032168 | Bacteria | 4442 |
| 325 | Ga0316593_10003182 | 3300032168 | Bacteria | 4032 |
| 326 | Ga0316593_10011615 | 3300032168 | Bacteria | 2564 |
| 327 | Ga0316593_10016894 | 3300032168 | Bacteria | 2219 |
| 328 | Ga0316593_10027098 | 3300032168 | Bacteria | 1836 |
| 329 | Ga0316593_10035974 | 3300032168 | Bacteria | 1631 |
| 330 | Ga0316593_10040301 | 3300032168 | Bacteria | 1552 |
| 331 | Ga0316593_10048579 | 3300032168 | Bacteria | 1428 |
| 332 | Ga0316593_10056501 | 3300032168 | Bacteria | 1335 |
| 333 | Ga0316593_10096907 | 3300032168 | Bacteria | 1043 |
| 334 | Ga0316593_10136487 | 3300032168 | Bacteria | 887 |
| 335 | Ga0316593_10138418 | 3300032168 | Bacteria | 881 |
| 336 | Ga0316593_10168261 | 3300032168 | Bacteria | 803 |
| 337 | Ga0316592_1005765 | 3300033524 | Bacteria | 2363 |
| 338 | Ga0316592_1005989 | 3300033524 | Bacteria | 2329 |
| 339 | Ga0316592_1006524 | 3300033524 | Bacteria | 2250 |
| 340 | Ga0316592_1014320 | 3300033524 | Bacteria | 1644 |
| 341 | Ga0316592_1015497 | 3300033524 | Bacteria | 1588 |
| 342 | Ga0316592_1025700 | 3300033524 | Bacteria | 1270 |
| 343 | Ga0316592_1032448 | 3300033524 | Bacteria | 1139 |
| 344 | Ga0316592_1046083 | 3300033524 | Bacteria | 971 |
| 345 | Ga0316592_1056442 | 3300033524 | Bacteria | 879 |
| 346 | Ga0316592_1060559 | 3300033524 | Bacteria | 850 |
| 347 | Ga0316592_1091733 | 3300033524 | Bacteria | 695 |
| 348 | Ga0316592_1105740 | 3300033524 | Bacteria | 649 |
| 349 | Ga0316586_1005274 | 3300033527 | Bacteria | 1808 |
| 350 | Ga0316586_1019998 | 3300033527 | Bacteria | 1097 |
| 351 | Ga0316586_1022006 | 3300033527 | Bacteria | 1057 |
| 352 | Ga0316586_1033660 | 3300033527 | Bacteria | 884 |
| 353 | Ga0316586_1038300 | 3300033527 | Bacteria | 837 |
| 354 | Ga0316586_1043942 | 3300033527 | Bacteria | 791 |
| 355 | Ga0316586_1051524 | 3300033527 | Bacteria | 737 |
| 356 | Ga0316586_1055756 | 3300033527 | Bacteria | 712 |
| 357 | Ga0316586_1062903 | 3300033527 | Bacteria | 676 |
| 358 | Ga0316586_1075341 | 3300033527 | Bacteria | 625 |
| 359 | Ga0316588_1037005 | 3300033528 | Bacteria | 1160 |
| 360 | Ga0316588_1048864 | 3300033528 | Bacteria | 1024 |
| 361 | Ga0316588_1053088 | 3300033528 | Bacteria | 984 |
| 362 | Ga0316588_1065248 | 3300033528 | Bacteria | 891 |
| 363 | Ga0316588_1084001 | 3300033528 | Bacteria | 790 |
| 364 | Ga0316587_1002073 | 3300033529 | Bacteria | 2618 |
| 365 | Ga0316587_1011428 | 3300033529 | Bacteria | 1433 |
| 366 | Ga0316587_1016999 | 3300033529 | Bacteria | 1217 |
| 367 | Ga0316587_1022838 | 3300033529 | Bacteria | 1074 |
| 368 | Ga0316587_1022947 | 3300033529 | Bacteria | 1072 |
| 369 | Ga0316587_1023026 | 3300033529 | Bacteria | 1071 |
| 370 | Ga0316587_1024775 | 3300033529 | Bacteria | 1040 |
| 371 | Ga0316587_1041169 | 3300033529 | Bacteria | 835 |
| 372 | Ga0316587_1044244 | 3300033529 | Bacteria | 808 |
| 373 | Ga0316587_1077153 | 3300033529 | Bacteria | 627 |
| 374 | Ga0316596_1003281 | 3300033541 | Bacteria | 3525 |
| 375 | Ga0316596_1010810 | 3300033541 | Bacteria | 2219 |
| 376 | Ga0316596_1045748 | 3300033541 | Bacteria | 1155 |
| 377 | Ga0316596_1048987 | 3300033541 | Bacteria | 1117 |
| 378 | Ga0316596_1050494 | 3300033541 | Bacteria | 1100 |
| 379 | Ga0316596_1050677 | 3300033541 | Bacteria | 1098 |
| 380 | Ga0316596_1060385 | 3300033541 | Bacteria | 1011 |
| 381 | Ga0316596_1082098 | 3300033541 | Bacteria | 866 |
| 382 | Ga0316596_1086999 | 3300033541 | Bacteria | 841 |
| 383 | Ga0316596_1092820 | 3300033541 | Bacteria | 814 |
| 384 | Ga0316596_1103012 | 3300033541 | Bacteria | 773 |
| 385 | Ga0316596_1108539 | 3300033541 | Bacteria | 753 |
| 386 | Ga0316596_1151937 | 3300033541 | Bacteria | 636 |
| 387 | Ga0373932_0079037 | 3300035112 | Bacteria | 1035 |
| 388 | Ga0316574_0058769 | 3300035398 | Bacteria | 2409 |
| 389 | Ga0316574_0059664 | 3300035398 | Bacteria | 2393 |
| 390 | Ga0316574_0099246 | 3300035398 | Bacteria | 1863 |
| 391 | Ga0316574_0103246 | 3300035398 | Bacteria | 1825 |
| 392 | Ga0316574_0107635 | 3300035398 | Bacteria | 1786 |
| 393 | Ga0316574_0115416 | 3300035398 | Bacteria | 1722 |
| 394 | Ga0316574_0148979 | 3300035398 | Bacteria | 1508 |
| 395 | Ga0316574_0166974 | 3300035398 | Bacteria | 1417 |
| 396 | Ga0316574_0377019 | 3300035398 | Bacteria | 895 |
| 397 | Ga0373931_0006809 | 3300035691 | Bacteria | 5370 |
| 398 | Ga0373935_0036455 | 3300035692 | Bacteria | 3075 |
| 399 | Ga0316582_0012859 | 3300036647 | Bacteria | 4689 |
| 400 | Ga0316582_0078295 | 3300036647 | Bacteria | 2153 |
| 401 | Ga0316582_0122101 | 3300036647 | Bacteria | 1744 |
| 402 | Ga0316582_0147667 | 3300036647 | Bacteria | 1588 |
| 403 | Ga0316582_0170244 | 3300036647 | Bacteria | 1478 |
| 404 | Ga0316582_0273580 | 3300036647 | Bacteria | 1159 |
| 405 | Ga0316582_0485939 | 3300036647 | Bacteria | 851 |
| 406 | Ga0316582_0710343 | 3300036647 | Bacteria | 690 |
| 407 | Ga0316582_0762336 | 3300036647 | Bacteria | 664 |
| 408 | Ga0316582_0905104 | 3300036647 | Bacteria | 603 |
| 409 | Ga0316584_0026869 | 3300036712 | Bacteria | 4233 |
| 410 | Ga0316584_0027463 | 3300036712 | Bacteria | 4189 |
| 411 | Ga0316584_0031441 | 3300036712 | Bacteria | 3925 |
| 412 | Ga0316584_0089632 | 3300036712 | Bacteria | 2303 |
| 413 | Ga0316584_0100914 | 3300036712 | Bacteria | 2161 |
| 414 | Ga0395905_0098026 | 3300037471 | Bacteria | 2753 |
| 415 | Ga0395905_0423867 | 3300037471 | Bacteria | 1227 |
| 416 | Ga0395901_0028549 | 3300038443 | Bacteria | 5738 |
| 417 | Ga0395901_0124059 | 3300038443 | Bacteria | 2714 |
| 418 | Ga0395901_0221688 | 3300038443 | Bacteria | 1976 |
| 419 | Ga0400484_13308 | 3300038725 | Bacteria | 6644 |
| 420 | Ga0400484_15042 | 3300038725 | Bacteria | 13847 |
| 421 | Ga0400484_26729 | 3300038725 | Bacteria | 9808 |
| 422 | Ga0400484_39270 | 3300038725 | Bacteria | 2716 |
| 423 | Ga0400490_10105 | 3300038726 | Bacteria | 13419 |
| 424 | Ga0400490_18320 | 3300038726 | Bacteria | 13680 |
| 425 | Ga0400490_22574 | 3300038726 | Bacteria | 43180 |
| 426 | Ga0400490_37868 | 3300038726 | Bacteria | 1188 |
| 427 | Ga0400490_41189 | 3300038726 | Bacteria | 1070 |
| 428 | Ga0400490_49726 | 3300038726 | Bacteria | 10243 |
| 429 | Ga0400490_50012 | 3300038726 | Bacteria | 56375 |
| 430 | Ga0400491_17779 | 3300038727 | Bacteria | 4282 |
| 431 | Ga0400491_26672 | 3300038727 | Bacteria | 5464 |
| 432 | Ga0400485_01919 | 3300038735 | Bacteria | 1596 |
| 433 | Ga0400485_04300 | 3300038735 | Bacteria | 7739 |
| 434 | Ga0400485_05559 | 3300038735 | Bacteria | 72885 |
| 435 | Ga0400485_13786 | 3300038735 | Bacteria | 18010 |
| 436 | Ga0400488_08965 | 3300038741 | Bacteria | 1053 |
| 437 | Ga0400488_15710 | 3300038741 | Bacteria | 1916 |
| 438 | Ga0400488_16979 | 3300038741 | Bacteria | 10596 |
| 439 | Ga0400488_24313 | 3300038741 | Bacteria | 3091 |
| 440 | Ga0400488_24385 | 3300038741 | Bacteria | 1932 |
| 441 | Ga0400488_31407 | 3300038741 | Bacteria | 3976 |
| 442 | Ga0400488_56635 | 3300038741 | Bacteria | 33038 |
| 443 | Ga0400486_08934 | 3300038742 | Bacteria | 14468 |
| 444 | Ga0400486_11322 | 3300038742 | Bacteria | 2128 |
| 445 | Ga0400486_19494 | 3300038742 | Bacteria | 5079 |
| 446 | Ga0400486_22319 | 3300038742 | Bacteria | 3244 |
| 447 | Ga0400486_24992 | 3300038742 | Bacteria | 6431 |
| 448 | Ga0400486_25787 | 3300038742 | Bacteria | 5643 |
| 449 | Ga0400486_29967 | 3300038742 | Bacteria | 2870 |
| 450 | Ga0400483_019152 | 3300039062 | Bacteria | 1545 |
| 451 | Ga0400483_040321 | 3300039062 | Bacteria | 8063 |
| 452 | Ga0400483_047647 | 3300039062 | Bacteria | 12459 |
| 453 | Ga0400483_072585 | 3300039062 | Bacteria | 6311 |
| 454 | Ga0400483_079703 | 3300039062 | Bacteria | 1824 |
| 455 | Ga0400483_088976 | 3300039062 | Bacteria | 6687 |
| 456 | Ga0400483_153515 | 3300039062 | Bacteria | 9626 |
| 457 | Ga0400483_166434 | 3300039062 | Bacteria | 4729 |
| 458 | Ga0400483_168599 | 3300039062 | Bacteria | 24577 |
| 459 | Ga0400483_178382 | 3300039062 | Bacteria | 4958 |
| 460 | Ga0400483_204937 | 3300039062 | Bacteria | 1748 |
| 461 | Ga0400483_211231 | 3300039062 | Bacteria | 2487 |
| 462 | Ga0400483_216032 | 3300039062 | Bacteria | 21399 |
| 463 | Ga0400483_225160 | 3300039062 | Bacteria | 9257 |
| 464 | Ga0400489_87471 | 3300039093 | Bacteria | 26149 |
| 465 | Ga0400487_02859 | 3300039110 | Bacteria | 42897 |
| 466 | Ga0400487_09396 | 3300039110 | Bacteria | 8395 |
| 467 | Ga0400487_23547 | 3300039110 | Bacteria | 12995 |
| 468 | Ga0400487_25942 | 3300039110 | Bacteria | 30428 |
| 469 | Ga0400487_47800 | 3300039110 | Bacteria | 3812 |
| 470 | Ga0400487_59574 | 3300039110 | Bacteria | 28285 |
| 471 | Ga0436361_0126586 | 3300039447 | Bacteria | 4704 |
| 472 | Ga0436361_0144792 | 3300039447 | Bacteria | 34252 |
| 473 | Ga0436361_0356304 | 3300039447 | Bacteria | 5683 |
| 474 | Ga0436361_0362312 | 3300039447 | Bacteria | 55943 |
| 475 | Ga0436361_1115566 | 3300039447 | Bacteria | 4061 |
| 476 | Ga0451789_0672233 | 3300041443 | Bacteria | 810 |
| 477 | Ga0451789_0928157 | 3300041443 | Bacteria | 837 |
| 478 | Ga0451791_0854013 | 3300041451 | Bacteria | 1048 |
| 479 | Ga0451807_0250850 | 3300041486 | Bacteria | 1605 |
| 480 | Ga0451853_2770061 | 3300041512 | Bacteria | 697 |
| 481 | Ga0439452_002182 | 3300042010 | Bacteria | 7394 |
| 482 | Ga0451577_0217264 | 3300042876 | Bacteria | 1727 |
| 483 | Ga0466972_0187443 | 3300044658 | Bacteria | 969 |
| 484 | Ga0453683_0067092 | 3300044673 | Bacteria | 2242 |
| 485 | Ga0466966_0135118 | 3300044684 | Bacteria | 1508 |
| 486 | Ga0466966_0305749 | 3300044684 | Bacteria | 956 |
| 487 | Ga0453684_0022605 | 3300044712 | Bacteria | 9318 |
| 488 | Ga0466968_0012096 | 3300044735 | Bacteria | 3371 |
| 489 | Ga0451576_0314312 | 3300045051 | Bacteria | 1639 |
| 490 | Ga0495627_004217 | 3300046453 | Bacteria | 6082 |
| 491 | Ga0495650_0010405 | 3300046471 | Bacteria | 5191 |
| 492 | Ga0495606_0151747 | 3300046507 | Bacteria | 1359 |
| 493 | Ga0495631_0000568 | 3300046518 | Bacteria | 24838 |
| 494 | Ga0495637_0004150 | 3300046520 | Bacteria | 7543 |
| 495 | Ga0495621_0008325 | 3300046539 | Bacteria | 3105 |
| 496 | Ga0495597_0001974 | 3300046542 | Bacteria | 13773 |
| 497 | Ga0495622_0084617 | 3300046557 | Bacteria | 1459 |
| 498 | Ga0495668_0346696 | 3300046616 | Bacteria | 815 |
| 499 | Ga0495625_0204142 | 3300046660 | Bacteria | 1302 |
| 500 | Ga0495588_0019719 | 3300046674 | Bacteria | 3307 |
| 501 | Ga0495658_0065504 | 3300046683 | Bacteria | 2096 |
| 502 | Ga0495624_0391140 | 3300046690 | Bacteria | 835 |
| 503 | Ga0495671_0001939 | 3300046692 | Bacteria | 13265 |
| 504 | Ga0495660_0052927 | 3300046810 | Bacteria | 2205 |
| 505 | Ga0495593_0007197 | 3300047673 | Bacteria | 6525 |
| 506 | Ga0496101_0003658 | 3300048904 | Bacteria | 9595 |
| 507 | Ga0496102_0041084 | 3300048905 | Bacteria | 4187 |
| 508 | Ga0496103_0354740 | 3300048906 | Bacteria | 943 |
| 509 | Ga0496104_0009648 | 3300048907 | Bacteria | 8597 |
| 510 | Ga0496104_0188247 | 3300048907 | Bacteria | 1975 |
| 511 | Ga0496105_0001498 | 3300048908 | Bacteria | 16500 |
| 512 | Ga0496107_0014396 | 3300048910 | Bacteria | 5539 |
| 513 | Ga0496108_0043636 | 3300048911 | Bacteria | 3745 |
| 514 | Ga0496108_0052349 | 3300048911 | Bacteria | 3421 |
| 515 | Ga0496109_0075662 | 3300048912 | Bacteria | 3096 |
| 516 | Ga0496110_0066769 | 3300048913 | Bacteria | 3181 |
| 517 | Ga0496112_0498757 | 3300048915 | Bacteria | 1153 |
| 518 | Ga0496113_0082011 | 3300048916 | Bacteria | 2473 |
| 519 | Ga0496113_0775009 | 3300048916 | Bacteria | 763 |
| 520 | Ga0496114_0017437 | 3300048917 | Bacteria | 5796 |
| 521 | Ga0496114_0019059 | 3300048917 | Bacteria | 5560 |
| 522 | Ga0496115_0177701 | 3300048918 | Bacteria | 1760 |
| 523 | Ga0496117_0022355 | 3300048920 | Bacteria | 5075 |
| 524 | Ga0496117_0136882 | 3300048920 | Bacteria | 1474 |
| 525 | Ga0496118_0024508 | 3300048921 | Bacteria | 5203 |
| 526 | Ga0496118_0181435 | 3300048921 | Bacteria | 1271 |
| 527 | Ga0496121_0000018 | 3300048924 | Bacteria | 542045 |
| 528 | Ga0496121_0016542 | 3300048924 | Bacteria | 7609 |
| 529 | Ga0496122_0002359 | 3300048925 | Bacteria | 27157 |
| 530 | Ga0496123_0000108 | 3300048926 | Bacteria | 166102 |
| 531 | Ga0496124_0036322 | 3300048927 | Bacteria | 4299 |
| 532 | Ga0496124_0104238 | 3300048927 | Bacteria | 2293 |
| 533 | Ga0496125_0220257 | 3300048928 | Bacteria | 1223 |
| 534 | Ga0496126_0402889 | 3300048929 | Bacteria | 1109 |
| 535 | Ga0501036_0443683 | 3300049572 | Bacteria | 1081 |
| 536 | Ga0501043_0067884 | 3300049579 | Bacteria | 2800 |
| 537 | Ga0501047_0031795 | 3300049581 | Bacteria | 5091 |
| 538 | Ga0501080_0012035 | 3300049742 | Bacteria | 7925 |
| 539 | Ga0501035_0068055 | 3300049822 | Bacteria | 3158 |
| 540 | nmdc:mga03n38_45013_c1 | 3300050490 | Bacteria | 1941 |
| 541 | nmdc:mga00v17_66700_c1 | 3300050491 | Bacteria | 2222 |
| 542 | nmdc:mga0k408_186334_c1 | 3300050493 | Bacteria | 1238 |
| 543 | nmdc:mga0k408_20404_c1 | 3300050493 | Bacteria | 3711 |
| 544 | Ga0500610_0040104 | 3300053079 | Bacteria | 2418 |
| 545 | Ga0500643_003384 | 3300053087 | Bacteria | 7710 |
| 546 | Ga0500651_0000722 | 3300053093 | Bacteria | 16232 |
| 547 | Ga0500555_006844 | 3300053103 | Bacteria | 3241 |
| 548 | Ga0500571_000076 | 3300053110 | Bacteria | 30903 |
| 549 | Ga0500571_000362 | 3300053110 | Bacteria | 17940 |
| 550 | Ga0500593_000566 | 3300053117 | Bacteria | 14276 |
| 551 | Ga0500593_021917 | 3300053117 | Bacteria | 2817 |
| 552 | Ga0500594_0003094 | 3300053118 | Bacteria | 3639 |
| 553 | Ga0500607_001562 | 3300053121 | Bacteria | 20266 |
| 554 | Ga0500655_000498 | 3300053133 | Bacteria | 7923 |
| 555 | Ga0500658_0000096 | 3300053134 | Bacteria | 40172 |
| 556 | Ga0500658_0000100 | 3300053134 | Bacteria | 39487 |
| 557 | Ga0500658_0000990 | 3300053134 | Bacteria | 11609 |
| 558 | Ga0500559_0001129 | 3300053136 | Bacteria | 16078 |
| 559 | Ga0500564_003174 | 3300053138 | Bacteria | 6307 |
| 560 | Ga0500568_0011194 | 3300053139 | Bacteria | 4177 |
| 561 | Ga0500616_0069130 | 3300053153 | Bacteria | 1806 |
| 562 | Ga0500622_0000029 | 3300053156 | Bacteria | 213762 |
| 563 | Ga0500622_0097970 | 3300053156 | Bacteria | 1448 |
| 564 | Ga0500627_0001790 | 3300053158 | Bacteria | 6107 |
| 565 | Ga0500634_0003015 | 3300053161 | Bacteria | 7350 |
| 566 | Ga0500634_0051872 | 3300053161 | Bacteria | 2205 |
| 567 | Ga0466962_0130758 | 3300061719 | Bacteria | 1213 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0166974 | Ga0316574_0166974_403_987 | 183 |
| 2 | 3300036647 | Ga0316582_0905104 | Ga0316582_0905104_32_589 | 185 |
| 3 | 3300039062 | Ga0400483_019152 | Ga0400483_019152_10_570 | 185 |
| 4 | iso_pu_bacteria | 2501025501 | 2501075102 | 188 |
| 5 | iso_pu_bacteria | 2501025502 | 2501081795 | 188 |
| 6 | iso_pu_bacteria | 2501025504 | 2501408118 | 188 |
| 7 | iso_pu_bacteria | 2510917013 | 2511085730 | 188 |
| 8 | iso_pu_bacteria | 2510917014 | 2511095856 | 188 |
| 9 | iso_pu_bacteria | 2510917015 | 2511103391 | 188 |
| 10 | iso_pu_bacteria | 2511231003 | 2511248363 | 188 |
| 11 | iso_pu_bacteria | 2511231026 | 2511383359 | 188 |
| 12 | iso_pu_bacteria | 2513237082 | 2513556230 | 188 |
| 13 | iso_pu_bacteria | 2513237083 | 2513561417 | 188 |
| 14 | iso_pu_bacteria | 2515154189 | 2516020792 | 188 |
| 15 | iso_pu_bacteria | 2519103095 | 2519459585 | 188 |
| 16 | iso_pu_bacteria | 2521172590 | 2521557075 | 188 |
| 17 | iso_pu_bacteria | 2548876994 | 2550696966 | 188 |
| 18 | iso_pu_bacteria | 2548876994 | 2550696968 | 188 |
| 19 | iso_pu_bacteria | 2551306416 | 2553007982 | 188 |
| 20 | iso_pu_bacteria | 2582581311 | 2585291173 | 188 |
| 21 | iso_pu_bacteria | 2599185292 | 2599904911 | 188 |
| 22 | iso_pu_bacteria | 2643221559 | 2643816343 | 188 |
| 23 | iso_pu_bacteria | 2643221569 | 2643860454 | 188 |
| 24 | iso_pu_bacteria | 2643221573 | 2643881534 | 188 |
| 25 | iso_pu_bacteria | 2643221586 | 2643938970 | 188 |
| 26 | iso_pu_bacteria | 2643221594 | 2643981682 | 188 |
| 27 | iso_pu_bacteria | 2643221612 | 2644077287 | 188 |
| 28 | iso_pu_bacteria | 2643221621 | 2644119810 | 188 |
| 29 | iso_pu_bacteria | 2643221720 | 2644662670 | 188 |
| 30 | iso_pu_bacteria | 2643221727 | 2644694403 | 188 |
| 31 | iso_pu_bacteria | 2643221728 | 2644698376 | 188 |
| 32 | iso_pu_bacteria | 2728369097 | 2729146219 | 188 |
| 33 | iso_pu_bacteria | 2765235838 | 2765568211 | 188 |
| 34 | iso_pu_bacteria | 2808606384 | 2808973749 | 188 |
| 35 | iso_pu_bacteria | 2808606386 | 2808983570 | 188 |
| 36 | iso_pu_bacteria | 2808606390 | 2809008586 | 188 |
| 37 | iso_pu_bacteria | 2808606391 | 2809015685 | 188 |
| 38 | iso_pu_bacteria | 2808606395 | 2809035590 | 188 |
| 39 | iso_pu_bacteria | 2808606415 | 2809129234 | 188 |
| 40 | iso_pu_bacteria | 2808606419 | 2809149711 | 188 |
| 41 | iso_pu_bacteria | 2816332253 | 2817261866 | 188 |
| 42 | iso_pu_bacteria | 2816332256 | 2817279570 | 188 |
| 43 | iso_pu_bacteria | 2816332286 | 2817454322 | 188 |
| 44 | iso_pu_bacteria | 2818991445 | 2819594543 | 188 |
| 45 | iso_pu_bacteria | 2818991449 | 2819616746 | 188 |
| 46 | iso_pu_bacteria | 2839094727 | 2839097484 | 188 |
| 47 | iso_pu_bacteria | 2852618963 | 2852619865 | 188 |
| 48 | iso_pu_bacteria | 2856287931 | 2856292024 | 188 |
| 49 | iso_pu_bacteria | 2857357740 | 2857360575 | 188 |
| 50 | iso_pu_bacteria | 2857537821 | 2857539134 | 188 |
| 51 | iso_pu_bacteria | 2858950400 | 2858956031 | 188 |
| 52 | iso_pu_bacteria | 2863421361 | 2863425869 | 188 |
| 53 | iso_pu_bacteria | 2870068957 | 2870070387 | 188 |
| 54 | iso_pu_bacteria | 2883087390 | 2883095152 | 188 |
| 55 | iso_pu_bacteria | 2884811622 | 2884812199 | 188 |
| 56 | iso_pu_bacteria | 2884836552 | 2884839245 | 188 |
| 57 | iso_pu_bacteria | 2884852848 | 2884855536 | 188 |
| 58 | iso_pu_bacteria | 2894510363 | 2894514165 | 188 |
| 59 | iso_pu_bacteria | 2896154374 | 2896158957 | 188 |
| 60 | iso_pu_bacteria | 2904439833 | 2904440236 | 188 |
| 61 | iso_pu_bacteria | 2904530477 | 2904530854 | 188 |
| 62 | iso_pu_bacteria | 2904564687 | 2904569237 | 188 |
| 63 | iso_pu_bacteria | 2904571731 | 2904576455 | 188 |
| 64 | iso_pu_bacteria | 2904584206 | 2904585736 | 188 |
| 65 | iso_pu_bacteria | 2904589729 | 2904592451 | 188 |
| 66 | iso_pu_bacteria | 2904601388 | 2904601412 | 188 |
| 67 | iso_pu_bacteria | 2919046199 | 2919049875 | 188 |
| 68 | iso_pu_bacteria | 2919079590 | 2919082936 | 188 |
| 69 | iso_pu_bacteria | 2923510766 | 2923515712 | 188 |
| 70 | iso_pu_bacteria | 2928130867 | 2928134584 | 188 |
| 71 | iso_pu_bacteria | 2928157003 | 2928161339 | 188 |
| 72 | iso_pu_bacteria | 2928163908 | 2928168169 | 188 |
| 73 | iso_pu_bacteria | 2928170801 | 2928178548 | 188 |
| 74 | iso_pu_bacteria | 2928536128 | 2928541633 | 188 |
| 75 | iso_pu_bacteria | 2941479691 | 2941483822 | 188 |
| 76 | iso_pu_bacteria | 2981990288 | 2981993278 | 188 |
| 77 | iso_pu_bacteria | 2989392574 | 2989392925 | 188 |
| 78 | iso_pu_bacteria | 640427133 | 640489074 | 188 |
| 79 | iso_pu_bacteria | 641736154 | 642415617 | 188 |
| 80 | iso_pu_bacteria | 651053060 | 651177168 | 188 |
| 81 | iso_pu_bacteria | 8001522603 | 8001524091 | 188 |
| 82 | iso_pu_bacteria | 8003955200 | 8003957560 | 188 |
| 83 | iso_pu_bacteria | 8020807995 | 8020808245 | 188 |
| 84 | iso_pu_bacteria | 8020945358 | 8020950505 | 188 |
| 85 | iso_pu_bacteria | 8039098773 | 8039100860 | 188 |
| 86 | iso_pu_bacteria | 8040167225 | 8040169025 | 188 |
| 87 | iso_pu_bacteria | 8040173305 | 8040179306 | 188 |
| 88 | iso_pu_bacteria | 8055225921 | 8055228274 | 188 |
| 89 | iso_pu_bacteria | 2511231002 | 2511246185 | 189 |
| 90 | iso_pu_bacteria | 2600255067 | 2600814574 | 189 |
| 91 | iso_pu_bacteria | 2738541307 | 2738882143 | 189 |
| 92 | iso_pu_bacteria | 2818991446 | 2819595794 | 189 |
| 93 | iso_pu_bacteria | 2818991446 | 2819598078 | 189 |
| 94 | iso_pu_bacteria | 2838054893 | 2838057118 | 189 |
| 95 | iso_pu_bacteria | 2838054893 | 2838058489 | 189 |
| 96 | iso_pu_bacteria | 2899924645 | 2899925140 | 189 |
| 97 | iso_pu_bacteria | 2899924645 | 2899929495 | 189 |
| 98 | iso_pu_bacteria | 2904541872 | 2904543383 | 189 |
| 99 | iso_pu_bacteria | 2904541872 | 2904544710 | 189 |
| 100 | iso_pu_bacteria | 2928037797 | 2928038735 | 189 |
| 101 | iso_pu_bacteria | 2928037797 | 2928040059 | 189 |
| 102 | iso_pu_bacteria | 2928044640 | 2928045660 | 189 |
| 103 | iso_pu_bacteria | 2928044640 | 2928047192 | 189 |
| 104 | iso_pu_bacteria | 2928051484 | 2928053277 | 189 |
| 105 | iso_pu_bacteria | 2928051484 | 2928057607 | 189 |
| 106 | iso_pu_bacteria | 2928064002 | 2928066882 | 189 |
| 107 | iso_pu_bacteria | 2928064002 | 2928068011 | 189 |
| 108 | iso_pu_bacteria | 2928070936 | 2928071237 | 189 |
| 109 | iso_pu_bacteria | 2928070936 | 2928072587 | 189 |
| 110 | iso_pu_bacteria | 2928084124 | 2928084838 | 189 |
| 111 | iso_pu_bacteria | 2928084124 | 2928085762 | 189 |
| 112 | iso_pu_bacteria | 2928115317 | 2928116393 | 189 |
| 113 | iso_pu_bacteria | 2929160207 | 2929160616 | 189 |
| 114 | iso_pu_bacteria | 2929160207 | 2929163618 | 189 |
| 115 | iso_pu_bacteria | 2945909444 | 2945912302 | 189 |
| 116 | iso_pu_bacteria | 2945909444 | 2945914905 | 189 |
| 117 | iso_pu_bacteria | 2945984333 | 2945985385 | 189 |
| 118 | iso_pu_bacteria | 2945984333 | 2945989699 | 189 |
| 119 | 3300009093 | Ga0105240_10000096 | Ga0105240_10000096124 | 191 |
| 120 | 3300025913 | Ga0207695_10000836 | Ga0207695_1000083646 | 191 |
| 121 | 3300028654 | Ga0265322_10118519 | Ga0265322_101185191 | 191 |
| 122 | 3300028666 | Ga0265336_10010251 | Ga0265336_100102512 | 191 |
| 123 | 3300031691 | Ga0316579_10003273 | Ga0316579_100032738 | 191 |
| 124 | 3300031733 | Ga0316577_10073228 | Ga0316577_100732283 | 191 |
| 125 | 3300032168 | Ga0316593_10035974 | Ga0316593_100359742 | 191 |
| 126 | 3300033524 | Ga0316592_1060559 | Ga0316592_10605591 | 191 |
| 127 | 3300033541 | Ga0316596_1050494 | Ga0316596_10504941 | 191 |
| 128 | 3300036647 | Ga0316582_0170244 | Ga0316582_0170244_493_1071 | 191 |
| 129 | 3300044673 | Ga0453683_0067092 | Ga0453683_0067092_113_688 | 191 |
| 130 | 3300044712 | Ga0453684_0022605 | Ga0453684_0022605_8609_9184 | 191 |
| 131 | 3300053103 | Ga0500555_006844 | Ga0500555_006844_1586_2161 | 191 |
| 132 | 3300005616 | Ga0068852_100032373 | Ga0068852_1000323735 | 192 |
| 133 | 3300020077 | Ga0206351_10428386 | Ga0206351_104283862 | 192 |
| 134 | 3300020610 | Ga0154015_1240110 | Ga0154015_12401101 | 192 |
| 135 | 3300026142 | Ga0207698_10005789 | Ga0207698_100057893 | 192 |
| 136 | 3300027395 | Ga0209996_1003350 | Ga0209996_10033502 | 192 |
| 137 | 3300027552 | Ga0209982_1020102 | Ga0209982_10201022 | 192 |
| 138 | 3300027614 | Ga0209970_1015411 | Ga0209970_10154111 | 192 |
| 139 | 3300027665 | Ga0209983_1001258 | Ga0209983_10012585 | 192 |
| 140 | 3300027682 | Ga0209971_1001741 | Ga0209971_10017414 | 192 |
| 141 | 3300028563 | Ga0265319_1007769 | Ga0265319_10077692 | 192 |
| 142 | 3300028577 | Ga0265318_10075050 | Ga0265318_100750502 | 192 |
| 143 | 3300031251 | Ga0265327_10001152 | Ga0265327_1000115214 | 192 |
| 144 | 3300031665 | Ga0316575_10075151 | Ga0316575_100751511 | 192 |
| 145 | 3300031665 | Ga0316575_10126717 | Ga0316575_101267171 | 192 |
| 146 | 3300031691 | Ga0316579_10002240 | Ga0316579_100022402 | 192 |
| 147 | 3300031691 | Ga0316579_10010519 | Ga0316579_100105192 | 192 |
| 148 | 3300031691 | Ga0316579_10201963 | Ga0316579_102019632 | 192 |
| 149 | 3300031711 | Ga0265314_10104775 | Ga0265314_101047751 | 192 |
| 150 | 3300031727 | Ga0316576_10003570 | Ga0316576_100035705 | 192 |
| 151 | 3300031727 | Ga0316576_10055018 | Ga0316576_100550182 | 192 |
| 152 | 3300031727 | Ga0316576_10066156 | Ga0316576_100661563 | 192 |
| 153 | 3300031727 | Ga0316576_10133575 | Ga0316576_101335752 | 192 |
| 154 | 3300031727 | Ga0316576_10335475 | Ga0316576_103354752 | 192 |
| 155 | 3300031728 | Ga0316578_10003048 | Ga0316578_100030482 | 192 |
| 156 | 3300031728 | Ga0316578_10015033 | Ga0316578_100150335 | 192 |
| 157 | 3300031728 | Ga0316578_10098879 | Ga0316578_100988792 | 192 |
| 158 | 3300031728 | Ga0316578_10109545 | Ga0316578_101095452 | 192 |
| 159 | 3300031728 | Ga0316578_10140245 | Ga0316578_101402453 | 192 |
| 160 | 3300031728 | Ga0316578_10175690 | Ga0316578_101756902 | 192 |
| 161 | 3300031733 | Ga0316577_10015044 | Ga0316577_100150442 | 192 |
| 162 | 3300032133 | Ga0316583_10130134 | Ga0316583_101301341 | 192 |
| 163 | 3300032137 | Ga0316585_10126701 | Ga0316585_101267011 | 192 |
| 164 | 3300032139 | Ga0316580_10002554 | Ga0316580_100025546 | 192 |
| 165 | 3300032168 | Ga0316593_10002364 | Ga0316593_100023643 | 192 |
| 166 | 3300032168 | Ga0316593_10003182 | Ga0316593_100031823 | 192 |
| 167 | 3300032168 | Ga0316593_10011615 | Ga0316593_100116153 | 192 |
| 168 | 3300032168 | Ga0316593_10016894 | Ga0316593_100168942 | 192 |
| 169 | 3300032168 | Ga0316593_10027098 | Ga0316593_100270981 | 192 |
| 170 | 3300032168 | Ga0316593_10040301 | Ga0316593_100403012 | 192 |
| 171 | 3300032168 | Ga0316593_10048579 | Ga0316593_100485793 | 192 |
| 172 | 3300032168 | Ga0316593_10056501 | Ga0316593_100565011 | 192 |
| 173 | 3300032168 | Ga0316593_10096907 | Ga0316593_100969072 | 192 |
| 174 | 3300032168 | Ga0316593_10136487 | Ga0316593_101364871 | 192 |
| 175 | 3300032168 | Ga0316593_10138418 | Ga0316593_101384182 | 192 |
| 176 | 3300032168 | Ga0316593_10168261 | Ga0316593_101682611 | 192 |
| 177 | 3300033524 | Ga0316592_1005765 | Ga0316592_10057651 | 192 |
| 178 | 3300033524 | Ga0316592_1005989 | Ga0316592_10059893 | 192 |
| 179 | 3300033524 | Ga0316592_1006524 | Ga0316592_10065241 | 192 |
| 180 | 3300033524 | Ga0316592_1014320 | Ga0316592_10143202 | 192 |
| 181 | 3300033524 | Ga0316592_1015497 | Ga0316592_10154972 | 192 |
| 182 | 3300033524 | Ga0316592_1025700 | Ga0316592_10257002 | 192 |
| 183 | 3300033524 | Ga0316592_1032448 | Ga0316592_10324482 | 192 |
| 184 | 3300033524 | Ga0316592_1046083 | Ga0316592_10460831 | 192 |
| 185 | 3300033524 | Ga0316592_1056442 | Ga0316592_10564421 | 192 |
| 186 | 3300033524 | Ga0316592_1091733 | Ga0316592_10917331 | 192 |
| 187 | 3300033524 | Ga0316592_1105740 | Ga0316592_11057401 | 192 |
| 188 | 3300033527 | Ga0316586_1005274 | Ga0316586_10052742 | 192 |
| 189 | 3300033527 | Ga0316586_1019998 | Ga0316586_10199981 | 192 |
| 190 | 3300033527 | Ga0316586_1022006 | Ga0316586_10220061 | 192 |
| 191 | 3300033527 | Ga0316586_1033660 | Ga0316586_10336602 | 192 |
| 192 | 3300033527 | Ga0316586_1038300 | Ga0316586_10383001 | 192 |
| 193 | 3300033527 | Ga0316586_1043942 | Ga0316586_10439421 | 192 |
| 194 | 3300033527 | Ga0316586_1051524 | Ga0316586_10515241 | 192 |
| 195 | 3300033527 | Ga0316586_1055756 | Ga0316586_10557561 | 192 |
| 196 | 3300033527 | Ga0316586_1062903 | Ga0316586_10629031 | 192 |
| 197 | 3300033527 | Ga0316586_1075341 | Ga0316586_10753411 | 192 |
| 198 | 3300033528 | Ga0316588_1037005 | Ga0316588_10370052 | 192 |
| 199 | 3300033528 | Ga0316588_1048864 | Ga0316588_10488641 | 192 |
| 200 | 3300033528 | Ga0316588_1053088 | Ga0316588_10530882 | 192 |
| 201 | 3300033528 | Ga0316588_1065248 | Ga0316588_10652481 | 192 |
| 202 | 3300033528 | Ga0316588_1084001 | Ga0316588_10840011 | 192 |
| 203 | 3300033529 | Ga0316587_1002073 | Ga0316587_10020731 | 192 |
| 204 | 3300033529 | Ga0316587_1011428 | Ga0316587_10114281 | 192 |
| 205 | 3300033529 | Ga0316587_1016999 | Ga0316587_10169992 | 192 |
| 206 | 3300033529 | Ga0316587_1022838 | Ga0316587_10228381 | 192 |
| 207 | 3300033529 | Ga0316587_1022947 | Ga0316587_10229471 | 192 |
| 208 | 3300033529 | Ga0316587_1023026 | Ga0316587_10230261 | 192 |
| 209 | 3300033529 | Ga0316587_1024775 | Ga0316587_10247751 | 192 |
| 210 | 3300033529 | Ga0316587_1041169 | Ga0316587_10411691 | 192 |
| 211 | 3300033529 | Ga0316587_1044244 | Ga0316587_10442441 | 192 |
| 212 | 3300033529 | Ga0316587_1077153 | Ga0316587_10771531 | 192 |
| 213 | 3300033541 | Ga0316596_1003281 | Ga0316596_10032812 | 192 |
| 214 | 3300033541 | Ga0316596_1010810 | Ga0316596_10108102 | 192 |
| 215 | 3300033541 | Ga0316596_1045748 | Ga0316596_10457481 | 192 |
| 216 | 3300033541 | Ga0316596_1048987 | Ga0316596_10489871 | 192 |
| 217 | 3300033541 | Ga0316596_1050677 | Ga0316596_10506771 | 192 |
| 218 | 3300033541 | Ga0316596_1060385 | Ga0316596_10603852 | 192 |
| 219 | 3300033541 | Ga0316596_1082098 | Ga0316596_10820981 | 192 |
| 220 | 3300033541 | Ga0316596_1086999 | Ga0316596_10869991 | 192 |
| 221 | 3300033541 | Ga0316596_1092820 | Ga0316596_10928201 | 192 |
| 222 | 3300033541 | Ga0316596_1103012 | Ga0316596_11030121 | 192 |
| 223 | 3300033541 | Ga0316596_1108539 | Ga0316596_11085391 | 192 |
| 224 | 3300033541 | Ga0316596_1151937 | Ga0316596_11519371 | 192 |
| 225 | 3300035398 | Ga0316574_0058769 | Ga0316574_0058769_769_1347 | 192 |
| 226 | 3300035398 | Ga0316574_0059664 | Ga0316574_0059664_1688_2266 | 192 |
| 227 | 3300035398 | Ga0316574_0099246 | Ga0316574_0099246_328_906 | 192 |
| 228 | 3300035398 | Ga0316574_0103246 | Ga0316574_0103246_726_1307 | 192 |
| 229 | 3300035398 | Ga0316574_0107635 | Ga0316574_0107635_970_1548 | 192 |
| 230 | 3300035398 | Ga0316574_0115416 | Ga0316574_0115416_588_1166 | 192 |
| 231 | 3300035398 | Ga0316574_0148979 | Ga0316574_0148979_183_878 | 192 |
| 232 | 3300035398 | Ga0316574_0377019 | Ga0316574_0377019_95_673 | 192 |
| 233 | 3300035692 | Ga0373935_0036455 | Ga0373935_0036455_1101_1682 | 192 |
| 234 | 3300036647 | Ga0316582_0012859 | Ga0316582_0012859_30_608 | 192 |
| 235 | 3300036647 | Ga0316582_0078295 | Ga0316582_0078295_48_629 | 192 |
| 236 | 3300036647 | Ga0316582_0122101 | Ga0316582_0122101_23_604 | 192 |
| 237 | 3300036647 | Ga0316582_0147667 | Ga0316582_0147667_165_746 | 192 |
| 238 | 3300036647 | Ga0316582_0273580 | Ga0316582_0273580_385_963 | 192 |
| 239 | 3300036647 | Ga0316582_0485939 | Ga0316582_0485939_150_728 | 192 |
| 240 | 3300036647 | Ga0316582_0710343 | Ga0316582_0710343_25_606 | 192 |
| 241 | 3300036647 | Ga0316582_0762336 | Ga0316582_0762336_20_601 | 192 |
| 242 | 3300036712 | Ga0316584_0026869 | Ga0316584_0026869_722_1303 | 192 |
| 243 | 3300036712 | Ga0316584_0027463 | Ga0316584_0027463_1592_2173 | 192 |
| 244 | 3300036712 | Ga0316584_0031441 | Ga0316584_0031441_420_998 | 192 |
| 245 | 3300036712 | Ga0316584_0089632 | Ga0316584_0089632_601_1182 | 192 |
| 246 | 3300036712 | Ga0316584_0100914 | Ga0316584_0100914_492_1073 | 192 |
| 247 | 3300038725 | Ga0400484_13308 | Ga0400484_13308_5658_6239 | 192 |
| 248 | 3300038725 | Ga0400484_15042 | Ga0400484_15042_1296_1877 | 192 |
| 249 | 3300038725 | Ga0400484_26729 | Ga0400484_26729_9045_9629 | 192 |
| 250 | 3300038725 | Ga0400484_39270 | Ga0400484_39270_218_799 | 192 |
| 251 | 3300038726 | Ga0400490_10105 | Ga0400490_10105_324_905 | 192 |
| 252 | 3300038726 | Ga0400490_18320 | Ga0400490_18320_8738_9409 | 192 |
| 253 | 3300038726 | Ga0400490_22574 | Ga0400490_22574_16402_16983 | 192 |
| 254 | 3300038726 | Ga0400490_37868 | Ga0400490_37868_223_804 | 192 |
| 255 | 3300038726 | Ga0400490_41189 | Ga0400490_41189_137_718 | 192 |
| 256 | 3300038726 | Ga0400490_49726 | Ga0400490_49726_260_841 | 192 |
| 257 | 3300038726 | Ga0400490_50012 | Ga0400490_50012_3741_4322 | 192 |
| 258 | 3300038727 | Ga0400491_17779 | Ga0400491_17779_1148_1729 | 192 |
| 259 | 3300038727 | Ga0400491_26672 | Ga0400491_26672_1422_2003 | 192 |
| 260 | 3300038735 | Ga0400485_01919 | Ga0400485_01919_283_864 | 192 |
| 261 | 3300038735 | Ga0400485_04300 | Ga0400485_04300_3281_3862 | 192 |
| 262 | 3300038735 | Ga0400485_05559 | Ga0400485_05559_71782_72363 | 192 |
| 263 | 3300038735 | Ga0400485_13786 | Ga0400485_13786_5151_5732 | 192 |
| 264 | 3300038741 | Ga0400488_08965 | Ga0400488_08965_138_719 | 192 |
| 265 | 3300038741 | Ga0400488_15710 | Ga0400488_15710_1270_1887 | 192 |
| 266 | 3300038741 | Ga0400488_16979 | Ga0400488_16979_9511_10092 | 192 |
| 267 | 3300038741 | Ga0400488_24313 | Ga0400488_24313_385_966 | 192 |
| 268 | 3300038741 | Ga0400488_24385 | Ga0400488_24385_620_1198 | 192 |
| 269 | 3300038741 | Ga0400488_31407 | Ga0400488_31407_3024_3605 | 192 |
| 270 | 3300038741 | Ga0400488_56635 | Ga0400488_56635_24150_24731 | 192 |
| 271 | 3300038742 | Ga0400486_08934 | Ga0400486_08934_5147_5728 | 192 |
| 272 | 3300038742 | Ga0400486_11322 | Ga0400486_11322_727_1308 | 192 |
| 273 | 3300038742 | Ga0400486_19494 | Ga0400486_19494_2161_2742 | 192 |
| 274 | 3300038742 | Ga0400486_22319 | Ga0400486_22319_2199_2780 | 192 |
| 275 | 3300038742 | Ga0400486_24992 | Ga0400486_24992_855_1436 | 192 |
| 276 | 3300038742 | Ga0400486_25787 | Ga0400486_25787_2551_3132 | 192 |
| 277 | 3300038742 | Ga0400486_29967 | Ga0400486_29967_2190_2771 | 192 |
| 278 | 3300039062 | Ga0400483_040321 | Ga0400483_040321_4957_5538 | 192 |
| 279 | 3300039062 | Ga0400483_047647 | Ga0400483_047647_6302_6883 | 192 |
| 280 | 3300039062 | Ga0400483_072585 | Ga0400483_072585_4810_5391 | 192 |
| 281 | 3300039062 | Ga0400483_079703 | Ga0400483_079703_160_741 | 192 |
| 282 | 3300039062 | Ga0400483_088976 | Ga0400483_088976_5329_5910 | 192 |
| 283 | 3300039062 | Ga0400483_153515 | Ga0400483_153515_6493_7074 | 192 |
| 284 | 3300039062 | Ga0400483_166434 | Ga0400483_166434_4059_4640 | 192 |
| 285 | 3300039062 | Ga0400483_168599 | Ga0400483_168599_2748_3329 | 192 |
| 286 | 3300039062 | Ga0400483_178382 | Ga0400483_178382_2037_2618 | 192 |
| 287 | 3300039062 | Ga0400483_204937 | Ga0400483_204937_1059_1640 | 192 |
| 288 | 3300039062 | Ga0400483_211231 | Ga0400483_211231_721_1302 | 192 |
| 289 | 3300039062 | Ga0400483_216032 | Ga0400483_216032_4207_4788 | 192 |
| 290 | 3300039062 | Ga0400483_225160 | Ga0400483_225160_8239_8820 | 192 |
| 291 | 3300039093 | Ga0400489_87471 | Ga0400489_87471_298_879 | 192 |
| 292 | 3300039110 | Ga0400487_02859 | Ga0400487_02859_39338_39919 | 192 |
| 293 | 3300039110 | Ga0400487_09396 | Ga0400487_09396_7429_8010 | 192 |
| 294 | 3300039110 | Ga0400487_23547 | Ga0400487_23547_11275_11892 | 192 |
| 295 | 3300039110 | Ga0400487_25942 | Ga0400487_25942_8043_8624 | 192 |
| 296 | 3300039110 | Ga0400487_47800 | Ga0400487_47800_3207_3788 | 192 |
| 297 | 3300039110 | Ga0400487_59574 | Ga0400487_59574_27300_27881 | 192 |
| 298 | 3300045051 | Ga0451576_0314312 | Ga0451576_0314312_978_1559 | 192 |
| 299 | 3300048924 | Ga0496121_0000018 | Ga0496121_0000018_313316_313900 | 192 |
| 300 | 3300048924 | Ga0496121_0016542 | Ga0496121_0016542_4622_5200 | 192 |
| 301 | 3300053156 | Ga0500622_0000029 | Ga0500622_0000029_124363_124944 | 192 |
| 302 | 3300001979 | JGI24740J21852_10051584 | JGI24740J21852_100515842 | 193 |
| 303 | 3300001989 | JGI24739J22299_10013502 | JGI24739J22299_100135023 | 193 |
| 304 | 3300002739 | JGI25158J39367_1011357 | JGI25158J39367_10113572 | 193 |
| 305 | 3300002773 | JGI25152J39213_1012314 | JGI25152J39213_10123142 | 193 |
| 306 | 3300002987 | JGI25159J45721_1001861 | JGI25159J45721_10018616 | 193 |
| 307 | 3300002987 | JGI25159J45721_1003820 | JGI25159J45721_10038206 | 193 |
| 308 | 3300002987 | JGI25159J45721_1004718 | JGI25159J45721_10047183 | 193 |
| 309 | 3300002987 | JGI25159J45721_1005899 | JGI25159J45721_10058993 | 193 |
| 310 | 3300003187 | JGI25151J46595_10013500 | JGI25151J46595_100135005 | 193 |
| 311 | 3300003187 | JGI25151J46595_10020267 | JGI25151J46595_100202672 | 193 |
| 312 | 3300003187 | JGI25151J46595_10029288 | JGI25151J46595_100292882 | 193 |
| 313 | 3300003354 | JGI25160J50197_1000646 | JGI25160J50197_10006465 | 193 |
| 314 | 3300003354 | JGI25160J50197_1000712 | JGI25160J50197_100071211 | 193 |
| 315 | 3300003374 | JGI25161J50226_1000018 | JGI25161J50226_1000018173 | 193 |
| 316 | 3300003374 | JGI25161J50226_1002851 | JGI25161J50226_10028514 | 193 |
| 317 | 3300003759 | Ga0055525_1000013 | Ga0055525_1000013156 | 193 |
| 318 | 3300003760 | Ga0055527_1005489 | Ga0055527_10054892 | 193 |
| 319 | 3300003771 | Ga0055526_1010564 | Ga0055526_10105644 | 193 |
| 320 | 3300003773 | Ga0055537_1001685 | Ga0055537_10016854 | 193 |
| 321 | 3300003773 | Ga0055537_1010093 | Ga0055537_10100932 | 193 |
| 322 | 3300003775 | Ga0055524_1000012 | Ga0055524_100001211 | 193 |
| 323 | 3300003781 | Ga0055536_1005421 | Ga0055536_10054216 | 193 |
| 324 | 3300003784 | Ga0055534_1003317 | Ga0055534_10033174 | 193 |
| 325 | 3300003784 | Ga0055534_1004663 | Ga0055534_10046633 | 193 |
| 326 | 3300003790 | Ga0055528_1000925 | Ga0055528_100092518 | 193 |
| 327 | 3300003790 | Ga0055528_1006458 | Ga0055528_10064583 | 193 |
| 328 | 3300003791 | Ga0055530_10002096 | Ga0055530_1000209611 | 193 |
| 329 | 3300003791 | Ga0055530_10002329 | Ga0055530_1000232911 | 193 |
| 330 | 3300003791 | Ga0055530_10047761 | Ga0055530_100477612 | 193 |
| 331 | 3300003792 | Ga0055540_1000012 | Ga0055540_1000012129 | 193 |
| 332 | 3300003792 | Ga0055540_1027959 | Ga0055540_10279591 | 193 |
| 333 | 3300003794 | Ga0055531_10000345 | Ga0055531_1000034527 | 193 |
| 334 | 3300003794 | Ga0055531_10004467 | Ga0055531_100044674 | 193 |
| 335 | 3300003794 | Ga0055531_10039699 | Ga0055531_100396992 | 193 |
| 336 | 3300004625 | Ga0055543_1001471 | Ga0055543_10014717 | 193 |
| 337 | 3300004625 | Ga0055543_1002402 | Ga0055543_10024024 | 193 |
| 338 | 3300005262 | Ga0065165_1029136 | Ga0065165_10291363 | 193 |
| 339 | 3300005262 | Ga0065165_1100907 | Ga0065165_11009071 | 193 |
| 340 | 3300005289 | Ga0065704_10029721 | Ga0065704_100297212 | 193 |
| 341 | 3300005327 | Ga0070658_10020320 | Ga0070658_100203206 | 193 |
| 342 | 3300005327 | Ga0070658_10619094 | Ga0070658_106190942 | 193 |
| 343 | 3300005328 | Ga0070676_10264626 | Ga0070676_102646262 | 193 |
| 344 | 3300005329 | Ga0070683_100005699 | Ga0070683_10000569914 | 193 |
| 345 | 3300005329 | Ga0070683_100162463 | Ga0070683_1001624632 | 193 |
| 346 | 3300005335 | Ga0070666_10267897 | Ga0070666_102678972 | 193 |
| 347 | 3300005335 | Ga0070666_10420055 | Ga0070666_104200551 | 193 |
| 348 | 3300005338 | Ga0068868_100001942 | Ga0068868_10000194213 | 193 |
| 349 | 3300005339 | Ga0070660_100075942 | Ga0070660_1000759422 | 193 |
| 350 | 3300005339 | Ga0070660_100279113 | Ga0070660_1002791131 | 193 |
| 351 | 3300005344 | Ga0070661_100277424 | Ga0070661_1002774242 | 193 |
| 352 | 3300005353 | Ga0070669_100028621 | Ga0070669_1000286212 | 193 |
| 353 | 3300005353 | Ga0070669_100102338 | Ga0070669_1001023382 | 193 |
| 354 | 3300005354 | Ga0070675_100002690 | Ga0070675_10000269013 | 193 |
| 355 | 3300005355 | Ga0070671_100305335 | Ga0070671_1003053352 | 193 |
| 356 | 3300005356 | Ga0070674_100324362 | Ga0070674_1003243622 | 193 |
| 357 | 3300005364 | Ga0070673_101389581 | Ga0070673_1013895811 | 193 |
| 358 | 3300005366 | Ga0070659_100078641 | Ga0070659_1000786412 | 193 |
| 359 | 3300005366 | Ga0070659_100352569 | Ga0070659_1003525692 | 193 |
| 360 | 3300005367 | Ga0070667_100240676 | Ga0070667_1002406762 | 193 |
| 361 | 3300005367 | Ga0070667_100291034 | Ga0070667_1002910342 | 193 |
| 362 | 3300005455 | Ga0070663_100459781 | Ga0070663_1004597811 | 193 |
| 363 | 3300005457 | Ga0070662_100026589 | Ga0070662_1000265894 | 193 |
| 364 | 3300005457 | Ga0070662_100094386 | Ga0070662_1000943862 | 193 |
| 365 | 3300005459 | Ga0068867_100011231 | Ga0068867_1000112312 | 193 |
| 366 | 3300005466 | Ga0070685_10828367 | Ga0070685_108283671 | 193 |
| 367 | 3300005535 | Ga0070684_100032261 | Ga0070684_1000322616 | 193 |
| 368 | 3300005535 | Ga0070684_100304994 | Ga0070684_1003049943 | 193 |
| 369 | 3300005539 | Ga0068853_100055551 | Ga0068853_1000555513 | 193 |
| 370 | 3300005539 | Ga0068853_100189388 | Ga0068853_1001893881 | 193 |
| 371 | 3300005547 | Ga0070693_100087266 | Ga0070693_1000872662 | 193 |
| 372 | 3300005547 | Ga0070693_100097492 | Ga0070693_1000974922 | 193 |
| 373 | 3300005563 | Ga0068855_100023604 | Ga0068855_1000236046 | 193 |
| 374 | 3300005577 | Ga0068857_100127738 | Ga0068857_1001277382 | 193 |
| 375 | 3300005577 | Ga0068857_100520899 | Ga0068857_1005208991 | 193 |
| 376 | 3300005578 | Ga0068854_100016635 | Ga0068854_1000166354 | 193 |
| 377 | 3300005614 | Ga0068856_100063174 | Ga0068856_1000631745 | 193 |
| 378 | 3300005614 | Ga0068856_100277837 | Ga0068856_1002778372 | 193 |
| 379 | 3300005616 | Ga0068852_100217522 | Ga0068852_1002175222 | 193 |
| 380 | 3300005617 | Ga0068859_100217651 | Ga0068859_1002176512 | 193 |
| 381 | 3300005618 | Ga0068864_100009238 | Ga0068864_1000092387 | 193 |
| 382 | 3300005719 | Ga0068861_100005119 | Ga0068861_1000051195 | 193 |
| 383 | 3300005834 | Ga0068851_10059805 | Ga0068851_100598052 | 193 |
| 384 | 3300005834 | Ga0068851_10104123 | Ga0068851_101041233 | 193 |
| 385 | 3300005842 | Ga0068858_100387511 | Ga0068858_1003875113 | 193 |
| 386 | 3300005843 | Ga0068860_100008648 | Ga0068860_10000864814 | 193 |
| 387 | 3300006038 | Ga0075365_10094215 | Ga0075365_100942152 | 193 |
| 388 | 3300006042 | Ga0075368_10024245 | Ga0075368_100242453 | 193 |
| 389 | 3300006048 | Ga0075363_100239812 | Ga0075363_1002398121 | 193 |
| 390 | 3300006051 | Ga0075364_10006278 | Ga0075364_100062782 | 193 |
| 391 | 3300006051 | Ga0075364_10112903 | Ga0075364_101129032 | 193 |
| 392 | 3300006195 | Ga0075366_10016348 | Ga0075366_100163482 | 193 |
| 393 | 3300006195 | Ga0075366_10094424 | Ga0075366_100944242 | 193 |
| 394 | 3300006353 | Ga0075370_10367685 | Ga0075370_103676852 | 193 |
| 395 | 3300006358 | Ga0068871_100087560 | Ga0068871_1000875602 | 193 |
| 396 | 3300006931 | Ga0097620_100217652 | Ga0097620_1002176522 | 193 |
| 397 | 3300009093 | Ga0105240_10556401 | Ga0105240_105564012 | 193 |
| 398 | 3300009098 | Ga0105245_10036044 | Ga0105245_100360445 | 193 |
| 399 | 3300009177 | Ga0105248_10027182 | Ga0105248_100271825 | 193 |
| 400 | 3300009551 | Ga0105238_10060978 | Ga0105238_100609783 | 193 |
| 401 | 3300009551 | Ga0105238_10185754 | Ga0105238_101857543 | 193 |
| 402 | 3300010375 | Ga0105239_10275951 | Ga0105239_102759512 | 193 |
| 403 | 3300012480 | Ga0157346_1006907 | Ga0157346_10069072 | 193 |
| 404 | 3300012497 | Ga0157319_1006742 | Ga0157319_10067421 | 193 |
| 405 | 3300012502 | Ga0157347_1001688 | Ga0157347_10016882 | 193 |
| 406 | 3300012506 | Ga0157324_1001788 | Ga0157324_10017882 | 193 |
| 407 | 3300012513 | Ga0157326_1006688 | Ga0157326_10066882 | 193 |
| 408 | 3300013105 | Ga0157369_10018014 | Ga0157369_100180143 | 193 |
| 409 | 3300013296 | Ga0157374_10445067 | Ga0157374_104450672 | 193 |
| 410 | 3300013306 | Ga0163162_10030471 | Ga0163162_100304712 | 193 |
| 411 | 3300013307 | Ga0157372_10046609 | Ga0157372_100466093 | 193 |
| 412 | 3300013307 | Ga0157372_10056547 | Ga0157372_100565473 | 193 |
| 413 | 3300013308 | Ga0157375_11138664 | Ga0157375_111386642 | 193 |
| 414 | 3300014497 | Ga0182008_10000664 | Ga0182008_100006647 | 193 |
| 415 | 3300014745 | Ga0157377_10005357 | Ga0157377_100053575 | 193 |
| 416 | 3300014969 | Ga0157376_10004653 | Ga0157376_1000465312 | 193 |
| 417 | 3300015261 | Ga0182006_1063082 | Ga0182006_10630822 | 193 |
| 418 | 3300015262 | Ga0182007_10000468 | Ga0182007_100004686 | 193 |
| 419 | 3300015265 | Ga0182005_1098250 | Ga0182005_10982501 | 193 |
| 420 | 3300015683 | Ga0183362_10001 | Ga0183362_100011377 | 193 |
| 421 | 3300017792 | Ga0163161_10000142 | Ga0163161_100001423 | 193 |
| 422 | 3300017792 | Ga0163161_10000568 | Ga0163161_1000056819 | 193 |
| 423 | 3300021361 | Ga0213872_10000160 | Ga0213872_1000016058 | 193 |
| 424 | 3300021361 | Ga0213872_10000683 | Ga0213872_100006837 | 193 |
| 425 | 3300021361 | Ga0213872_10011112 | Ga0213872_100111125 | 193 |
| 426 | 3300025228 | Ga0209672_100354 | Ga0209672_10035417 | 193 |
| 427 | 3300025230 | Ga0209563_100025 | Ga0209563_100025430 | 193 |
| 428 | 3300025242 | Ga0209258_100015 | Ga0209258_100015118 | 193 |
| 429 | 3300025245 | Ga0207425_1000514 | Ga0207425_100051411 | 193 |
| 430 | 3300025245 | Ga0207425_1002389 | Ga0207425_10023894 | 193 |
| 431 | 3300025258 | Ga0209129_1000023 | Ga0209129_100002379 | 193 |
| 432 | 3300025258 | Ga0209129_1000049 | Ga0209129_1000049117 | 193 |
| 433 | 3300025258 | Ga0209129_1001139 | Ga0209129_100113914 | 193 |
| 434 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004623 | 193 |
| 435 | 3300025263 | Ga0209565_1000108 | Ga0209565_100010838 | 193 |
| 436 | 3300025263 | Ga0209565_1000187 | Ga0209565_100018757 | 193 |
| 437 | 3300025263 | Ga0209565_1000892 | Ga0209565_10008924 | 193 |
| 438 | 3300025273 | Ga0209673_1000074 | Ga0209673_1000074159 | 193 |
| 439 | 3300025273 | Ga0209673_1000389 | Ga0209673_100038957 | 193 |
| 440 | 3300025273 | Ga0209673_1000477 | Ga0209673_100047711 | 193 |
| 441 | 3300025273 | Ga0209673_1000817 | Ga0209673_100081738 | 193 |
| 442 | 3300025284 | Ga0209130_1000050 | Ga0209130_1000050173 | 193 |
| 443 | 3300025284 | Ga0209130_1000069 | Ga0209130_100006982 | 193 |
| 444 | 3300025284 | Ga0209130_1000267 | Ga0209130_100026760 | 193 |
| 445 | 3300025284 | Ga0209130_1000828 | Ga0209130_10008281 | 193 |
| 446 | 3300025284 | Ga0209130_1001005 | Ga0209130_100100510 | 193 |
| 447 | 3300025284 | Ga0209130_1001070 | Ga0209130_100107014 | 193 |
| 448 | 3300025291 | Ga0209675_1000044 | Ga0209675_100004446 | 193 |
| 449 | 3300025291 | Ga0209675_1000232 | Ga0209675_100023241 | 193 |
| 450 | 3300025291 | Ga0209675_1000398 | Ga0209675_100039832 | 193 |
| 451 | 3300025291 | Ga0209675_1001699 | Ga0209675_100169914 | 193 |
| 452 | 3300025291 | Ga0209675_1002669 | Ga0209675_10026697 | 193 |
| 453 | 3300025291 | Ga0209675_1003839 | Ga0209675_10038399 | 193 |
| 454 | 3300025291 | Ga0209675_1003844 | Ga0209675_10038444 | 193 |
| 455 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005737 | 193 |
| 456 | 3300025292 | Ga0209676_1000029 | Ga0209676_1000029278 | 193 |
| 457 | 3300025292 | Ga0209676_1000137 | Ga0209676_100013759 | 193 |
| 458 | 3300025292 | Ga0209676_1000139 | Ga0209676_1000139147 | 193 |
| 459 | 3300025292 | Ga0209676_1000416 | Ga0209676_100041614 | 193 |
| 460 | 3300025292 | Ga0209676_1001530 | Ga0209676_10015306 | 193 |
| 461 | 3300025292 | Ga0209676_1007648 | Ga0209676_10076485 | 193 |
| 462 | 3300025292 | Ga0209676_1009127 | Ga0209676_10091275 | 193 |
| 463 | 3300025294 | Ga0209025_1000313 | Ga0209025_100031315 | 193 |
| 464 | 3300025294 | Ga0209025_1000316 | Ga0209025_100031622 | 193 |
| 465 | 3300025294 | Ga0209025_1000481 | Ga0209025_100048115 | 193 |
| 466 | 3300025294 | Ga0209025_1005773 | Ga0209025_10057736 | 193 |
| 467 | 3300025294 | Ga0209025_1019202 | Ga0209025_10192023 | 193 |
| 468 | 3300025294 | Ga0209025_1024149 | Ga0209025_10241492 | 193 |
| 469 | 3300025294 | Ga0209025_1030246 | Ga0209025_10302464 | 193 |
| 470 | 3300025294 | Ga0209025_1047973 | Ga0209025_10479733 | 193 |
| 471 | 3300025295 | Ga0209564_1000090 | Ga0209564_1000090209 | 193 |
| 472 | 3300025295 | Ga0209564_1000232 | Ga0209564_100023236 | 193 |
| 473 | 3300025295 | Ga0209564_1000303 | Ga0209564_100030391 | 193 |
| 474 | 3300025295 | Ga0209564_1001809 | Ga0209564_100180917 | 193 |
| 475 | 3300025295 | Ga0209564_1019681 | Ga0209564_10196812 | 193 |
| 476 | 3300025295 | Ga0209564_1023389 | Ga0209564_10233892 | 193 |
| 477 | 3300025297 | Ga0209758_1000044 | Ga0209758_1000044348 | 193 |
| 478 | 3300025297 | Ga0209758_1000135 | Ga0209758_100013560 | 193 |
| 479 | 3300025297 | Ga0209758_1003942 | Ga0209758_10039424 | 193 |
| 480 | 3300025297 | Ga0209758_1009084 | Ga0209758_10090844 | 193 |
| 481 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003340 | 193 |
| 482 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007360 | 193 |
| 483 | 3300025298 | Ga0209050_1000015 | Ga0209050_1000015121 | 193 |
| 484 | 3300025298 | Ga0209050_1015570 | Ga0209050_10155704 | 193 |
| 485 | 3300025298 | Ga0209050_1019571 | Ga0209050_10195712 | 193 |
| 486 | 3300025298 | Ga0209050_1047094 | Ga0209050_10470942 | 193 |
| 487 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001344 | 193 |
| 488 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020351 | 193 |
| 489 | 3300025299 | Ga0209256_1000022 | Ga0209256_100002284 | 193 |
| 490 | 3300025299 | Ga0209256_1000129 | Ga0209256_100012960 | 193 |
| 491 | 3300025299 | Ga0209256_1000224 | Ga0209256_10002246 | 193 |
| 492 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001986 | 193 |
| 493 | 3300025302 | Ga0207426_1000031 | Ga0207426_1000031240 | 193 |
| 494 | 3300025302 | Ga0207426_1000071 | Ga0207426_100007183 | 193 |
| 495 | 3300025302 | Ga0207426_1000171 | Ga0207426_100017160 | 193 |
| 496 | 3300025302 | Ga0207426_1000185 | Ga0207426_100018552 | 193 |
| 497 | 3300025302 | Ga0207426_1003300 | Ga0207426_10033005 | 193 |
| 498 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003340 | 193 |
| 499 | 3300025303 | Ga0209051_1000010 | Ga0209051_1000010121 | 193 |
| 500 | 3300025303 | Ga0209051_1000036 | Ga0209051_100003688 | 193 |
| 501 | 3300025303 | Ga0209051_1001299 | Ga0209051_10012995 | 193 |
| 502 | 3300025303 | Ga0209051_1005858 | Ga0209051_10058582 | 193 |
| 503 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011711 | 193 |
| 504 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018340 | 193 |
| 505 | 3300025304 | Ga0209257_1000026 | Ga0209257_1000026557 | 193 |
| 506 | 3300025304 | Ga0209257_1000643 | Ga0209257_100064317 | 193 |
| 507 | 3300025304 | Ga0209257_1003639 | Ga0209257_100363911 | 193 |
| 508 | 3300025304 | Ga0209257_1004427 | Ga0209257_10044274 | 193 |
| 509 | 3300025304 | Ga0209257_1007677 | Ga0209257_10076772 | 193 |
| 510 | 3300025304 | Ga0209257_1014348 | Ga0209257_10143483 | 193 |
| 511 | 3300025304 | Ga0209257_1022304 | Ga0209257_10223044 | 193 |
| 512 | 3300025321 | Ga0207656_10121016 | Ga0207656_101210162 | 193 |
| 513 | 3300025908 | Ga0207643_10130029 | Ga0207643_101300292 | 193 |
| 514 | 3300025909 | Ga0207705_10511277 | Ga0207705_105112771 | 193 |
| 515 | 3300025913 | Ga0207695_10090050 | Ga0207695_100900502 | 193 |
| 516 | 3300025913 | Ga0207695_10160682 | Ga0207695_101606823 | 193 |
| 517 | 3300025919 | Ga0207657_10044124 | Ga0207657_100441244 | 193 |
| 518 | 3300025919 | Ga0207657_10235712 | Ga0207657_102357122 | 193 |
| 519 | 3300025923 | Ga0207681_10026743 | Ga0207681_100267432 | 193 |
| 520 | 3300025923 | Ga0207681_10044904 | Ga0207681_100449043 | 193 |
| 521 | 3300025924 | Ga0207694_10285023 | Ga0207694_102850232 | 193 |
| 522 | 3300025926 | Ga0207659_10305258 | Ga0207659_103052582 | 193 |
| 523 | 3300025927 | Ga0207687_10008809 | Ga0207687_100088095 | 193 |
| 524 | 3300025932 | Ga0207690_10031077 | Ga0207690_100310775 | 193 |
| 525 | 3300025932 | Ga0207690_10086483 | Ga0207690_100864833 | 193 |
| 526 | 3300025933 | Ga0207706_10144826 | Ga0207706_101448263 | 193 |
| 527 | 3300025933 | Ga0207706_10159295 | Ga0207706_101592952 | 193 |
| 528 | 3300025934 | Ga0207686_10329325 | Ga0207686_103293252 | 193 |
| 529 | 3300025935 | Ga0207709_10000195 | Ga0207709_1000019569 | 193 |
| 530 | 3300025935 | Ga0207709_10000308 | Ga0207709_1000030844 | 193 |
| 531 | 3300025935 | Ga0207709_10031504 | Ga0207709_100315042 | 193 |
| 532 | 3300025935 | Ga0207709_10071319 | Ga0207709_100713193 | 193 |
| 533 | 3300025940 | Ga0207691_10125601 | Ga0207691_101256014 | 193 |
| 534 | 3300025940 | Ga0207691_10134708 | Ga0207691_101347082 | 193 |
| 535 | 3300025940 | Ga0207691_10812940 | Ga0207691_108129401 | 193 |
| 536 | 3300025941 | Ga0207711_10006066 | Ga0207711_100060663 | 193 |
| 537 | 3300025944 | Ga0207661_10454772 | Ga0207661_104547721 | 193 |
| 538 | 3300025945 | Ga0207679_10003805 | Ga0207679_100038055 | 193 |
| 539 | 3300025960 | Ga0207651_10652379 | Ga0207651_106523792 | 193 |
| 540 | 3300025981 | Ga0207640_10089337 | Ga0207640_100893372 | 193 |
| 541 | 3300025981 | Ga0207640_10351508 | Ga0207640_103515081 | 193 |
| 542 | 3300025986 | Ga0207658_10225074 | Ga0207658_102250742 | 193 |
| 543 | 3300026023 | Ga0207677_10004412 | Ga0207677_100044125 | 193 |
| 544 | 3300026035 | Ga0207703_10113400 | Ga0207703_101134003 | 193 |
| 545 | 3300026041 | Ga0207639_10025273 | Ga0207639_100252732 | 193 |
| 546 | 3300026041 | Ga0207639_10424606 | Ga0207639_104246063 | 193 |
| 547 | 3300026041 | Ga0207639_10466622 | Ga0207639_104666222 | 193 |
| 548 | 3300026067 | Ga0207678_10069440 | Ga0207678_100694403 | 193 |
| 549 | 3300026067 | Ga0207678_10176402 | Ga0207678_101764022 | 193 |
| 550 | 3300026067 | Ga0207678_10404661 | Ga0207678_104046612 | 193 |
| 551 | 3300026078 | Ga0207702_10037173 | Ga0207702_100371733 | 193 |
| 552 | 3300026089 | Ga0207648_10010393 | Ga0207648_100103934 | 193 |
| 553 | 3300026089 | Ga0207648_10191097 | Ga0207648_101910972 | 193 |
| 554 | 3300026095 | Ga0207676_10009240 | Ga0207676_100092408 | 193 |
| 555 | 3300026095 | Ga0207676_10969178 | Ga0207676_109691782 | 193 |
| 556 | 3300026116 | Ga0207674_10075700 | Ga0207674_100757004 | 193 |
| 557 | 3300026118 | Ga0207675_100001125 | Ga0207675_10000112515 | 193 |
| 558 | 3300026118 | Ga0207675_100953003 | Ga0207675_1009530031 | 193 |
| 559 | 3300026121 | Ga0207683_10076632 | Ga0207683_100766322 | 193 |
| 560 | 3300026121 | Ga0207683_11011854 | Ga0207683_110118542 | 193 |
| 561 | 3300026142 | Ga0207698_10115999 | Ga0207698_101159992 | 193 |
| 562 | 3300026142 | Ga0207698_10167292 | Ga0207698_101672923 | 193 |
| 563 | 3300026142 | Ga0207698_10309110 | Ga0207698_103091102 | 193 |
| 564 | 3300028794 | Ga0307515_10000006 | Ga0307515_1000000691 | 193 |
| 565 | 3300028794 | Ga0307515_10000484 | Ga0307515_1000048479 | 193 |
| 566 | 3300028794 | Ga0307515_10000645 | Ga0307515_1000064540 | 193 |
| 567 | 3300028794 | Ga0307515_10224088 | Ga0307515_102240882 | 193 |
| 568 | 3300030522 | Ga0307512_10216274 | Ga0307512_102162741 | 193 |
| 569 | 3300031235 | Ga0265330_10064418 | Ga0265330_100644183 | 193 |
| 570 | 3300031250 | Ga0265331_10042383 | Ga0265331_100423832 | 193 |
| 571 | 3300031251 | Ga0265327_10006337 | Ga0265327_100063379 | 193 |
| 572 | 3300031251 | Ga0265327_10012819 | Ga0265327_100128193 | 193 |
| 573 | 3300031456 | Ga0307513_10000014 | Ga0307513_10000014254 | 193 |
| 574 | 3300031456 | Ga0307513_10005720 | Ga0307513_100057204 | 193 |
| 575 | 3300031456 | Ga0307513_10016922 | Ga0307513_100169228 | 193 |
| 576 | 3300031649 | Ga0307514_10000645 | Ga0307514_1000064534 | 193 |
| 577 | 3300031711 | Ga0265314_10077616 | Ga0265314_100776162 | 193 |
| 578 | 3300031712 | Ga0265342_10081430 | Ga0265342_100814302 | 193 |
| 579 | 3300031730 | Ga0307516_10019943 | Ga0307516_100199434 | 193 |
| 580 | 3300031730 | Ga0307516_10422900 | Ga0307516_104229001 | 193 |
| 581 | 3300031911 | Ga0307412_10002987 | Ga0307412_100029873 | 193 |
| 582 | 3300031911 | Ga0307412_10037397 | Ga0307412_100373972 | 193 |
| 583 | 3300032002 | Ga0307416_100019773 | Ga0307416_1000197734 | 193 |
| 584 | 3300032005 | Ga0307411_10056745 | Ga0307411_100567452 | 193 |
| 585 | 3300032005 | Ga0307411_10131898 | Ga0307411_101318982 | 193 |
| 586 | 3300035112 | Ga0373932_0079037 | Ga0373932_0079037_82_735 | 193 |
| 587 | 3300035691 | Ga0373931_0006809 | Ga0373931_0006809_4416_5069 | 193 |
| 588 | 3300037471 | Ga0395905_0098026 | Ga0395905_0098026_1455_2036 | 193 |
| 589 | 3300037471 | Ga0395905_0423867 | Ga0395905_0423867_67_648 | 193 |
| 590 | 3300038443 | Ga0395901_0028549 | Ga0395901_0028549_3622_4203 | 193 |
| 591 | 3300038443 | Ga0395901_0124059 | Ga0395901_0124059_424_1005 | 193 |
| 592 | 3300038443 | Ga0395901_0221688 | Ga0395901_0221688_1235_1816 | 193 |
| 593 | 3300039447 | Ga0436361_0126586 | Ga0436361_0126586_3872_4453 | 193 |
| 594 | 3300039447 | Ga0436361_0144792 | Ga0436361_0144792_17303_17884 | 193 |
| 595 | 3300039447 | Ga0436361_0356304 | Ga0436361_0356304_26_607 | 193 |
| 596 | 3300039447 | Ga0436361_0362312 | Ga0436361_0362312_31352_31933 | 193 |
| 597 | 3300039447 | Ga0436361_1115566 | Ga0436361_1115566_2022_2603 | 193 |
| 598 | 3300041443 | Ga0451789_0672233 | Ga0451789_0672233_174_755 | 193 |
| 599 | 3300041443 | Ga0451789_0928157 | Ga0451789_0928157_219_800 | 193 |
| 600 | 3300041451 | Ga0451791_0854013 | Ga0451791_0854013_78_659 | 193 |
| 601 | 3300041486 | Ga0451807_0250850 | Ga0451807_0250850_564_1187 | 193 |
| 602 | 3300041512 | Ga0451853_2770061 | Ga0451853_2770061_53_634 | 193 |
| 603 | 3300042010 | Ga0439452_002182 | Ga0439452_002182_4748_5329 | 193 |
| 604 | 3300042876 | Ga0451577_0217264 | Ga0451577_0217264_736_1317 | 193 |
| 605 | 3300044658 | Ga0466972_0187443 | Ga0466972_0187443_148_729 | 193 |
| 606 | 3300044684 | Ga0466966_0135118 | Ga0466966_0135118_417_998 | 193 |
| 607 | 3300044684 | Ga0466966_0305749 | Ga0466966_0305749_228_809 | 193 |
| 608 | 3300044735 | Ga0466968_0012096 | Ga0466968_0012096_125_706 | 193 |
| 609 | 3300046453 | Ga0495627_004217 | Ga0495627_004217_4512_5093 | 193 |
| 610 | 3300046471 | Ga0495650_0010405 | Ga0495650_0010405_2321_2902 | 193 |
| 611 | 3300046507 | Ga0495606_0151747 | Ga0495606_0151747_742_1323 | 193 |
| 612 | 3300046518 | Ga0495631_0000568 | Ga0495631_0000568_13600_14181 | 193 |
| 613 | 3300046520 | Ga0495637_0004150 | Ga0495637_0004150_1229_1810 | 193 |
| 614 | 3300046539 | Ga0495621_0008325 | Ga0495621_0008325_32_613 | 193 |
| 615 | 3300046542 | Ga0495597_0001974 | Ga0495597_0001974_1081_1662 | 193 |
| 616 | 3300046557 | Ga0495622_0084617 | Ga0495622_0084617_609_1190 | 193 |
| 617 | 3300046616 | Ga0495668_0346696 | Ga0495668_0346696_10_591 | 193 |
| 618 | 3300046660 | Ga0495625_0204142 | Ga0495625_0204142_48_629 | 193 |
| 619 | 3300046674 | Ga0495588_0019719 | Ga0495588_0019719_966_1547 | 193 |
| 620 | 3300046683 | Ga0495658_0065504 | Ga0495658_0065504_1259_1840 | 193 |
| 621 | 3300046690 | Ga0495624_0391140 | Ga0495624_0391140_25_606 | 193 |
| 622 | 3300046692 | Ga0495671_0001939 | Ga0495671_0001939_4947_5528 | 193 |
| 623 | 3300046810 | Ga0495660_0052927 | Ga0495660_0052927_625_1206 | 193 |
| 624 | 3300047673 | Ga0495593_0007197 | Ga0495593_0007197_5076_5657 | 193 |
| 625 | 3300048904 | Ga0496101_0003658 | Ga0496101_0003658_2441_3022 | 193 |
| 626 | 3300048905 | Ga0496102_0041084 | Ga0496102_0041084_577_1158 | 193 |
| 627 | 3300048906 | Ga0496103_0354740 | Ga0496103_0354740_230_883 | 193 |
| 628 | 3300048907 | Ga0496104_0009648 | Ga0496104_0009648_2474_3055 | 193 |
| 629 | 3300048907 | Ga0496104_0188247 | Ga0496104_0188247_1118_1771 | 193 |
| 630 | 3300048908 | Ga0496105_0001498 | Ga0496105_0001498_3826_4407 | 193 |
| 631 | 3300048910 | Ga0496107_0014396 | Ga0496107_0014396_3800_4453 | 193 |
| 632 | 3300048911 | Ga0496108_0043636 | Ga0496108_0043636_1810_2463 | 193 |
| 633 | 3300048911 | Ga0496108_0052349 | Ga0496108_0052349_813_1394 | 193 |
| 634 | 3300048912 | Ga0496109_0075662 | Ga0496109_0075662_1623_2207 | 193 |
| 635 | 3300048913 | Ga0496110_0066769 | Ga0496110_0066769_183_764 | 193 |
| 636 | 3300048915 | Ga0496112_0498757 | Ga0496112_0498757_387_1040 | 193 |
| 637 | 3300048916 | Ga0496113_0082011 | Ga0496113_0082011_1763_2416 | 193 |
| 638 | 3300048916 | Ga0496113_0775009 | Ga0496113_0775009_34_615 | 193 |
| 639 | 3300048917 | Ga0496114_0017437 | Ga0496114_0017437_1050_1703 | 193 |
| 640 | 3300048917 | Ga0496114_0019059 | Ga0496114_0019059_4793_5374 | 193 |
| 641 | 3300048918 | Ga0496115_0177701 | Ga0496115_0177701_460_1113 | 193 |
| 642 | 3300048920 | Ga0496117_0022355 | Ga0496117_0022355_2619_3200 | 193 |
| 643 | 3300048920 | Ga0496117_0136882 | Ga0496117_0136882_661_1242 | 193 |
| 644 | 3300048921 | Ga0496118_0024508 | Ga0496118_0024508_3036_3617 | 193 |
| 645 | 3300048921 | Ga0496118_0181435 | Ga0496118_0181435_116_697 | 193 |
| 646 | 3300048925 | Ga0496122_0002359 | Ga0496122_0002359_23520_24101 | 193 |
| 647 | 3300048926 | Ga0496123_0000108 | Ga0496123_0000108_35650_36231 | 193 |
| 648 | 3300048927 | Ga0496124_0036322 | Ga0496124_0036322_787_1368 | 193 |
| 649 | 3300048927 | Ga0496124_0104238 | Ga0496124_0104238_1461_2042 | 193 |
| 650 | 3300048928 | Ga0496125_0220257 | Ga0496125_0220257_337_918 | 193 |
| 651 | 3300048929 | Ga0496126_0402889 | Ga0496126_0402889_466_1047 | 193 |
| 652 | 3300049572 | Ga0501036_0443683 | Ga0501036_0443683_52_633 | 193 |
| 653 | 3300049579 | Ga0501043_0067884 | Ga0501043_0067884_1452_2033 | 193 |
| 654 | 3300049581 | Ga0501047_0031795 | Ga0501047_0031795_535_1116 | 193 |
| 655 | 3300049742 | Ga0501080_0012035 | Ga0501080_0012035_1040_1621 | 193 |
| 656 | 3300049822 | Ga0501035_0068055 | Ga0501035_0068055_1875_2456 | 193 |
| 657 | 3300050490 | nmdc:mga03n38_45013_c1 | nmdc:mga03n38_45013_c1_1307_1888 | 193 |
| 658 | 3300050491 | nmdc:mga00v17_66700_c1 | nmdc:mga00v17_66700_c1_783_1364 | 193 |
| 659 | 3300050493 | nmdc:mga0k408_186334_c1 | nmdc:mga0k408_186334_c1_268_849 | 193 |
| 660 | 3300050493 | nmdc:mga0k408_20404_c1 | nmdc:mga0k408_20404_c1_2443_3024 | 193 |
| 661 | 3300053079 | Ga0500610_0040104 | Ga0500610_0040104_1415_1996 | 193 |
| 662 | 3300053087 | Ga0500643_003384 | Ga0500643_003384_5365_5946 | 193 |
| 663 | 3300053093 | Ga0500651_0000722 | Ga0500651_0000722_7762_8343 | 193 |
| 664 | 3300053110 | Ga0500571_000076 | Ga0500571_000076_8024_8605 | 193 |
| 665 | 3300053110 | Ga0500571_000362 | Ga0500571_000362_14835_15416 | 193 |
| 666 | 3300053117 | Ga0500593_000566 | Ga0500593_000566_671_1252 | 193 |
| 667 | 3300053117 | Ga0500593_021917 | Ga0500593_021917_725_1306 | 193 |
| 668 | 3300053118 | Ga0500594_0003094 | Ga0500594_0003094_2181_2762 | 193 |
| 669 | 3300053121 | Ga0500607_001562 | Ga0500607_001562_888_1469 | 193 |
| 670 | 3300053133 | Ga0500655_000498 | Ga0500655_000498_5387_5968 | 193 |
| 671 | 3300053134 | Ga0500658_0000096 | Ga0500658_0000096_10603_11184 | 193 |
| 672 | 3300053134 | Ga0500658_0000100 | Ga0500658_0000100_12796_13377 | 193 |
| 673 | 3300053134 | Ga0500658_0000990 | Ga0500658_0000990_4349_4930 | 193 |
| 674 | 3300053136 | Ga0500559_0001129 | Ga0500559_0001129_2931_3512 | 193 |
| 675 | 3300053138 | Ga0500564_003174 | Ga0500564_003174_4011_4592 | 193 |
| 676 | 3300053139 | Ga0500568_0011194 | Ga0500568_0011194_2985_3566 | 193 |
| 677 | 3300053153 | Ga0500616_0069130 | Ga0500616_0069130_716_1297 | 193 |
| 678 | 3300053156 | Ga0500622_0097970 | Ga0500622_0097970_112_693 | 193 |
| 679 | 3300053158 | Ga0500627_0001790 | Ga0500627_0001790_2343_2924 | 193 |
| 680 | 3300053161 | Ga0500634_0003015 | Ga0500634_0003015_3007_3588 | 193 |
| 681 | 3300053161 | Ga0500634_0051872 | Ga0500634_0051872_837_1418 | 193 |
| 682 | 3300061719 | Ga0466962_0130758 | Ga0466962_0130758_296_877 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2bkb-assembly2.cif.gz_C | q69e-fesod | 0.9745 | 3 | 192 |
| 1isc-assembly1.cif.gz_B | structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus | 0.9728 | 5 | 192 |
| 1za5-assembly1.cif.gz_B | q69h-fesod | 0.9726 | 3 | 192 |
| 1dt0-assembly2.cif.gz_C-2 | cloning, sequence, and crystallographic structure of recombinant iron superoxide dismutase from pseudomonas ovalis | 0.9708 | 3 | 193 |
| 4l2c-assembly1.cif.gz_B | x-ray structure of the c57r mutant of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form i) | 0.9704 | 3 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ceiB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9937 | 20 | 80 | 1.10.287.990 |
| 3ceiB01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain | 0.9475 | 20 | 80 | 1.10.287.990 |
| af_I1LCI3_113_243_3.55.40.20 | Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain | 0.9435 | 83 | 191 | 3.55.40.20 |
| af_A0A0R0EIY1_182_299_3.55.40.20 | Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain | 0.9426 | 87 | 192 | 3.55.40.20 |
| 1xuqA02 | Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain | 0.9402 | 83 | 192 | 3.55.40.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090RJ75-F1-model_v4 | Superoxide dismutase [Fe] (EC 1.15.1.1) | 0.9878 | 1 | 110 |
GO:0004784
GO:0046872 |
| AF-A0A429W4T7-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9859 | 26 | 193 |
GO:0004784
GO:0046872 |
| AF-A0A481PBD8-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9859 | 20 | 158 |
GO:0004784
GO:0046872 |
| AF-A0A554WLZ9-F1-model_v4 | Superoxide dismutase (EC 1.15.1.1) | 0.9858 | 1 | 192 |
GO:0004784
GO:0046872 |
| AF-D0IZW3-F1-model_v4 | deleted | 0.9858 | 3 | 192 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar