F474919

General Info

Members Datasets Scaffolds Average Seq Length
682 366 567 193

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0148979|Ga0316574_0148979_183_878
Length 231
Sequence MAEPLSGGPAIFGAALFLQRFHPYVLSGNSFHYEHRSLIMAHVLPPLPFAKDALEPVISAETIDYHYGKHHQAYVTNLNNLVPGTEFENATLEEIVMRSSGGIFNNAAQVWNHTFYWNGLSPDGGGQPGGALGAAIDKAFGSLDAFKEAFVKSAVGNFGSGWTWLVKNADGSVEIVNTSNAATPLRDGKTPLLTIDVWEHAYYIDYRNARPKYLEEIWKLVNWDFVSSNYG

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
8 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
9 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2519103095 Burkholderia sp. KJ006 Isolate Nodule
14 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
15 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
16 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
17 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
18 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
19 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
20 2643221559 Lysobacter sp. Root559 Isolate Unclassified
21 2643221569 Achromobacter sp. Root565 Isolate Unclassified
22 2643221573 Lysobacter sp. Root604 Isolate Unclassified
23 2643221586 Lysobacter sp. Root667 Isolate Unclassified
24 2643221594 Achromobacter sp. Root170 Isolate Unclassified
25 2643221612 Lysobacter sp. Root76 Isolate Unclassified
26 2643221621 Achromobacter sp. Root83 Isolate Unclassified
27 2643221720 Lysobacter sp. Root916 Isolate Unclassified
28 2643221727 Lysobacter sp. Root96 Isolate Unclassified
29 2643221728 Lysobacter sp. Root983 Isolate Unclassified
30 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
31 2738541307 Variovorax sp. GV008 Isolate Unclassified
32 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
33 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
34 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
35 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
36 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
37 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
38 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
39 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
40 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
41 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
42 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
43 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
44 2818991446 Variovorax sp. 1180 Isolate Unclassified
45 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
46 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
47 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
48 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
49 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
50 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
51 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
52 2858950400 Achromobacter sp. K91 Isolate Unclassified
53 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
54 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
55 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
56 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
57 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
58 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
59 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
60 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
61 2899924645 Variovorax sp. 369 Isolate Unclassified
62 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
63 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
64 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
65 2904564687 Burkholderia sp. 571 Isolate Unclassified
66 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
67 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
68 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
69 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
70 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
71 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
72 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
73 2928037797 Variovorax sp. 1126 Isolate Unclassified
74 2928044640 Variovorax sp. 1128 Isolate Unclassified
75 2928051484 Variovorax sp. 1133 Isolate Unclassified
76 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
77 2928070936 Variovorax gossypii 1167 Isolate Unclassified
78 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
79 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
80 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
81 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
82 2928163908 Burkholderia sp. 567 Isolate Unclassified
83 2928170801 Burkholderia sp. 572 Isolate Unclassified
84 2928536128 Burkholderia sola 565 Isolate Unclassified
85 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
86 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
87 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
88 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
89 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
90 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
91 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
92 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
93 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
94 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
95 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
96 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
97 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
98 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
99 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
100 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
101 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
102 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
103 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
104 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
105 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
112 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
113 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
114 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
115 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
116 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
117 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
118 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
122 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
123 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
126 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
127 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
128 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
129 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
130 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
133 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
134 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
135 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
136 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
137 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
138 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
139 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
140 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
141 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
142 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
143 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
144 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
145 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
146 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
149 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
150 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
151 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
154 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
158 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
159 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
160 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
161 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
173 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
178 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
189 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
191 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
233 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
234 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
235 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
236 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
237 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
238 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
239 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
240 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
241 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
242 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
243 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
247 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
248 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
254 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
255 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
256 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
257 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
268 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
269 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
272 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
273 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
274 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
275 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
276 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
277 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
278 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
279 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
280 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
281 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
282 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
283 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
284 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
285 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
286 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
287 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
295 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
307 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
338 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
341 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
342 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
343 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
346 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
347 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
352 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
353 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
354 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
355 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
356 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
357 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
358 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
359 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
360 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
361 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
362 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
363 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
364 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
365 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
366 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.61
Metatranscriptomes 9.53
Isolates 16.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.02
Nodule 1.47
Rhizoplane 3.23
Rhizosphere 51.47
Stem 0
Stem Tuber 0
Unclassified 20.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10051584 3300001979 Bacteria 1176
2 JGI24739J22299_10013502 3300001989 Bacteria 2982
3 JGI25158J39367_1011357 3300002739 Bacteria 1190
4 JGI25152J39213_1012314 3300002773 Bacteria 1844
5 JGI25159J45721_1001861 3300002987 Bacteria 8437
6 JGI25159J45721_1003820 3300002987 Bacteria 5184
7 JGI25159J45721_1004718 3300002987 Bacteria 4434
8 JGI25159J45721_1005899 3300002987 Bacteria 3766
9 JGI25151J46595_10013500 3300003187 Bacteria 3673
10 JGI25151J46595_10020267 3300003187 Bacteria 2806
11 JGI25151J46595_10029288 3300003187 Bacteria 2182
12 JGI25160J50197_1000646 3300003354 Bacteria 19384
13 JGI25160J50197_1000712 3300003354 Bacteria 18321
14 JGI25161J50226_1000018 3300003374 Bacteria 172599
15 JGI25161J50226_1002851 3300003374 Bacteria 4223
16 Ga0055525_1000013 3300003759 Bacteria 440870
17 Ga0055527_1005489 3300003760 Bacteria 1646
18 Ga0055526_1010564 3300003771 Bacteria 4276
19 Ga0055537_1001685 3300003773 Bacteria 8186
20 Ga0055537_1010093 3300003773 Bacteria 2019
21 Ga0055524_1000012 3300003775 Bacteria 260384
22 Ga0055536_1005421 3300003781 Bacteria 6243
23 Ga0055534_1003317 3300003784 Bacteria 5100
24 Ga0055534_1004663 3300003784 Bacteria 3889
25 Ga0055528_1000925 3300003790 Bacteria 19615
26 Ga0055528_1006458 3300003790 Bacteria 5318
27 Ga0055530_10002096 3300003791 Bacteria 13321
28 Ga0055530_10002329 3300003791 Bacteria 12409
29 Ga0055530_10047761 3300003791 Bacteria 1010
30 Ga0055540_1000012 3300003792 Bacteria 262667
31 Ga0055540_1027959 3300003792 Bacteria 1340
32 Ga0055531_10000345 3300003794 Bacteria 45594
33 Ga0055531_10004467 3300003794 Bacteria 8510
34 Ga0055531_10039699 3300003794 Bacteria 1393
35 Ga0055543_1001471 3300004625 Bacteria 9301
36 Ga0055543_1002402 3300004625 Bacteria 6223
37 Ga0065165_1029136 3300005262 Bacteria 1773
38 Ga0065165_1100907 3300005262 Bacteria 722
39 Ga0065704_10029721 3300005289 Bacteria 1509
40 Ga0070658_10020320 3300005327 Bacteria 5322
41 Ga0070658_10619094 3300005327 Bacteria 939
42 Ga0070676_10264626 3300005328 Bacteria 1153
43 Ga0070683_100005699 3300005329 Bacteria 10405
44 Ga0070683_100162463 3300005329 Bacteria 2119
45 Ga0070666_10267897 3300005335 Bacteria 1212
46 Ga0070666_10420055 3300005335 Bacteria 963
47 Ga0068868_100001942 3300005338 Bacteria 14183
48 Ga0070660_100075942 3300005339 Bacteria 2631
49 Ga0070660_100279113 3300005339 Bacteria 1367
50 Ga0070661_100277424 3300005344 Bacteria 1299
51 Ga0070669_100028621 3300005353 Bacteria 4013
52 Ga0070669_100102338 3300005353 Bacteria 2163
53 Ga0070675_100002690 3300005354 Bacteria 13361
54 Ga0070671_100305335 3300005355 Bacteria 1355
55 Ga0070674_100324362 3300005356 Bacteria 1236
56 Ga0070673_101389581 3300005364 Bacteria 661
57 Ga0070659_100078641 3300005366 Bacteria 2631
58 Ga0070659_100352569 3300005366 Bacteria 1235
59 Ga0070667_100240676 3300005367 Bacteria 1616
60 Ga0070667_100291034 3300005367 Bacteria 1469
61 Ga0070663_100459781 3300005455 Bacteria 1050
62 Ga0070662_100026589 3300005457 Bacteria 4009
63 Ga0070662_100094386 3300005457 Bacteria 2252
64 Ga0068867_100011231 3300005459 Bacteria 6317
65 Ga0070685_10828367 3300005466 Bacteria 684
66 Ga0070684_100032261 3300005535 Bacteria 4463
67 Ga0070684_100304994 3300005535 Bacteria 1461
68 Ga0068853_100055551 3300005539 Bacteria 3413
69 Ga0068853_100189388 3300005539 Bacteria 1868
70 Ga0070693_100087266 3300005547 Bacteria 1873
71 Ga0070693_100097492 3300005547 Bacteria 1784
72 Ga0068855_100023604 3300005563 Bacteria 7366
73 Ga0068857_100127738 3300005577 Bacteria 2291
74 Ga0068857_100520899 3300005577 Bacteria 1117
75 Ga0068854_100016635 3300005578 Bacteria 4907
76 Ga0068856_100063174 3300005614 Bacteria 3658
77 Ga0068856_100277837 3300005614 Bacteria 1691
78 Ga0068852_100032373 3300005616 Bacteria 4329
79 Ga0068852_100217522 3300005616 Bacteria 1815
80 Ga0068859_100217651 3300005617 Bacteria 1997
81 Ga0068864_100009238 3300005618 Bacteria 8129
82 Ga0068861_100005119 3300005719 Bacteria 8841
83 Ga0068851_10059805 3300005834 Bacteria 1949
84 Ga0068851_10104123 3300005834 Bacteria 1508
85 Ga0068858_100387511 3300005842 Bacteria 1341
86 Ga0068860_100008648 3300005843 Bacteria 10144
87 Ga0075365_10094215 3300006038 Bacteria 2043
88 Ga0075368_10024245 3300006042 Bacteria 2323
89 Ga0075363_100239812 3300006048 Bacteria 1042
90 Ga0075364_10006278 3300006051 Bacteria 6974
91 Ga0075364_10112903 3300006051 Bacteria 1814
92 Ga0075366_10016348 3300006195 Bacteria 4264
93 Ga0075366_10094424 3300006195 Bacteria 1793
94 Ga0075370_10367685 3300006353 Bacteria 860
95 Ga0068871_100087560 3300006358 Bacteria 2590
96 Ga0097620_100217652 3300006931 Bacteria 1997
97 Ga0105240_10000096 3300009093 Bacteria 179543
98 Ga0105240_10556401 3300009093 Bacteria 1268
99 Ga0105245_10036044 3300009098 Bacteria 4392
100 Ga0105248_10027182 3300009177 Bacteria 6364
101 Ga0105238_10060978 3300009551 Bacteria 3775
102 Ga0105238_10185754 3300009551 Bacteria 2055
103 Ga0105239_10275951 3300010375 Bacteria 1891
104 Ga0157346_1006907 3300012480 Bacteria 745
105 Ga0157319_1006742 3300012497 Bacteria 833
106 Ga0157347_1001688 3300012502 Bacteria 1781
107 Ga0157324_1001788 3300012506 Bacteria 1236
108 Ga0157326_1006688 3300012513 Bacteria 1235
109 Ga0157369_10018014 3300013105 Bacteria 7924
110 Ga0157374_10445067 3300013296 Bacteria 1296
111 Ga0163162_10030471 3300013306 Bacteria 5345
112 Ga0157372_10046609 3300013307 Bacteria 4812
113 Ga0157372_10056547 3300013307 Bacteria 4383
114 Ga0157375_11138664 3300013308 Bacteria 914
115 Ga0182008_10000664 3300014497 Bacteria 24934
116 Ga0157377_10005357 3300014745 Bacteria 6022
117 Ga0157376_10004653 3300014969 Bacteria 9562
118 Ga0182006_1063082 3300015261 Bacteria 1393
119 Ga0182007_10000468 3300015262 Bacteria 24418
120 Ga0182005_1098250 3300015265 Bacteria 819
121 Ga0183362_10001 3300015683 Bacteria 2046624
122 Ga0163161_10000142 3300017792 Bacteria 66331
123 Ga0163161_10000568 3300017792 Bacteria 29734
124 Ga0206351_10428386 3300020077 Bacteria 957
125 Ga0154015_1240110 3300020610 Bacteria 799
126 Ga0213872_10000160 3300021361 Bacteria 61551
127 Ga0213872_10000683 3300021361 Bacteria 25720
128 Ga0213872_10011112 3300021361 Bacteria 4266
129 Ga0209672_100354 3300025228 Bacteria 29117
130 Ga0209563_100025 3300025230 Bacteria 596456
131 Ga0209258_100015 3300025242 Bacteria 706310
132 Ga0207425_1000514 3300025245 Bacteria 23629
133 Ga0207425_1002389 3300025245 Bacteria 6644
134 Ga0209129_1000023 3300025258 Bacteria 420646
135 Ga0209129_1000049 3300025258 Bacteria 268086
136 Ga0209129_1001139 3300025258 Bacteria 15365
137 Ga0209565_1000004 3300025263 Bacteria 983150
138 Ga0209565_1000108 3300025263 Bacteria 120719
139 Ga0209565_1000187 3300025263 Bacteria 76001
140 Ga0209565_1000892 3300025263 Bacteria 16282
141 Ga0209673_1000074 3300025273 Bacteria 233552
142 Ga0209673_1000389 3300025273 Bacteria 79243
143 Ga0209673_1000477 3300025273 Bacteria 66849
144 Ga0209673_1000817 3300025273 Bacteria 41131
145 Ga0209130_1000050 3300025284 Bacteria 222092
146 Ga0209130_1000069 3300025284 Bacteria 179177
147 Ga0209130_1000267 3300025284 Bacteria 65435
148 Ga0209130_1000828 3300025284 Bacteria 26047
149 Ga0209130_1001005 3300025284 Bacteria 21918
150 Ga0209130_1001070 3300025284 Bacteria 20605
151 Ga0209675_1000044 3300025291 Bacteria 230392
152 Ga0209675_1000232 3300025291 Bacteria 56301
153 Ga0209675_1000398 3300025291 Bacteria 36047
154 Ga0209675_1001699 3300025291 Bacteria 12181
155 Ga0209675_1002669 3300025291 Bacteria 8997
156 Ga0209675_1003839 3300025291 Bacteria 6929
157 Ga0209675_1003844 3300025291 Bacteria 6927
158 Ga0209676_1000005 3300025292 Bacteria 1076001
159 Ga0209676_1000029 3300025292 Bacteria 520536
160 Ga0209676_1000137 3300025292 Bacteria 179437
161 Ga0209676_1000139 3300025292 Bacteria 177886
162 Ga0209676_1000416 3300025292 Bacteria 76249
163 Ga0209676_1001530 3300025292 Bacteria 21006
164 Ga0209676_1007648 3300025292 Bacteria 5012
165 Ga0209676_1009127 3300025292 Bacteria 4319
166 Ga0209025_1000313 3300025294 Bacteria 107850
167 Ga0209025_1000316 3300025294 Bacteria 107447
168 Ga0209025_1000481 3300025294 Bacteria 77405
169 Ga0209025_1005773 3300025294 Bacteria 9927
170 Ga0209025_1019202 3300025294 Bacteria 3815
171 Ga0209025_1024149 3300025294 Bacteria 3150
172 Ga0209025_1030246 3300025294 Bacteria 2597
173 Ga0209025_1047973 3300025294 Bacteria 1737
174 Ga0209564_1000090 3300025295 Bacteria 249298
175 Ga0209564_1000232 3300025295 Bacteria 122080
176 Ga0209564_1000303 3300025295 Bacteria 97431
177 Ga0209564_1001809 3300025295 Bacteria 19735
178 Ga0209564_1019681 3300025295 Bacteria 2511
179 Ga0209564_1023389 3300025295 Bacteria 2149
180 Ga0209758_1000044 3300025297 Bacteria 398448
181 Ga0209758_1000135 3300025297 Bacteria 177753
182 Ga0209758_1003942 3300025297 Bacteria 12892
183 Ga0209758_1009084 3300025297 Bacteria 6271
184 Ga0209050_1000003 3300025298 Bacteria 1609245
185 Ga0209050_1000007 3300025298 Bacteria 1187891
186 Ga0209050_1000015 3300025298 Bacteria 759102
187 Ga0209050_1015570 3300025298 Bacteria 3181
188 Ga0209050_1019571 3300025298 Bacteria 2564
189 Ga0209050_1047094 3300025298 Bacteria 1126
190 Ga0209256_1000001 3300025299 Bacteria 2166974
191 Ga0209256_1000020 3300025299 Bacteria 542402
192 Ga0209256_1000022 3300025299 Bacteria 481843
193 Ga0209256_1000129 3300025299 Bacteria 163766
194 Ga0209256_1000224 3300025299 Bacteria 104436
195 Ga0207426_1000001 3300025302 Bacteria 1341301
196 Ga0207426_1000031 3300025302 Bacteria 460699
197 Ga0207426_1000071 3300025302 Bacteria 329539
198 Ga0207426_1000171 3300025302 Bacteria 163766
199 Ga0207426_1000185 3300025302 Bacteria 154146
200 Ga0207426_1003300 3300025302 Bacteria 8974
201 Ga0209051_1000003 3300025303 Bacteria 1609245
202 Ga0209051_1000010 3300025303 Bacteria 641298
203 Ga0209051_1000036 3300025303 Bacteria 339863
204 Ga0209051_1001299 3300025303 Bacteria 21972
205 Ga0209051_1005858 3300025303 Bacteria 7068
206 Ga0209257_1000011 3300025304 Bacteria 1112630
207 Ga0209257_1000018 3300025304 Bacteria 836016
208 Ga0209257_1000026 3300025304 Bacteria 723225
209 Ga0209257_1000643 3300025304 Bacteria 55819
210 Ga0209257_1003639 3300025304 Bacteria 12958
211 Ga0209257_1004427 3300025304 Bacteria 10890
212 Ga0209257_1007677 3300025304 Bacteria 6445
213 Ga0209257_1014348 3300025304 Bacteria 3408
214 Ga0209257_1022304 3300025304 Bacteria 2263
215 Ga0207656_10121016 3300025321 Bacteria 1218
216 Ga0207643_10130029 3300025908 Bacteria 1498
217 Ga0207705_10511277 3300025909 Bacteria 933
218 Ga0207695_10000836 3300025913 Bacteria 56759
219 Ga0207695_10090050 3300025913 Bacteria 3084
220 Ga0207695_10160682 3300025913 Bacteria 2178
221 Ga0207657_10044124 3300025919 Bacteria 3922
222 Ga0207657_10235712 3300025919 Bacteria 1462
223 Ga0207681_10026743 3300025923 Bacteria 3725
224 Ga0207681_10044904 3300025923 Bacteria 2963
225 Ga0207694_10285023 3300025924 Bacteria 1357
226 Ga0207659_10305258 3300025926 Bacteria 1309
227 Ga0207687_10008809 3300025927 Bacteria 6594
228 Ga0207690_10031077 3300025932 Bacteria 3413
229 Ga0207690_10086483 3300025932 Bacteria 2203
230 Ga0207706_10144826 3300025933 Bacteria 2090
231 Ga0207706_10159295 3300025933 Bacteria 1985
232 Ga0207686_10329325 3300025934 Bacteria 1144
233 Ga0207709_10000195 3300025935 Bacteria 80988
234 Ga0207709_10000308 3300025935 Bacteria 53075
235 Ga0207709_10031504 3300025935 Bacteria 3098
236 Ga0207709_10071319 3300025935 Bacteria 2206
237 Ga0207691_10125601 3300025940 Bacteria 2270
238 Ga0207691_10134708 3300025940 Bacteria 2180
239 Ga0207691_10812940 3300025940 Bacteria 785
240 Ga0207711_10006066 3300025941 Bacteria 10211
241 Ga0207661_10454772 3300025944 Bacteria 1166
242 Ga0207679_10003805 3300025945 Bacteria 9356
243 Ga0207651_10652379 3300025960 Bacteria 924
244 Ga0207640_10089337 3300025981 Bacteria 2129
245 Ga0207640_10351508 3300025981 Bacteria 1184
246 Ga0207658_10225074 3300025986 Bacteria 1580
247 Ga0207677_10004412 3300026023 Bacteria 7546
248 Ga0207703_10113400 3300026035 Bacteria 2317
249 Ga0207639_10025273 3300026041 Bacteria 4306
250 Ga0207639_10424606 3300026041 Bacteria 1202
251 Ga0207639_10466622 3300026041 Bacteria 1149
252 Ga0207678_10069440 3300026067 Bacteria 3021
253 Ga0207678_10176402 3300026067 Bacteria 1825
254 Ga0207678_10404661 3300026067 Bacteria 1182
255 Ga0207702_10037173 3300026078 Bacteria 4074
256 Ga0207648_10010393 3300026089 Bacteria 8823
257 Ga0207648_10191097 3300026089 Bacteria 1814
258 Ga0207676_10009240 3300026095 Bacteria 7014
259 Ga0207676_10969178 3300026095 Bacteria 837
260 Ga0207674_10075700 3300026116 Bacteria 3375
261 Ga0207675_100001125 3300026118 Bacteria 26534
262 Ga0207675_100953003 3300026118 Bacteria 876
263 Ga0207683_10076632 3300026121 Bacteria 2961
264 Ga0207683_11011854 3300026121 Bacteria 771
265 Ga0207698_10005789 3300026142 Bacteria 7671
266 Ga0207698_10115999 3300026142 Bacteria 2256
267 Ga0207698_10167292 3300026142 Bacteria 1931
268 Ga0207698_10309110 3300026142 Bacteria 1475
269 Ga0209996_1003350 3300027395 Bacteria 2013
270 Ga0209982_1020102 3300027552 Bacteria 1025
271 Ga0209970_1015411 3300027614 Bacteria 1272
272 Ga0209983_1001258 3300027665 Bacteria 5634
273 Ga0209971_1001741 3300027682 Bacteria 5339
274 Ga0265319_1007769 3300028563 Bacteria 4778
275 Ga0265318_10075050 3300028577 Bacteria 1251
276 Ga0265322_10118519 3300028654 Bacteria 754
277 Ga0265336_10010251 3300028666 Bacteria 3213
278 Ga0307515_10000006 3300028794 Bacteria 725810
279 Ga0307515_10000484 3300028794 Bacteria 94947
280 Ga0307515_10000645 3300028794 Bacteria 80548
281 Ga0307515_10224088 3300028794 Bacteria 1690
282 Ga0307512_10216274 3300030522 Bacteria 1009
283 Ga0265330_10064418 3300031235 Bacteria 1592
284 Ga0265331_10042383 3300031250 Bacteria 2208
285 Ga0265327_10001152 3300031251 Bacteria 36013
286 Ga0265327_10006337 3300031251 Bacteria 9495
287 Ga0265327_10012819 3300031251 Bacteria 5621
288 Ga0307513_10000014 3300031456 Bacteria 303157
289 Ga0307513_10005720 3300031456 Bacteria 16360
290 Ga0307513_10016922 3300031456 Bacteria 8765
291 Ga0307514_10000645 3300031649 Bacteria 63434
292 Ga0316575_10075151 3300031665 Bacteria 1360
293 Ga0316575_10126717 3300031665 Bacteria 1046
294 Ga0316579_10002240 3300031691 Bacteria 7292
295 Ga0316579_10003273 3300031691 Bacteria 6288
296 Ga0316579_10010519 3300031691 Bacteria 3914
297 Ga0316579_10201963 3300031691 Bacteria 961
298 Ga0265314_10077616 3300031711 Bacteria 2202
299 Ga0265314_10104775 3300031711 Bacteria 1810
300 Ga0265342_10081430 3300031712 Bacteria 1869
301 Ga0316576_10003570 3300031727 Bacteria 9160
302 Ga0316576_10055018 3300031727 Bacteria 2903
303 Ga0316576_10066156 3300031727 Bacteria 2657
304 Ga0316576_10133575 3300031727 Bacteria 1867
305 Ga0316576_10335475 3300031727 Bacteria 1126
306 Ga0316578_10003048 3300031728 Bacteria 7556
307 Ga0316578_10015033 3300031728 Bacteria 4152
308 Ga0316578_10098879 3300031728 Bacteria 1748
309 Ga0316578_10109545 3300031728 Bacteria 1658
310 Ga0316578_10140245 3300031728 Bacteria 1456
311 Ga0316578_10175690 3300031728 Bacteria 1291
312 Ga0307516_10019943 3300031730 Bacteria 6931
313 Ga0307516_10422900 3300031730 Bacteria 990
314 Ga0316577_10015044 3300031733 Bacteria 4253
315 Ga0316577_10073228 3300031733 Bacteria 1913
316 Ga0307412_10002987 3300031911 Bacteria 9370
317 Ga0307412_10037397 3300031911 Bacteria 3118
318 Ga0307416_100019773 3300032002 Bacteria 4784
319 Ga0307411_10056745 3300032005 Bacteria 2583
320 Ga0307411_10131898 3300032005 Bacteria 1827
321 Ga0316583_10130134 3300032133 Bacteria 877
322 Ga0316585_10126701 3300032137 Bacteria 841
323 Ga0316580_10002554 3300032139 Bacteria 5033
324 Ga0316593_10002364 3300032168 Bacteria 4442
325 Ga0316593_10003182 3300032168 Bacteria 4032
326 Ga0316593_10011615 3300032168 Bacteria 2564
327 Ga0316593_10016894 3300032168 Bacteria 2219
328 Ga0316593_10027098 3300032168 Bacteria 1836
329 Ga0316593_10035974 3300032168 Bacteria 1631
330 Ga0316593_10040301 3300032168 Bacteria 1552
331 Ga0316593_10048579 3300032168 Bacteria 1428
332 Ga0316593_10056501 3300032168 Bacteria 1335
333 Ga0316593_10096907 3300032168 Bacteria 1043
334 Ga0316593_10136487 3300032168 Bacteria 887
335 Ga0316593_10138418 3300032168 Bacteria 881
336 Ga0316593_10168261 3300032168 Bacteria 803
337 Ga0316592_1005765 3300033524 Bacteria 2363
338 Ga0316592_1005989 3300033524 Bacteria 2329
339 Ga0316592_1006524 3300033524 Bacteria 2250
340 Ga0316592_1014320 3300033524 Bacteria 1644
341 Ga0316592_1015497 3300033524 Bacteria 1588
342 Ga0316592_1025700 3300033524 Bacteria 1270
343 Ga0316592_1032448 3300033524 Bacteria 1139
344 Ga0316592_1046083 3300033524 Bacteria 971
345 Ga0316592_1056442 3300033524 Bacteria 879
346 Ga0316592_1060559 3300033524 Bacteria 850
347 Ga0316592_1091733 3300033524 Bacteria 695
348 Ga0316592_1105740 3300033524 Bacteria 649
349 Ga0316586_1005274 3300033527 Bacteria 1808
350 Ga0316586_1019998 3300033527 Bacteria 1097
351 Ga0316586_1022006 3300033527 Bacteria 1057
352 Ga0316586_1033660 3300033527 Bacteria 884
353 Ga0316586_1038300 3300033527 Bacteria 837
354 Ga0316586_1043942 3300033527 Bacteria 791
355 Ga0316586_1051524 3300033527 Bacteria 737
356 Ga0316586_1055756 3300033527 Bacteria 712
357 Ga0316586_1062903 3300033527 Bacteria 676
358 Ga0316586_1075341 3300033527 Bacteria 625
359 Ga0316588_1037005 3300033528 Bacteria 1160
360 Ga0316588_1048864 3300033528 Bacteria 1024
361 Ga0316588_1053088 3300033528 Bacteria 984
362 Ga0316588_1065248 3300033528 Bacteria 891
363 Ga0316588_1084001 3300033528 Bacteria 790
364 Ga0316587_1002073 3300033529 Bacteria 2618
365 Ga0316587_1011428 3300033529 Bacteria 1433
366 Ga0316587_1016999 3300033529 Bacteria 1217
367 Ga0316587_1022838 3300033529 Bacteria 1074
368 Ga0316587_1022947 3300033529 Bacteria 1072
369 Ga0316587_1023026 3300033529 Bacteria 1071
370 Ga0316587_1024775 3300033529 Bacteria 1040
371 Ga0316587_1041169 3300033529 Bacteria 835
372 Ga0316587_1044244 3300033529 Bacteria 808
373 Ga0316587_1077153 3300033529 Bacteria 627
374 Ga0316596_1003281 3300033541 Bacteria 3525
375 Ga0316596_1010810 3300033541 Bacteria 2219
376 Ga0316596_1045748 3300033541 Bacteria 1155
377 Ga0316596_1048987 3300033541 Bacteria 1117
378 Ga0316596_1050494 3300033541 Bacteria 1100
379 Ga0316596_1050677 3300033541 Bacteria 1098
380 Ga0316596_1060385 3300033541 Bacteria 1011
381 Ga0316596_1082098 3300033541 Bacteria 866
382 Ga0316596_1086999 3300033541 Bacteria 841
383 Ga0316596_1092820 3300033541 Bacteria 814
384 Ga0316596_1103012 3300033541 Bacteria 773
385 Ga0316596_1108539 3300033541 Bacteria 753
386 Ga0316596_1151937 3300033541 Bacteria 636
387 Ga0373932_0079037 3300035112 Bacteria 1035
388 Ga0316574_0058769 3300035398 Bacteria 2409
389 Ga0316574_0059664 3300035398 Bacteria 2393
390 Ga0316574_0099246 3300035398 Bacteria 1863
391 Ga0316574_0103246 3300035398 Bacteria 1825
392 Ga0316574_0107635 3300035398 Bacteria 1786
393 Ga0316574_0115416 3300035398 Bacteria 1722
394 Ga0316574_0148979 3300035398 Bacteria 1508
395 Ga0316574_0166974 3300035398 Bacteria 1417
396 Ga0316574_0377019 3300035398 Bacteria 895
397 Ga0373931_0006809 3300035691 Bacteria 5370
398 Ga0373935_0036455 3300035692 Bacteria 3075
399 Ga0316582_0012859 3300036647 Bacteria 4689
400 Ga0316582_0078295 3300036647 Bacteria 2153
401 Ga0316582_0122101 3300036647 Bacteria 1744
402 Ga0316582_0147667 3300036647 Bacteria 1588
403 Ga0316582_0170244 3300036647 Bacteria 1478
404 Ga0316582_0273580 3300036647 Bacteria 1159
405 Ga0316582_0485939 3300036647 Bacteria 851
406 Ga0316582_0710343 3300036647 Bacteria 690
407 Ga0316582_0762336 3300036647 Bacteria 664
408 Ga0316582_0905104 3300036647 Bacteria 603
409 Ga0316584_0026869 3300036712 Bacteria 4233
410 Ga0316584_0027463 3300036712 Bacteria 4189
411 Ga0316584_0031441 3300036712 Bacteria 3925
412 Ga0316584_0089632 3300036712 Bacteria 2303
413 Ga0316584_0100914 3300036712 Bacteria 2161
414 Ga0395905_0098026 3300037471 Bacteria 2753
415 Ga0395905_0423867 3300037471 Bacteria 1227
416 Ga0395901_0028549 3300038443 Bacteria 5738
417 Ga0395901_0124059 3300038443 Bacteria 2714
418 Ga0395901_0221688 3300038443 Bacteria 1976
419 Ga0400484_13308 3300038725 Bacteria 6644
420 Ga0400484_15042 3300038725 Bacteria 13847
421 Ga0400484_26729 3300038725 Bacteria 9808
422 Ga0400484_39270 3300038725 Bacteria 2716
423 Ga0400490_10105 3300038726 Bacteria 13419
424 Ga0400490_18320 3300038726 Bacteria 13680
425 Ga0400490_22574 3300038726 Bacteria 43180
426 Ga0400490_37868 3300038726 Bacteria 1188
427 Ga0400490_41189 3300038726 Bacteria 1070
428 Ga0400490_49726 3300038726 Bacteria 10243
429 Ga0400490_50012 3300038726 Bacteria 56375
430 Ga0400491_17779 3300038727 Bacteria 4282
431 Ga0400491_26672 3300038727 Bacteria 5464
432 Ga0400485_01919 3300038735 Bacteria 1596
433 Ga0400485_04300 3300038735 Bacteria 7739
434 Ga0400485_05559 3300038735 Bacteria 72885
435 Ga0400485_13786 3300038735 Bacteria 18010
436 Ga0400488_08965 3300038741 Bacteria 1053
437 Ga0400488_15710 3300038741 Bacteria 1916
438 Ga0400488_16979 3300038741 Bacteria 10596
439 Ga0400488_24313 3300038741 Bacteria 3091
440 Ga0400488_24385 3300038741 Bacteria 1932
441 Ga0400488_31407 3300038741 Bacteria 3976
442 Ga0400488_56635 3300038741 Bacteria 33038
443 Ga0400486_08934 3300038742 Bacteria 14468
444 Ga0400486_11322 3300038742 Bacteria 2128
445 Ga0400486_19494 3300038742 Bacteria 5079
446 Ga0400486_22319 3300038742 Bacteria 3244
447 Ga0400486_24992 3300038742 Bacteria 6431
448 Ga0400486_25787 3300038742 Bacteria 5643
449 Ga0400486_29967 3300038742 Bacteria 2870
450 Ga0400483_019152 3300039062 Bacteria 1545
451 Ga0400483_040321 3300039062 Bacteria 8063
452 Ga0400483_047647 3300039062 Bacteria 12459
453 Ga0400483_072585 3300039062 Bacteria 6311
454 Ga0400483_079703 3300039062 Bacteria 1824
455 Ga0400483_088976 3300039062 Bacteria 6687
456 Ga0400483_153515 3300039062 Bacteria 9626
457 Ga0400483_166434 3300039062 Bacteria 4729
458 Ga0400483_168599 3300039062 Bacteria 24577
459 Ga0400483_178382 3300039062 Bacteria 4958
460 Ga0400483_204937 3300039062 Bacteria 1748
461 Ga0400483_211231 3300039062 Bacteria 2487
462 Ga0400483_216032 3300039062 Bacteria 21399
463 Ga0400483_225160 3300039062 Bacteria 9257
464 Ga0400489_87471 3300039093 Bacteria 26149
465 Ga0400487_02859 3300039110 Bacteria 42897
466 Ga0400487_09396 3300039110 Bacteria 8395
467 Ga0400487_23547 3300039110 Bacteria 12995
468 Ga0400487_25942 3300039110 Bacteria 30428
469 Ga0400487_47800 3300039110 Bacteria 3812
470 Ga0400487_59574 3300039110 Bacteria 28285
471 Ga0436361_0126586 3300039447 Bacteria 4704
472 Ga0436361_0144792 3300039447 Bacteria 34252
473 Ga0436361_0356304 3300039447 Bacteria 5683
474 Ga0436361_0362312 3300039447 Bacteria 55943
475 Ga0436361_1115566 3300039447 Bacteria 4061
476 Ga0451789_0672233 3300041443 Bacteria 810
477 Ga0451789_0928157 3300041443 Bacteria 837
478 Ga0451791_0854013 3300041451 Bacteria 1048
479 Ga0451807_0250850 3300041486 Bacteria 1605
480 Ga0451853_2770061 3300041512 Bacteria 697
481 Ga0439452_002182 3300042010 Bacteria 7394
482 Ga0451577_0217264 3300042876 Bacteria 1727
483 Ga0466972_0187443 3300044658 Bacteria 969
484 Ga0453683_0067092 3300044673 Bacteria 2242
485 Ga0466966_0135118 3300044684 Bacteria 1508
486 Ga0466966_0305749 3300044684 Bacteria 956
487 Ga0453684_0022605 3300044712 Bacteria 9318
488 Ga0466968_0012096 3300044735 Bacteria 3371
489 Ga0451576_0314312 3300045051 Bacteria 1639
490 Ga0495627_004217 3300046453 Bacteria 6082
491 Ga0495650_0010405 3300046471 Bacteria 5191
492 Ga0495606_0151747 3300046507 Bacteria 1359
493 Ga0495631_0000568 3300046518 Bacteria 24838
494 Ga0495637_0004150 3300046520 Bacteria 7543
495 Ga0495621_0008325 3300046539 Bacteria 3105
496 Ga0495597_0001974 3300046542 Bacteria 13773
497 Ga0495622_0084617 3300046557 Bacteria 1459
498 Ga0495668_0346696 3300046616 Bacteria 815
499 Ga0495625_0204142 3300046660 Bacteria 1302
500 Ga0495588_0019719 3300046674 Bacteria 3307
501 Ga0495658_0065504 3300046683 Bacteria 2096
502 Ga0495624_0391140 3300046690 Bacteria 835
503 Ga0495671_0001939 3300046692 Bacteria 13265
504 Ga0495660_0052927 3300046810 Bacteria 2205
505 Ga0495593_0007197 3300047673 Bacteria 6525
506 Ga0496101_0003658 3300048904 Bacteria 9595
507 Ga0496102_0041084 3300048905 Bacteria 4187
508 Ga0496103_0354740 3300048906 Bacteria 943
509 Ga0496104_0009648 3300048907 Bacteria 8597
510 Ga0496104_0188247 3300048907 Bacteria 1975
511 Ga0496105_0001498 3300048908 Bacteria 16500
512 Ga0496107_0014396 3300048910 Bacteria 5539
513 Ga0496108_0043636 3300048911 Bacteria 3745
514 Ga0496108_0052349 3300048911 Bacteria 3421
515 Ga0496109_0075662 3300048912 Bacteria 3096
516 Ga0496110_0066769 3300048913 Bacteria 3181
517 Ga0496112_0498757 3300048915 Bacteria 1153
518 Ga0496113_0082011 3300048916 Bacteria 2473
519 Ga0496113_0775009 3300048916 Bacteria 763
520 Ga0496114_0017437 3300048917 Bacteria 5796
521 Ga0496114_0019059 3300048917 Bacteria 5560
522 Ga0496115_0177701 3300048918 Bacteria 1760
523 Ga0496117_0022355 3300048920 Bacteria 5075
524 Ga0496117_0136882 3300048920 Bacteria 1474
525 Ga0496118_0024508 3300048921 Bacteria 5203
526 Ga0496118_0181435 3300048921 Bacteria 1271
527 Ga0496121_0000018 3300048924 Bacteria 542045
528 Ga0496121_0016542 3300048924 Bacteria 7609
529 Ga0496122_0002359 3300048925 Bacteria 27157
530 Ga0496123_0000108 3300048926 Bacteria 166102
531 Ga0496124_0036322 3300048927 Bacteria 4299
532 Ga0496124_0104238 3300048927 Bacteria 2293
533 Ga0496125_0220257 3300048928 Bacteria 1223
534 Ga0496126_0402889 3300048929 Bacteria 1109
535 Ga0501036_0443683 3300049572 Bacteria 1081
536 Ga0501043_0067884 3300049579 Bacteria 2800
537 Ga0501047_0031795 3300049581 Bacteria 5091
538 Ga0501080_0012035 3300049742 Bacteria 7925
539 Ga0501035_0068055 3300049822 Bacteria 3158
540 nmdc:mga03n38_45013_c1 3300050490 Bacteria 1941
541 nmdc:mga00v17_66700_c1 3300050491 Bacteria 2222
542 nmdc:mga0k408_186334_c1 3300050493 Bacteria 1238
543 nmdc:mga0k408_20404_c1 3300050493 Bacteria 3711
544 Ga0500610_0040104 3300053079 Bacteria 2418
545 Ga0500643_003384 3300053087 Bacteria 7710
546 Ga0500651_0000722 3300053093 Bacteria 16232
547 Ga0500555_006844 3300053103 Bacteria 3241
548 Ga0500571_000076 3300053110 Bacteria 30903
549 Ga0500571_000362 3300053110 Bacteria 17940
550 Ga0500593_000566 3300053117 Bacteria 14276
551 Ga0500593_021917 3300053117 Bacteria 2817
552 Ga0500594_0003094 3300053118 Bacteria 3639
553 Ga0500607_001562 3300053121 Bacteria 20266
554 Ga0500655_000498 3300053133 Bacteria 7923
555 Ga0500658_0000096 3300053134 Bacteria 40172
556 Ga0500658_0000100 3300053134 Bacteria 39487
557 Ga0500658_0000990 3300053134 Bacteria 11609
558 Ga0500559_0001129 3300053136 Bacteria 16078
559 Ga0500564_003174 3300053138 Bacteria 6307
560 Ga0500568_0011194 3300053139 Bacteria 4177
561 Ga0500616_0069130 3300053153 Bacteria 1806
562 Ga0500622_0000029 3300053156 Bacteria 213762
563 Ga0500622_0097970 3300053156 Bacteria 1448
564 Ga0500627_0001790 3300053158 Bacteria 6107
565 Ga0500634_0003015 3300053161 Bacteria 7350
566 Ga0500634_0051872 3300053161 Bacteria 2205
567 Ga0466962_0130758 3300061719 Bacteria 1213

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0166974 Ga0316574_0166974_403_987 183
2 3300036647 Ga0316582_0905104 Ga0316582_0905104_32_589 185
3 3300039062 Ga0400483_019152 Ga0400483_019152_10_570 185
4 iso_pu_bacteria 2501025501 2501075102 188
5 iso_pu_bacteria 2501025502 2501081795 188
6 iso_pu_bacteria 2501025504 2501408118 188
7 iso_pu_bacteria 2510917013 2511085730 188
8 iso_pu_bacteria 2510917014 2511095856 188
9 iso_pu_bacteria 2510917015 2511103391 188
10 iso_pu_bacteria 2511231003 2511248363 188
11 iso_pu_bacteria 2511231026 2511383359 188
12 iso_pu_bacteria 2513237082 2513556230 188
13 iso_pu_bacteria 2513237083 2513561417 188
14 iso_pu_bacteria 2515154189 2516020792 188
15 iso_pu_bacteria 2519103095 2519459585 188
16 iso_pu_bacteria 2521172590 2521557075 188
17 iso_pu_bacteria 2548876994 2550696966 188
18 iso_pu_bacteria 2548876994 2550696968 188
19 iso_pu_bacteria 2551306416 2553007982 188
20 iso_pu_bacteria 2582581311 2585291173 188
21 iso_pu_bacteria 2599185292 2599904911 188
22 iso_pu_bacteria 2643221559 2643816343 188
23 iso_pu_bacteria 2643221569 2643860454 188
24 iso_pu_bacteria 2643221573 2643881534 188
25 iso_pu_bacteria 2643221586 2643938970 188
26 iso_pu_bacteria 2643221594 2643981682 188
27 iso_pu_bacteria 2643221612 2644077287 188
28 iso_pu_bacteria 2643221621 2644119810 188
29 iso_pu_bacteria 2643221720 2644662670 188
30 iso_pu_bacteria 2643221727 2644694403 188
31 iso_pu_bacteria 2643221728 2644698376 188
32 iso_pu_bacteria 2728369097 2729146219 188
33 iso_pu_bacteria 2765235838 2765568211 188
34 iso_pu_bacteria 2808606384 2808973749 188
35 iso_pu_bacteria 2808606386 2808983570 188
36 iso_pu_bacteria 2808606390 2809008586 188
37 iso_pu_bacteria 2808606391 2809015685 188
38 iso_pu_bacteria 2808606395 2809035590 188
39 iso_pu_bacteria 2808606415 2809129234 188
40 iso_pu_bacteria 2808606419 2809149711 188
41 iso_pu_bacteria 2816332253 2817261866 188
42 iso_pu_bacteria 2816332256 2817279570 188
43 iso_pu_bacteria 2816332286 2817454322 188
44 iso_pu_bacteria 2818991445 2819594543 188
45 iso_pu_bacteria 2818991449 2819616746 188
46 iso_pu_bacteria 2839094727 2839097484 188
47 iso_pu_bacteria 2852618963 2852619865 188
48 iso_pu_bacteria 2856287931 2856292024 188
49 iso_pu_bacteria 2857357740 2857360575 188
50 iso_pu_bacteria 2857537821 2857539134 188
51 iso_pu_bacteria 2858950400 2858956031 188
52 iso_pu_bacteria 2863421361 2863425869 188
53 iso_pu_bacteria 2870068957 2870070387 188
54 iso_pu_bacteria 2883087390 2883095152 188
55 iso_pu_bacteria 2884811622 2884812199 188
56 iso_pu_bacteria 2884836552 2884839245 188
57 iso_pu_bacteria 2884852848 2884855536 188
58 iso_pu_bacteria 2894510363 2894514165 188
59 iso_pu_bacteria 2896154374 2896158957 188
60 iso_pu_bacteria 2904439833 2904440236 188
61 iso_pu_bacteria 2904530477 2904530854 188
62 iso_pu_bacteria 2904564687 2904569237 188
63 iso_pu_bacteria 2904571731 2904576455 188
64 iso_pu_bacteria 2904584206 2904585736 188
65 iso_pu_bacteria 2904589729 2904592451 188
66 iso_pu_bacteria 2904601388 2904601412 188
67 iso_pu_bacteria 2919046199 2919049875 188
68 iso_pu_bacteria 2919079590 2919082936 188
69 iso_pu_bacteria 2923510766 2923515712 188
70 iso_pu_bacteria 2928130867 2928134584 188
71 iso_pu_bacteria 2928157003 2928161339 188
72 iso_pu_bacteria 2928163908 2928168169 188
73 iso_pu_bacteria 2928170801 2928178548 188
74 iso_pu_bacteria 2928536128 2928541633 188
75 iso_pu_bacteria 2941479691 2941483822 188
76 iso_pu_bacteria 2981990288 2981993278 188
77 iso_pu_bacteria 2989392574 2989392925 188
78 iso_pu_bacteria 640427133 640489074 188
79 iso_pu_bacteria 641736154 642415617 188
80 iso_pu_bacteria 651053060 651177168 188
81 iso_pu_bacteria 8001522603 8001524091 188
82 iso_pu_bacteria 8003955200 8003957560 188
83 iso_pu_bacteria 8020807995 8020808245 188
84 iso_pu_bacteria 8020945358 8020950505 188
85 iso_pu_bacteria 8039098773 8039100860 188
86 iso_pu_bacteria 8040167225 8040169025 188
87 iso_pu_bacteria 8040173305 8040179306 188
88 iso_pu_bacteria 8055225921 8055228274 188
89 iso_pu_bacteria 2511231002 2511246185 189
90 iso_pu_bacteria 2600255067 2600814574 189
91 iso_pu_bacteria 2738541307 2738882143 189
92 iso_pu_bacteria 2818991446 2819595794 189
93 iso_pu_bacteria 2818991446 2819598078 189
94 iso_pu_bacteria 2838054893 2838057118 189
95 iso_pu_bacteria 2838054893 2838058489 189
96 iso_pu_bacteria 2899924645 2899925140 189
97 iso_pu_bacteria 2899924645 2899929495 189
98 iso_pu_bacteria 2904541872 2904543383 189
99 iso_pu_bacteria 2904541872 2904544710 189
100 iso_pu_bacteria 2928037797 2928038735 189
101 iso_pu_bacteria 2928037797 2928040059 189
102 iso_pu_bacteria 2928044640 2928045660 189
103 iso_pu_bacteria 2928044640 2928047192 189
104 iso_pu_bacteria 2928051484 2928053277 189
105 iso_pu_bacteria 2928051484 2928057607 189
106 iso_pu_bacteria 2928064002 2928066882 189
107 iso_pu_bacteria 2928064002 2928068011 189
108 iso_pu_bacteria 2928070936 2928071237 189
109 iso_pu_bacteria 2928070936 2928072587 189
110 iso_pu_bacteria 2928084124 2928084838 189
111 iso_pu_bacteria 2928084124 2928085762 189
112 iso_pu_bacteria 2928115317 2928116393 189
113 iso_pu_bacteria 2929160207 2929160616 189
114 iso_pu_bacteria 2929160207 2929163618 189
115 iso_pu_bacteria 2945909444 2945912302 189
116 iso_pu_bacteria 2945909444 2945914905 189
117 iso_pu_bacteria 2945984333 2945985385 189
118 iso_pu_bacteria 2945984333 2945989699 189
119 3300009093 Ga0105240_10000096 Ga0105240_10000096124 191
120 3300025913 Ga0207695_10000836 Ga0207695_1000083646 191
121 3300028654 Ga0265322_10118519 Ga0265322_101185191 191
122 3300028666 Ga0265336_10010251 Ga0265336_100102512 191
123 3300031691 Ga0316579_10003273 Ga0316579_100032738 191
124 3300031733 Ga0316577_10073228 Ga0316577_100732283 191
125 3300032168 Ga0316593_10035974 Ga0316593_100359742 191
126 3300033524 Ga0316592_1060559 Ga0316592_10605591 191
127 3300033541 Ga0316596_1050494 Ga0316596_10504941 191
128 3300036647 Ga0316582_0170244 Ga0316582_0170244_493_1071 191
129 3300044673 Ga0453683_0067092 Ga0453683_0067092_113_688 191
130 3300044712 Ga0453684_0022605 Ga0453684_0022605_8609_9184 191
131 3300053103 Ga0500555_006844 Ga0500555_006844_1586_2161 191
132 3300005616 Ga0068852_100032373 Ga0068852_1000323735 192
133 3300020077 Ga0206351_10428386 Ga0206351_104283862 192
134 3300020610 Ga0154015_1240110 Ga0154015_12401101 192
135 3300026142 Ga0207698_10005789 Ga0207698_100057893 192
136 3300027395 Ga0209996_1003350 Ga0209996_10033502 192
137 3300027552 Ga0209982_1020102 Ga0209982_10201022 192
138 3300027614 Ga0209970_1015411 Ga0209970_10154111 192
139 3300027665 Ga0209983_1001258 Ga0209983_10012585 192
140 3300027682 Ga0209971_1001741 Ga0209971_10017414 192
141 3300028563 Ga0265319_1007769 Ga0265319_10077692 192
142 3300028577 Ga0265318_10075050 Ga0265318_100750502 192
143 3300031251 Ga0265327_10001152 Ga0265327_1000115214 192
144 3300031665 Ga0316575_10075151 Ga0316575_100751511 192
145 3300031665 Ga0316575_10126717 Ga0316575_101267171 192
146 3300031691 Ga0316579_10002240 Ga0316579_100022402 192
147 3300031691 Ga0316579_10010519 Ga0316579_100105192 192
148 3300031691 Ga0316579_10201963 Ga0316579_102019632 192
149 3300031711 Ga0265314_10104775 Ga0265314_101047751 192
150 3300031727 Ga0316576_10003570 Ga0316576_100035705 192
151 3300031727 Ga0316576_10055018 Ga0316576_100550182 192
152 3300031727 Ga0316576_10066156 Ga0316576_100661563 192
153 3300031727 Ga0316576_10133575 Ga0316576_101335752 192
154 3300031727 Ga0316576_10335475 Ga0316576_103354752 192
155 3300031728 Ga0316578_10003048 Ga0316578_100030482 192
156 3300031728 Ga0316578_10015033 Ga0316578_100150335 192
157 3300031728 Ga0316578_10098879 Ga0316578_100988792 192
158 3300031728 Ga0316578_10109545 Ga0316578_101095452 192
159 3300031728 Ga0316578_10140245 Ga0316578_101402453 192
160 3300031728 Ga0316578_10175690 Ga0316578_101756902 192
161 3300031733 Ga0316577_10015044 Ga0316577_100150442 192
162 3300032133 Ga0316583_10130134 Ga0316583_101301341 192
163 3300032137 Ga0316585_10126701 Ga0316585_101267011 192
164 3300032139 Ga0316580_10002554 Ga0316580_100025546 192
165 3300032168 Ga0316593_10002364 Ga0316593_100023643 192
166 3300032168 Ga0316593_10003182 Ga0316593_100031823 192
167 3300032168 Ga0316593_10011615 Ga0316593_100116153 192
168 3300032168 Ga0316593_10016894 Ga0316593_100168942 192
169 3300032168 Ga0316593_10027098 Ga0316593_100270981 192
170 3300032168 Ga0316593_10040301 Ga0316593_100403012 192
171 3300032168 Ga0316593_10048579 Ga0316593_100485793 192
172 3300032168 Ga0316593_10056501 Ga0316593_100565011 192
173 3300032168 Ga0316593_10096907 Ga0316593_100969072 192
174 3300032168 Ga0316593_10136487 Ga0316593_101364871 192
175 3300032168 Ga0316593_10138418 Ga0316593_101384182 192
176 3300032168 Ga0316593_10168261 Ga0316593_101682611 192
177 3300033524 Ga0316592_1005765 Ga0316592_10057651 192
178 3300033524 Ga0316592_1005989 Ga0316592_10059893 192
179 3300033524 Ga0316592_1006524 Ga0316592_10065241 192
180 3300033524 Ga0316592_1014320 Ga0316592_10143202 192
181 3300033524 Ga0316592_1015497 Ga0316592_10154972 192
182 3300033524 Ga0316592_1025700 Ga0316592_10257002 192
183 3300033524 Ga0316592_1032448 Ga0316592_10324482 192
184 3300033524 Ga0316592_1046083 Ga0316592_10460831 192
185 3300033524 Ga0316592_1056442 Ga0316592_10564421 192
186 3300033524 Ga0316592_1091733 Ga0316592_10917331 192
187 3300033524 Ga0316592_1105740 Ga0316592_11057401 192
188 3300033527 Ga0316586_1005274 Ga0316586_10052742 192
189 3300033527 Ga0316586_1019998 Ga0316586_10199981 192
190 3300033527 Ga0316586_1022006 Ga0316586_10220061 192
191 3300033527 Ga0316586_1033660 Ga0316586_10336602 192
192 3300033527 Ga0316586_1038300 Ga0316586_10383001 192
193 3300033527 Ga0316586_1043942 Ga0316586_10439421 192
194 3300033527 Ga0316586_1051524 Ga0316586_10515241 192
195 3300033527 Ga0316586_1055756 Ga0316586_10557561 192
196 3300033527 Ga0316586_1062903 Ga0316586_10629031 192
197 3300033527 Ga0316586_1075341 Ga0316586_10753411 192
198 3300033528 Ga0316588_1037005 Ga0316588_10370052 192
199 3300033528 Ga0316588_1048864 Ga0316588_10488641 192
200 3300033528 Ga0316588_1053088 Ga0316588_10530882 192
201 3300033528 Ga0316588_1065248 Ga0316588_10652481 192
202 3300033528 Ga0316588_1084001 Ga0316588_10840011 192
203 3300033529 Ga0316587_1002073 Ga0316587_10020731 192
204 3300033529 Ga0316587_1011428 Ga0316587_10114281 192
205 3300033529 Ga0316587_1016999 Ga0316587_10169992 192
206 3300033529 Ga0316587_1022838 Ga0316587_10228381 192
207 3300033529 Ga0316587_1022947 Ga0316587_10229471 192
208 3300033529 Ga0316587_1023026 Ga0316587_10230261 192
209 3300033529 Ga0316587_1024775 Ga0316587_10247751 192
210 3300033529 Ga0316587_1041169 Ga0316587_10411691 192
211 3300033529 Ga0316587_1044244 Ga0316587_10442441 192
212 3300033529 Ga0316587_1077153 Ga0316587_10771531 192
213 3300033541 Ga0316596_1003281 Ga0316596_10032812 192
214 3300033541 Ga0316596_1010810 Ga0316596_10108102 192
215 3300033541 Ga0316596_1045748 Ga0316596_10457481 192
216 3300033541 Ga0316596_1048987 Ga0316596_10489871 192
217 3300033541 Ga0316596_1050677 Ga0316596_10506771 192
218 3300033541 Ga0316596_1060385 Ga0316596_10603852 192
219 3300033541 Ga0316596_1082098 Ga0316596_10820981 192
220 3300033541 Ga0316596_1086999 Ga0316596_10869991 192
221 3300033541 Ga0316596_1092820 Ga0316596_10928201 192
222 3300033541 Ga0316596_1103012 Ga0316596_11030121 192
223 3300033541 Ga0316596_1108539 Ga0316596_11085391 192
224 3300033541 Ga0316596_1151937 Ga0316596_11519371 192
225 3300035398 Ga0316574_0058769 Ga0316574_0058769_769_1347 192
226 3300035398 Ga0316574_0059664 Ga0316574_0059664_1688_2266 192
227 3300035398 Ga0316574_0099246 Ga0316574_0099246_328_906 192
228 3300035398 Ga0316574_0103246 Ga0316574_0103246_726_1307 192
229 3300035398 Ga0316574_0107635 Ga0316574_0107635_970_1548 192
230 3300035398 Ga0316574_0115416 Ga0316574_0115416_588_1166 192
231 3300035398 Ga0316574_0148979 Ga0316574_0148979_183_878 192
232 3300035398 Ga0316574_0377019 Ga0316574_0377019_95_673 192
233 3300035692 Ga0373935_0036455 Ga0373935_0036455_1101_1682 192
234 3300036647 Ga0316582_0012859 Ga0316582_0012859_30_608 192
235 3300036647 Ga0316582_0078295 Ga0316582_0078295_48_629 192
236 3300036647 Ga0316582_0122101 Ga0316582_0122101_23_604 192
237 3300036647 Ga0316582_0147667 Ga0316582_0147667_165_746 192
238 3300036647 Ga0316582_0273580 Ga0316582_0273580_385_963 192
239 3300036647 Ga0316582_0485939 Ga0316582_0485939_150_728 192
240 3300036647 Ga0316582_0710343 Ga0316582_0710343_25_606 192
241 3300036647 Ga0316582_0762336 Ga0316582_0762336_20_601 192
242 3300036712 Ga0316584_0026869 Ga0316584_0026869_722_1303 192
243 3300036712 Ga0316584_0027463 Ga0316584_0027463_1592_2173 192
244 3300036712 Ga0316584_0031441 Ga0316584_0031441_420_998 192
245 3300036712 Ga0316584_0089632 Ga0316584_0089632_601_1182 192
246 3300036712 Ga0316584_0100914 Ga0316584_0100914_492_1073 192
247 3300038725 Ga0400484_13308 Ga0400484_13308_5658_6239 192
248 3300038725 Ga0400484_15042 Ga0400484_15042_1296_1877 192
249 3300038725 Ga0400484_26729 Ga0400484_26729_9045_9629 192
250 3300038725 Ga0400484_39270 Ga0400484_39270_218_799 192
251 3300038726 Ga0400490_10105 Ga0400490_10105_324_905 192
252 3300038726 Ga0400490_18320 Ga0400490_18320_8738_9409 192
253 3300038726 Ga0400490_22574 Ga0400490_22574_16402_16983 192
254 3300038726 Ga0400490_37868 Ga0400490_37868_223_804 192
255 3300038726 Ga0400490_41189 Ga0400490_41189_137_718 192
256 3300038726 Ga0400490_49726 Ga0400490_49726_260_841 192
257 3300038726 Ga0400490_50012 Ga0400490_50012_3741_4322 192
258 3300038727 Ga0400491_17779 Ga0400491_17779_1148_1729 192
259 3300038727 Ga0400491_26672 Ga0400491_26672_1422_2003 192
260 3300038735 Ga0400485_01919 Ga0400485_01919_283_864 192
261 3300038735 Ga0400485_04300 Ga0400485_04300_3281_3862 192
262 3300038735 Ga0400485_05559 Ga0400485_05559_71782_72363 192
263 3300038735 Ga0400485_13786 Ga0400485_13786_5151_5732 192
264 3300038741 Ga0400488_08965 Ga0400488_08965_138_719 192
265 3300038741 Ga0400488_15710 Ga0400488_15710_1270_1887 192
266 3300038741 Ga0400488_16979 Ga0400488_16979_9511_10092 192
267 3300038741 Ga0400488_24313 Ga0400488_24313_385_966 192
268 3300038741 Ga0400488_24385 Ga0400488_24385_620_1198 192
269 3300038741 Ga0400488_31407 Ga0400488_31407_3024_3605 192
270 3300038741 Ga0400488_56635 Ga0400488_56635_24150_24731 192
271 3300038742 Ga0400486_08934 Ga0400486_08934_5147_5728 192
272 3300038742 Ga0400486_11322 Ga0400486_11322_727_1308 192
273 3300038742 Ga0400486_19494 Ga0400486_19494_2161_2742 192
274 3300038742 Ga0400486_22319 Ga0400486_22319_2199_2780 192
275 3300038742 Ga0400486_24992 Ga0400486_24992_855_1436 192
276 3300038742 Ga0400486_25787 Ga0400486_25787_2551_3132 192
277 3300038742 Ga0400486_29967 Ga0400486_29967_2190_2771 192
278 3300039062 Ga0400483_040321 Ga0400483_040321_4957_5538 192
279 3300039062 Ga0400483_047647 Ga0400483_047647_6302_6883 192
280 3300039062 Ga0400483_072585 Ga0400483_072585_4810_5391 192
281 3300039062 Ga0400483_079703 Ga0400483_079703_160_741 192
282 3300039062 Ga0400483_088976 Ga0400483_088976_5329_5910 192
283 3300039062 Ga0400483_153515 Ga0400483_153515_6493_7074 192
284 3300039062 Ga0400483_166434 Ga0400483_166434_4059_4640 192
285 3300039062 Ga0400483_168599 Ga0400483_168599_2748_3329 192
286 3300039062 Ga0400483_178382 Ga0400483_178382_2037_2618 192
287 3300039062 Ga0400483_204937 Ga0400483_204937_1059_1640 192
288 3300039062 Ga0400483_211231 Ga0400483_211231_721_1302 192
289 3300039062 Ga0400483_216032 Ga0400483_216032_4207_4788 192
290 3300039062 Ga0400483_225160 Ga0400483_225160_8239_8820 192
291 3300039093 Ga0400489_87471 Ga0400489_87471_298_879 192
292 3300039110 Ga0400487_02859 Ga0400487_02859_39338_39919 192
293 3300039110 Ga0400487_09396 Ga0400487_09396_7429_8010 192
294 3300039110 Ga0400487_23547 Ga0400487_23547_11275_11892 192
295 3300039110 Ga0400487_25942 Ga0400487_25942_8043_8624 192
296 3300039110 Ga0400487_47800 Ga0400487_47800_3207_3788 192
297 3300039110 Ga0400487_59574 Ga0400487_59574_27300_27881 192
298 3300045051 Ga0451576_0314312 Ga0451576_0314312_978_1559 192
299 3300048924 Ga0496121_0000018 Ga0496121_0000018_313316_313900 192
300 3300048924 Ga0496121_0016542 Ga0496121_0016542_4622_5200 192
301 3300053156 Ga0500622_0000029 Ga0500622_0000029_124363_124944 192
302 3300001979 JGI24740J21852_10051584 JGI24740J21852_100515842 193
303 3300001989 JGI24739J22299_10013502 JGI24739J22299_100135023 193
304 3300002739 JGI25158J39367_1011357 JGI25158J39367_10113572 193
305 3300002773 JGI25152J39213_1012314 JGI25152J39213_10123142 193
306 3300002987 JGI25159J45721_1001861 JGI25159J45721_10018616 193
307 3300002987 JGI25159J45721_1003820 JGI25159J45721_10038206 193
308 3300002987 JGI25159J45721_1004718 JGI25159J45721_10047183 193
309 3300002987 JGI25159J45721_1005899 JGI25159J45721_10058993 193
310 3300003187 JGI25151J46595_10013500 JGI25151J46595_100135005 193
311 3300003187 JGI25151J46595_10020267 JGI25151J46595_100202672 193
312 3300003187 JGI25151J46595_10029288 JGI25151J46595_100292882 193
313 3300003354 JGI25160J50197_1000646 JGI25160J50197_10006465 193
314 3300003354 JGI25160J50197_1000712 JGI25160J50197_100071211 193
315 3300003374 JGI25161J50226_1000018 JGI25161J50226_1000018173 193
316 3300003374 JGI25161J50226_1002851 JGI25161J50226_10028514 193
317 3300003759 Ga0055525_1000013 Ga0055525_1000013156 193
318 3300003760 Ga0055527_1005489 Ga0055527_10054892 193
319 3300003771 Ga0055526_1010564 Ga0055526_10105644 193
320 3300003773 Ga0055537_1001685 Ga0055537_10016854 193
321 3300003773 Ga0055537_1010093 Ga0055537_10100932 193
322 3300003775 Ga0055524_1000012 Ga0055524_100001211 193
323 3300003781 Ga0055536_1005421 Ga0055536_10054216 193
324 3300003784 Ga0055534_1003317 Ga0055534_10033174 193
325 3300003784 Ga0055534_1004663 Ga0055534_10046633 193
326 3300003790 Ga0055528_1000925 Ga0055528_100092518 193
327 3300003790 Ga0055528_1006458 Ga0055528_10064583 193
328 3300003791 Ga0055530_10002096 Ga0055530_1000209611 193
329 3300003791 Ga0055530_10002329 Ga0055530_1000232911 193
330 3300003791 Ga0055530_10047761 Ga0055530_100477612 193
331 3300003792 Ga0055540_1000012 Ga0055540_1000012129 193
332 3300003792 Ga0055540_1027959 Ga0055540_10279591 193
333 3300003794 Ga0055531_10000345 Ga0055531_1000034527 193
334 3300003794 Ga0055531_10004467 Ga0055531_100044674 193
335 3300003794 Ga0055531_10039699 Ga0055531_100396992 193
336 3300004625 Ga0055543_1001471 Ga0055543_10014717 193
337 3300004625 Ga0055543_1002402 Ga0055543_10024024 193
338 3300005262 Ga0065165_1029136 Ga0065165_10291363 193
339 3300005262 Ga0065165_1100907 Ga0065165_11009071 193
340 3300005289 Ga0065704_10029721 Ga0065704_100297212 193
341 3300005327 Ga0070658_10020320 Ga0070658_100203206 193
342 3300005327 Ga0070658_10619094 Ga0070658_106190942 193
343 3300005328 Ga0070676_10264626 Ga0070676_102646262 193
344 3300005329 Ga0070683_100005699 Ga0070683_10000569914 193
345 3300005329 Ga0070683_100162463 Ga0070683_1001624632 193
346 3300005335 Ga0070666_10267897 Ga0070666_102678972 193
347 3300005335 Ga0070666_10420055 Ga0070666_104200551 193
348 3300005338 Ga0068868_100001942 Ga0068868_10000194213 193
349 3300005339 Ga0070660_100075942 Ga0070660_1000759422 193
350 3300005339 Ga0070660_100279113 Ga0070660_1002791131 193
351 3300005344 Ga0070661_100277424 Ga0070661_1002774242 193
352 3300005353 Ga0070669_100028621 Ga0070669_1000286212 193
353 3300005353 Ga0070669_100102338 Ga0070669_1001023382 193
354 3300005354 Ga0070675_100002690 Ga0070675_10000269013 193
355 3300005355 Ga0070671_100305335 Ga0070671_1003053352 193
356 3300005356 Ga0070674_100324362 Ga0070674_1003243622 193
357 3300005364 Ga0070673_101389581 Ga0070673_1013895811 193
358 3300005366 Ga0070659_100078641 Ga0070659_1000786412 193
359 3300005366 Ga0070659_100352569 Ga0070659_1003525692 193
360 3300005367 Ga0070667_100240676 Ga0070667_1002406762 193
361 3300005367 Ga0070667_100291034 Ga0070667_1002910342 193
362 3300005455 Ga0070663_100459781 Ga0070663_1004597811 193
363 3300005457 Ga0070662_100026589 Ga0070662_1000265894 193
364 3300005457 Ga0070662_100094386 Ga0070662_1000943862 193
365 3300005459 Ga0068867_100011231 Ga0068867_1000112312 193
366 3300005466 Ga0070685_10828367 Ga0070685_108283671 193
367 3300005535 Ga0070684_100032261 Ga0070684_1000322616 193
368 3300005535 Ga0070684_100304994 Ga0070684_1003049943 193
369 3300005539 Ga0068853_100055551 Ga0068853_1000555513 193
370 3300005539 Ga0068853_100189388 Ga0068853_1001893881 193
371 3300005547 Ga0070693_100087266 Ga0070693_1000872662 193
372 3300005547 Ga0070693_100097492 Ga0070693_1000974922 193
373 3300005563 Ga0068855_100023604 Ga0068855_1000236046 193
374 3300005577 Ga0068857_100127738 Ga0068857_1001277382 193
375 3300005577 Ga0068857_100520899 Ga0068857_1005208991 193
376 3300005578 Ga0068854_100016635 Ga0068854_1000166354 193
377 3300005614 Ga0068856_100063174 Ga0068856_1000631745 193
378 3300005614 Ga0068856_100277837 Ga0068856_1002778372 193
379 3300005616 Ga0068852_100217522 Ga0068852_1002175222 193
380 3300005617 Ga0068859_100217651 Ga0068859_1002176512 193
381 3300005618 Ga0068864_100009238 Ga0068864_1000092387 193
382 3300005719 Ga0068861_100005119 Ga0068861_1000051195 193
383 3300005834 Ga0068851_10059805 Ga0068851_100598052 193
384 3300005834 Ga0068851_10104123 Ga0068851_101041233 193
385 3300005842 Ga0068858_100387511 Ga0068858_1003875113 193
386 3300005843 Ga0068860_100008648 Ga0068860_10000864814 193
387 3300006038 Ga0075365_10094215 Ga0075365_100942152 193
388 3300006042 Ga0075368_10024245 Ga0075368_100242453 193
389 3300006048 Ga0075363_100239812 Ga0075363_1002398121 193
390 3300006051 Ga0075364_10006278 Ga0075364_100062782 193
391 3300006051 Ga0075364_10112903 Ga0075364_101129032 193
392 3300006195 Ga0075366_10016348 Ga0075366_100163482 193
393 3300006195 Ga0075366_10094424 Ga0075366_100944242 193
394 3300006353 Ga0075370_10367685 Ga0075370_103676852 193
395 3300006358 Ga0068871_100087560 Ga0068871_1000875602 193
396 3300006931 Ga0097620_100217652 Ga0097620_1002176522 193
397 3300009093 Ga0105240_10556401 Ga0105240_105564012 193
398 3300009098 Ga0105245_10036044 Ga0105245_100360445 193
399 3300009177 Ga0105248_10027182 Ga0105248_100271825 193
400 3300009551 Ga0105238_10060978 Ga0105238_100609783 193
401 3300009551 Ga0105238_10185754 Ga0105238_101857543 193
402 3300010375 Ga0105239_10275951 Ga0105239_102759512 193
403 3300012480 Ga0157346_1006907 Ga0157346_10069072 193
404 3300012497 Ga0157319_1006742 Ga0157319_10067421 193
405 3300012502 Ga0157347_1001688 Ga0157347_10016882 193
406 3300012506 Ga0157324_1001788 Ga0157324_10017882 193
407 3300012513 Ga0157326_1006688 Ga0157326_10066882 193
408 3300013105 Ga0157369_10018014 Ga0157369_100180143 193
409 3300013296 Ga0157374_10445067 Ga0157374_104450672 193
410 3300013306 Ga0163162_10030471 Ga0163162_100304712 193
411 3300013307 Ga0157372_10046609 Ga0157372_100466093 193
412 3300013307 Ga0157372_10056547 Ga0157372_100565473 193
413 3300013308 Ga0157375_11138664 Ga0157375_111386642 193
414 3300014497 Ga0182008_10000664 Ga0182008_100006647 193
415 3300014745 Ga0157377_10005357 Ga0157377_100053575 193
416 3300014969 Ga0157376_10004653 Ga0157376_1000465312 193
417 3300015261 Ga0182006_1063082 Ga0182006_10630822 193
418 3300015262 Ga0182007_10000468 Ga0182007_100004686 193
419 3300015265 Ga0182005_1098250 Ga0182005_10982501 193
420 3300015683 Ga0183362_10001 Ga0183362_100011377 193
421 3300017792 Ga0163161_10000142 Ga0163161_100001423 193
422 3300017792 Ga0163161_10000568 Ga0163161_1000056819 193
423 3300021361 Ga0213872_10000160 Ga0213872_1000016058 193
424 3300021361 Ga0213872_10000683 Ga0213872_100006837 193
425 3300021361 Ga0213872_10011112 Ga0213872_100111125 193
426 3300025228 Ga0209672_100354 Ga0209672_10035417 193
427 3300025230 Ga0209563_100025 Ga0209563_100025430 193
428 3300025242 Ga0209258_100015 Ga0209258_100015118 193
429 3300025245 Ga0207425_1000514 Ga0207425_100051411 193
430 3300025245 Ga0207425_1002389 Ga0207425_10023894 193
431 3300025258 Ga0209129_1000023 Ga0209129_100002379 193
432 3300025258 Ga0209129_1000049 Ga0209129_1000049117 193
433 3300025258 Ga0209129_1001139 Ga0209129_100113914 193
434 3300025263 Ga0209565_1000004 Ga0209565_1000004623 193
435 3300025263 Ga0209565_1000108 Ga0209565_100010838 193
436 3300025263 Ga0209565_1000187 Ga0209565_100018757 193
437 3300025263 Ga0209565_1000892 Ga0209565_10008924 193
438 3300025273 Ga0209673_1000074 Ga0209673_1000074159 193
439 3300025273 Ga0209673_1000389 Ga0209673_100038957 193
440 3300025273 Ga0209673_1000477 Ga0209673_100047711 193
441 3300025273 Ga0209673_1000817 Ga0209673_100081738 193
442 3300025284 Ga0209130_1000050 Ga0209130_1000050173 193
443 3300025284 Ga0209130_1000069 Ga0209130_100006982 193
444 3300025284 Ga0209130_1000267 Ga0209130_100026760 193
445 3300025284 Ga0209130_1000828 Ga0209130_10008281 193
446 3300025284 Ga0209130_1001005 Ga0209130_100100510 193
447 3300025284 Ga0209130_1001070 Ga0209130_100107014 193
448 3300025291 Ga0209675_1000044 Ga0209675_100004446 193
449 3300025291 Ga0209675_1000232 Ga0209675_100023241 193
450 3300025291 Ga0209675_1000398 Ga0209675_100039832 193
451 3300025291 Ga0209675_1001699 Ga0209675_100169914 193
452 3300025291 Ga0209675_1002669 Ga0209675_10026697 193
453 3300025291 Ga0209675_1003839 Ga0209675_10038399 193
454 3300025291 Ga0209675_1003844 Ga0209675_10038444 193
455 3300025292 Ga0209676_1000005 Ga0209676_1000005737 193
456 3300025292 Ga0209676_1000029 Ga0209676_1000029278 193
457 3300025292 Ga0209676_1000137 Ga0209676_100013759 193
458 3300025292 Ga0209676_1000139 Ga0209676_1000139147 193
459 3300025292 Ga0209676_1000416 Ga0209676_100041614 193
460 3300025292 Ga0209676_1001530 Ga0209676_10015306 193
461 3300025292 Ga0209676_1007648 Ga0209676_10076485 193
462 3300025292 Ga0209676_1009127 Ga0209676_10091275 193
463 3300025294 Ga0209025_1000313 Ga0209025_100031315 193
464 3300025294 Ga0209025_1000316 Ga0209025_100031622 193
465 3300025294 Ga0209025_1000481 Ga0209025_100048115 193
466 3300025294 Ga0209025_1005773 Ga0209025_10057736 193
467 3300025294 Ga0209025_1019202 Ga0209025_10192023 193
468 3300025294 Ga0209025_1024149 Ga0209025_10241492 193
469 3300025294 Ga0209025_1030246 Ga0209025_10302464 193
470 3300025294 Ga0209025_1047973 Ga0209025_10479733 193
471 3300025295 Ga0209564_1000090 Ga0209564_1000090209 193
472 3300025295 Ga0209564_1000232 Ga0209564_100023236 193
473 3300025295 Ga0209564_1000303 Ga0209564_100030391 193
474 3300025295 Ga0209564_1001809 Ga0209564_100180917 193
475 3300025295 Ga0209564_1019681 Ga0209564_10196812 193
476 3300025295 Ga0209564_1023389 Ga0209564_10233892 193
477 3300025297 Ga0209758_1000044 Ga0209758_1000044348 193
478 3300025297 Ga0209758_1000135 Ga0209758_100013560 193
479 3300025297 Ga0209758_1003942 Ga0209758_10039424 193
480 3300025297 Ga0209758_1009084 Ga0209758_10090844 193
481 3300025298 Ga0209050_1000003 Ga0209050_1000003340 193
482 3300025298 Ga0209050_1000007 Ga0209050_1000007360 193
483 3300025298 Ga0209050_1000015 Ga0209050_1000015121 193
484 3300025298 Ga0209050_1015570 Ga0209050_10155704 193
485 3300025298 Ga0209050_1019571 Ga0209050_10195712 193
486 3300025298 Ga0209050_1047094 Ga0209050_10470942 193
487 3300025299 Ga0209256_1000001 Ga0209256_1000001344 193
488 3300025299 Ga0209256_1000020 Ga0209256_1000020351 193
489 3300025299 Ga0209256_1000022 Ga0209256_100002284 193
490 3300025299 Ga0209256_1000129 Ga0209256_100012960 193
491 3300025299 Ga0209256_1000224 Ga0209256_10002246 193
492 3300025302 Ga0207426_1000001 Ga0207426_1000001986 193
493 3300025302 Ga0207426_1000031 Ga0207426_1000031240 193
494 3300025302 Ga0207426_1000071 Ga0207426_100007183 193
495 3300025302 Ga0207426_1000171 Ga0207426_100017160 193
496 3300025302 Ga0207426_1000185 Ga0207426_100018552 193
497 3300025302 Ga0207426_1003300 Ga0207426_10033005 193
498 3300025303 Ga0209051_1000003 Ga0209051_1000003340 193
499 3300025303 Ga0209051_1000010 Ga0209051_1000010121 193
500 3300025303 Ga0209051_1000036 Ga0209051_100003688 193
501 3300025303 Ga0209051_1001299 Ga0209051_10012995 193
502 3300025303 Ga0209051_1005858 Ga0209051_10058582 193
503 3300025304 Ga0209257_1000011 Ga0209257_1000011711 193
504 3300025304 Ga0209257_1000018 Ga0209257_1000018340 193
505 3300025304 Ga0209257_1000026 Ga0209257_1000026557 193
506 3300025304 Ga0209257_1000643 Ga0209257_100064317 193
507 3300025304 Ga0209257_1003639 Ga0209257_100363911 193
508 3300025304 Ga0209257_1004427 Ga0209257_10044274 193
509 3300025304 Ga0209257_1007677 Ga0209257_10076772 193
510 3300025304 Ga0209257_1014348 Ga0209257_10143483 193
511 3300025304 Ga0209257_1022304 Ga0209257_10223044 193
512 3300025321 Ga0207656_10121016 Ga0207656_101210162 193
513 3300025908 Ga0207643_10130029 Ga0207643_101300292 193
514 3300025909 Ga0207705_10511277 Ga0207705_105112771 193
515 3300025913 Ga0207695_10090050 Ga0207695_100900502 193
516 3300025913 Ga0207695_10160682 Ga0207695_101606823 193
517 3300025919 Ga0207657_10044124 Ga0207657_100441244 193
518 3300025919 Ga0207657_10235712 Ga0207657_102357122 193
519 3300025923 Ga0207681_10026743 Ga0207681_100267432 193
520 3300025923 Ga0207681_10044904 Ga0207681_100449043 193
521 3300025924 Ga0207694_10285023 Ga0207694_102850232 193
522 3300025926 Ga0207659_10305258 Ga0207659_103052582 193
523 3300025927 Ga0207687_10008809 Ga0207687_100088095 193
524 3300025932 Ga0207690_10031077 Ga0207690_100310775 193
525 3300025932 Ga0207690_10086483 Ga0207690_100864833 193
526 3300025933 Ga0207706_10144826 Ga0207706_101448263 193
527 3300025933 Ga0207706_10159295 Ga0207706_101592952 193
528 3300025934 Ga0207686_10329325 Ga0207686_103293252 193
529 3300025935 Ga0207709_10000195 Ga0207709_1000019569 193
530 3300025935 Ga0207709_10000308 Ga0207709_1000030844 193
531 3300025935 Ga0207709_10031504 Ga0207709_100315042 193
532 3300025935 Ga0207709_10071319 Ga0207709_100713193 193
533 3300025940 Ga0207691_10125601 Ga0207691_101256014 193
534 3300025940 Ga0207691_10134708 Ga0207691_101347082 193
535 3300025940 Ga0207691_10812940 Ga0207691_108129401 193
536 3300025941 Ga0207711_10006066 Ga0207711_100060663 193
537 3300025944 Ga0207661_10454772 Ga0207661_104547721 193
538 3300025945 Ga0207679_10003805 Ga0207679_100038055 193
539 3300025960 Ga0207651_10652379 Ga0207651_106523792 193
540 3300025981 Ga0207640_10089337 Ga0207640_100893372 193
541 3300025981 Ga0207640_10351508 Ga0207640_103515081 193
542 3300025986 Ga0207658_10225074 Ga0207658_102250742 193
543 3300026023 Ga0207677_10004412 Ga0207677_100044125 193
544 3300026035 Ga0207703_10113400 Ga0207703_101134003 193
545 3300026041 Ga0207639_10025273 Ga0207639_100252732 193
546 3300026041 Ga0207639_10424606 Ga0207639_104246063 193
547 3300026041 Ga0207639_10466622 Ga0207639_104666222 193
548 3300026067 Ga0207678_10069440 Ga0207678_100694403 193
549 3300026067 Ga0207678_10176402 Ga0207678_101764022 193
550 3300026067 Ga0207678_10404661 Ga0207678_104046612 193
551 3300026078 Ga0207702_10037173 Ga0207702_100371733 193
552 3300026089 Ga0207648_10010393 Ga0207648_100103934 193
553 3300026089 Ga0207648_10191097 Ga0207648_101910972 193
554 3300026095 Ga0207676_10009240 Ga0207676_100092408 193
555 3300026095 Ga0207676_10969178 Ga0207676_109691782 193
556 3300026116 Ga0207674_10075700 Ga0207674_100757004 193
557 3300026118 Ga0207675_100001125 Ga0207675_10000112515 193
558 3300026118 Ga0207675_100953003 Ga0207675_1009530031 193
559 3300026121 Ga0207683_10076632 Ga0207683_100766322 193
560 3300026121 Ga0207683_11011854 Ga0207683_110118542 193
561 3300026142 Ga0207698_10115999 Ga0207698_101159992 193
562 3300026142 Ga0207698_10167292 Ga0207698_101672923 193
563 3300026142 Ga0207698_10309110 Ga0207698_103091102 193
564 3300028794 Ga0307515_10000006 Ga0307515_1000000691 193
565 3300028794 Ga0307515_10000484 Ga0307515_1000048479 193
566 3300028794 Ga0307515_10000645 Ga0307515_1000064540 193
567 3300028794 Ga0307515_10224088 Ga0307515_102240882 193
568 3300030522 Ga0307512_10216274 Ga0307512_102162741 193
569 3300031235 Ga0265330_10064418 Ga0265330_100644183 193
570 3300031250 Ga0265331_10042383 Ga0265331_100423832 193
571 3300031251 Ga0265327_10006337 Ga0265327_100063379 193
572 3300031251 Ga0265327_10012819 Ga0265327_100128193 193
573 3300031456 Ga0307513_10000014 Ga0307513_10000014254 193
574 3300031456 Ga0307513_10005720 Ga0307513_100057204 193
575 3300031456 Ga0307513_10016922 Ga0307513_100169228 193
576 3300031649 Ga0307514_10000645 Ga0307514_1000064534 193
577 3300031711 Ga0265314_10077616 Ga0265314_100776162 193
578 3300031712 Ga0265342_10081430 Ga0265342_100814302 193
579 3300031730 Ga0307516_10019943 Ga0307516_100199434 193
580 3300031730 Ga0307516_10422900 Ga0307516_104229001 193
581 3300031911 Ga0307412_10002987 Ga0307412_100029873 193
582 3300031911 Ga0307412_10037397 Ga0307412_100373972 193
583 3300032002 Ga0307416_100019773 Ga0307416_1000197734 193
584 3300032005 Ga0307411_10056745 Ga0307411_100567452 193
585 3300032005 Ga0307411_10131898 Ga0307411_101318982 193
586 3300035112 Ga0373932_0079037 Ga0373932_0079037_82_735 193
587 3300035691 Ga0373931_0006809 Ga0373931_0006809_4416_5069 193
588 3300037471 Ga0395905_0098026 Ga0395905_0098026_1455_2036 193
589 3300037471 Ga0395905_0423867 Ga0395905_0423867_67_648 193
590 3300038443 Ga0395901_0028549 Ga0395901_0028549_3622_4203 193
591 3300038443 Ga0395901_0124059 Ga0395901_0124059_424_1005 193
592 3300038443 Ga0395901_0221688 Ga0395901_0221688_1235_1816 193
593 3300039447 Ga0436361_0126586 Ga0436361_0126586_3872_4453 193
594 3300039447 Ga0436361_0144792 Ga0436361_0144792_17303_17884 193
595 3300039447 Ga0436361_0356304 Ga0436361_0356304_26_607 193
596 3300039447 Ga0436361_0362312 Ga0436361_0362312_31352_31933 193
597 3300039447 Ga0436361_1115566 Ga0436361_1115566_2022_2603 193
598 3300041443 Ga0451789_0672233 Ga0451789_0672233_174_755 193
599 3300041443 Ga0451789_0928157 Ga0451789_0928157_219_800 193
600 3300041451 Ga0451791_0854013 Ga0451791_0854013_78_659 193
601 3300041486 Ga0451807_0250850 Ga0451807_0250850_564_1187 193
602 3300041512 Ga0451853_2770061 Ga0451853_2770061_53_634 193
603 3300042010 Ga0439452_002182 Ga0439452_002182_4748_5329 193
604 3300042876 Ga0451577_0217264 Ga0451577_0217264_736_1317 193
605 3300044658 Ga0466972_0187443 Ga0466972_0187443_148_729 193
606 3300044684 Ga0466966_0135118 Ga0466966_0135118_417_998 193
607 3300044684 Ga0466966_0305749 Ga0466966_0305749_228_809 193
608 3300044735 Ga0466968_0012096 Ga0466968_0012096_125_706 193
609 3300046453 Ga0495627_004217 Ga0495627_004217_4512_5093 193
610 3300046471 Ga0495650_0010405 Ga0495650_0010405_2321_2902 193
611 3300046507 Ga0495606_0151747 Ga0495606_0151747_742_1323 193
612 3300046518 Ga0495631_0000568 Ga0495631_0000568_13600_14181 193
613 3300046520 Ga0495637_0004150 Ga0495637_0004150_1229_1810 193
614 3300046539 Ga0495621_0008325 Ga0495621_0008325_32_613 193
615 3300046542 Ga0495597_0001974 Ga0495597_0001974_1081_1662 193
616 3300046557 Ga0495622_0084617 Ga0495622_0084617_609_1190 193
617 3300046616 Ga0495668_0346696 Ga0495668_0346696_10_591 193
618 3300046660 Ga0495625_0204142 Ga0495625_0204142_48_629 193
619 3300046674 Ga0495588_0019719 Ga0495588_0019719_966_1547 193
620 3300046683 Ga0495658_0065504 Ga0495658_0065504_1259_1840 193
621 3300046690 Ga0495624_0391140 Ga0495624_0391140_25_606 193
622 3300046692 Ga0495671_0001939 Ga0495671_0001939_4947_5528 193
623 3300046810 Ga0495660_0052927 Ga0495660_0052927_625_1206 193
624 3300047673 Ga0495593_0007197 Ga0495593_0007197_5076_5657 193
625 3300048904 Ga0496101_0003658 Ga0496101_0003658_2441_3022 193
626 3300048905 Ga0496102_0041084 Ga0496102_0041084_577_1158 193
627 3300048906 Ga0496103_0354740 Ga0496103_0354740_230_883 193
628 3300048907 Ga0496104_0009648 Ga0496104_0009648_2474_3055 193
629 3300048907 Ga0496104_0188247 Ga0496104_0188247_1118_1771 193
630 3300048908 Ga0496105_0001498 Ga0496105_0001498_3826_4407 193
631 3300048910 Ga0496107_0014396 Ga0496107_0014396_3800_4453 193
632 3300048911 Ga0496108_0043636 Ga0496108_0043636_1810_2463 193
633 3300048911 Ga0496108_0052349 Ga0496108_0052349_813_1394 193
634 3300048912 Ga0496109_0075662 Ga0496109_0075662_1623_2207 193
635 3300048913 Ga0496110_0066769 Ga0496110_0066769_183_764 193
636 3300048915 Ga0496112_0498757 Ga0496112_0498757_387_1040 193
637 3300048916 Ga0496113_0082011 Ga0496113_0082011_1763_2416 193
638 3300048916 Ga0496113_0775009 Ga0496113_0775009_34_615 193
639 3300048917 Ga0496114_0017437 Ga0496114_0017437_1050_1703 193
640 3300048917 Ga0496114_0019059 Ga0496114_0019059_4793_5374 193
641 3300048918 Ga0496115_0177701 Ga0496115_0177701_460_1113 193
642 3300048920 Ga0496117_0022355 Ga0496117_0022355_2619_3200 193
643 3300048920 Ga0496117_0136882 Ga0496117_0136882_661_1242 193
644 3300048921 Ga0496118_0024508 Ga0496118_0024508_3036_3617 193
645 3300048921 Ga0496118_0181435 Ga0496118_0181435_116_697 193
646 3300048925 Ga0496122_0002359 Ga0496122_0002359_23520_24101 193
647 3300048926 Ga0496123_0000108 Ga0496123_0000108_35650_36231 193
648 3300048927 Ga0496124_0036322 Ga0496124_0036322_787_1368 193
649 3300048927 Ga0496124_0104238 Ga0496124_0104238_1461_2042 193
650 3300048928 Ga0496125_0220257 Ga0496125_0220257_337_918 193
651 3300048929 Ga0496126_0402889 Ga0496126_0402889_466_1047 193
652 3300049572 Ga0501036_0443683 Ga0501036_0443683_52_633 193
653 3300049579 Ga0501043_0067884 Ga0501043_0067884_1452_2033 193
654 3300049581 Ga0501047_0031795 Ga0501047_0031795_535_1116 193
655 3300049742 Ga0501080_0012035 Ga0501080_0012035_1040_1621 193
656 3300049822 Ga0501035_0068055 Ga0501035_0068055_1875_2456 193
657 3300050490 nmdc:mga03n38_45013_c1 nmdc:mga03n38_45013_c1_1307_1888 193
658 3300050491 nmdc:mga00v17_66700_c1 nmdc:mga00v17_66700_c1_783_1364 193
659 3300050493 nmdc:mga0k408_186334_c1 nmdc:mga0k408_186334_c1_268_849 193
660 3300050493 nmdc:mga0k408_20404_c1 nmdc:mga0k408_20404_c1_2443_3024 193
661 3300053079 Ga0500610_0040104 Ga0500610_0040104_1415_1996 193
662 3300053087 Ga0500643_003384 Ga0500643_003384_5365_5946 193
663 3300053093 Ga0500651_0000722 Ga0500651_0000722_7762_8343 193
664 3300053110 Ga0500571_000076 Ga0500571_000076_8024_8605 193
665 3300053110 Ga0500571_000362 Ga0500571_000362_14835_15416 193
666 3300053117 Ga0500593_000566 Ga0500593_000566_671_1252 193
667 3300053117 Ga0500593_021917 Ga0500593_021917_725_1306 193
668 3300053118 Ga0500594_0003094 Ga0500594_0003094_2181_2762 193
669 3300053121 Ga0500607_001562 Ga0500607_001562_888_1469 193
670 3300053133 Ga0500655_000498 Ga0500655_000498_5387_5968 193
671 3300053134 Ga0500658_0000096 Ga0500658_0000096_10603_11184 193
672 3300053134 Ga0500658_0000100 Ga0500658_0000100_12796_13377 193
673 3300053134 Ga0500658_0000990 Ga0500658_0000990_4349_4930 193
674 3300053136 Ga0500559_0001129 Ga0500559_0001129_2931_3512 193
675 3300053138 Ga0500564_003174 Ga0500564_003174_4011_4592 193
676 3300053139 Ga0500568_0011194 Ga0500568_0011194_2985_3566 193
677 3300053153 Ga0500616_0069130 Ga0500616_0069130_716_1297 193
678 3300053156 Ga0500622_0097970 Ga0500622_0097970_112_693 193
679 3300053158 Ga0500627_0001790 Ga0500627_0001790_2343_2924 193
680 3300053161 Ga0500634_0003015 Ga0500634_0003015_3007_3588 193
681 3300053161 Ga0500634_0051872 Ga0500634_0051872_837_1418 193
682 3300061719 Ga0466962_0130758 Ga0466962_0130758_296_877 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

128

229

0.97

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

41

121

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bkb-assembly2.cif.gz_C q69e-fesod 0.9745 3 192
1isc-assembly1.cif.gz_B structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus 0.9728 5 192
1za5-assembly1.cif.gz_B q69h-fesod 0.9726 3 192
1dt0-assembly2.cif.gz_C-2 cloning, sequence, and crystallographic structure of recombinant iron superoxide dismutase from pseudomonas ovalis 0.9708 3 193
4l2c-assembly1.cif.gz_B x-ray structure of the c57r mutant of the iron superoxide dismutase from pseudoalteromonas haloplanktis (crystal form i) 0.9704 3 193
ID Description Score Start End Superfamily
3ceiB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9937 20 80 1.10.287.990
3ceiB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9475 20 80 1.10.287.990
af_I1LCI3_113_243_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9435 83 191 3.55.40.20
af_A0A0R0EIY1_182_299_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9426 87 192 3.55.40.20
1xuqA02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9402 83 192 3.55.40.20
ID Description Score Start End GO Terms
AF-A0A090RJ75-F1-model_v4 Superoxide dismutase [Fe] (EC 1.15.1.1) 0.9878 1 110 GO:0004784
GO:0046872
AF-A0A429W4T7-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9859 26 193 GO:0004784
GO:0046872
AF-A0A481PBD8-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9859 20 158 GO:0004784
GO:0046872
AF-A0A554WLZ9-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9858 1 192 GO:0004784
GO:0046872
AF-D0IZW3-F1-model_v4 deleted 0.9858 3 192

Feature Viewer

pLDDT pTM Quality
96.65 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map